1AW6A

Gal4 (cd), nmr, 24 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords GAL4 (CD)
publication title Refined solution structure of the DNA-binding domain of GAL4 and use of 3J(113Cd,1H) in structure determination.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 4
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1997-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1aw6A00
1AJYA 1HWTC 2EREA 2ERGA 3COQA 3ALCA 1F4SP 2ER8A 1AW6A 1ZMEC 1F5EP 1D66A 1QP9A 1PYIA 1PYCA 2HAPC 2ALCA
chains in the Genus database with same CATH superfamily
1AJYA 1HWTC 2EREA 2ERGA 3COQA 3ALCA 1F4SP 2ER8A 1AW6A 1ZMEC 1F5EP 1D66A 1QP9A 1PYIA 1PYCA 2HAPC 2ALCA
chains in the Genus database with same CATH topology
1AJYA 1HWTC 2EREA 2ERGA 3COQA 3ALCA 1F4SP 2ER8A 1AW6A 1ZMEC 1F5EP 1D66A 1QP9A 1PYIA 1PYCA 2HAPC 2ALCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AJY A;  1HWT C;  2ERE A;  2ERG A;  3COQ A;  3ALC A;  1F4S P;  2ER8 A;  1AW6 A;  1ZME C;  1F5E P;  1D66 A;  1QP9 A;  1PYI A;  1PYC A;  2HAP C;  2ALC A; 
#chains in the Genus database with same CATH topology
 1AJY A;  1HWT C;  2ERE A;  2ERG A;  3COQ A;  3ALC A;  1F4S P;  2ER8 A;  1AW6 A;  1ZME C;  1F5E P;  1D66 A;  1QP9 A;  1PYI A;  1PYC A;  2HAP C;  2ALC A; 
#chains in the Genus database with same CATH homology
 1AJY A;  1HWT C;  2ERE A;  2ERG A;  3COQ A;  3ALC A;  1F4S P;  2ER8 A;  1AW6 A;  1ZME C;  1F5E P;  1D66 A;  1QP9 A;  1PYI A;  1PYC A;  2HAP C;  2ALC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...