1ZMEC

Crystal structure of put3/dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
70
structure length
70
Chain Sequence
SVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*CP*GP*GP*GP*AP*AP*GP*CP*CP*AP*AP*CP*TP*CP*CP*G
publication title Crystal structure of a PUT3-DNA complex reveals a novel mechanism for DNA recognition by a protein containing a Zn2Cys6 binuclear cluster.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 19
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zmeC02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1zmeC01
3H25A 1PYCA 2ERGA 1WMKA 2HAPC 1FDOA 1HWTC 1D66A 3IN6A 2P10A 3COQA 2ALCA 3O6QA 3EWKA 1QP9A 1F4SP 1FDIA 2G8YA 1PYIA 1AJYA 1ZMEC 1AW6A 3ALCA 2ER8A 1F5EP 2EREA 1OMIA
chains in the Genus database with same CATH superfamily
5KLIC 4Y99C 2A06D 3H32B 4PJ0E 1A02F 5APXA 2WMMA 2YKPA 2HPCB 3PP5A 1EC5A 3EWKA 1LNQA 3H1LG 3M9HA 3C1LA 1MZ9A 1SFCB 2JO1A 2KSEA 1NAYA 3L72G 1URQC 4GIFA 3H1HJ 3C9IA 3SFDC 4JF7A 3BVHA 2OYHB 3MD0A 2Y9YA 3COQA 2IZ0A 1KILC 3WUTA 1G2CA 2KK7A 2WITA 1AJYA 4IFDK 1DH3A 1R8EA 1S2EA 1IFMA 1FU1A 2IBZG 1FZBA 1HJ0A 1JY2N 5AW0B 3BATA 1YI2P 2ALCA 4I6MC 4ASWA 1NH4A 1SQVJ 1GZLA 3HD7A 1DIPA 1IO4A 5GTIH 5APUA 1KYOH 3WU2E 1PL5A 4W7YA 5AW4B 1G2CB 1S3JA 5AVZB 3MTUE 2WSCJ 1HH0A 1OXZA 4WY4C 1SQBE 2FXPA 1LTGC 1KZUB 5AVVB 2M3BA 3P8MC 5TISE 2FYNB 2W6AA 1N7SD 4RO0A 2Q6QA 4OGQC 1YIJP 1NAFA 2RMZA 3JC22 1RF0C 3HD7B 3IR9A 3OJAB 3E7KA 1PIXA 2Y0DA 1GK4A 3WMM0 3RL0g 1IJDB 1P84I 3V2RA 1JEKA 1F5EP 1USDA 1KD1Q 3FXEA 3Q3DA 3NXSA 4LGDE 3NMDA 1PYCA 3CWBG 2K9JA 1OWAA 1QVFO 1JTHA 2Q9IA 4XFJA 1JUNA 3MUDC 2WSEH 3H1JG 2JEEA 1L0LJ 3AECC 3CMAP 2E74D 1H88A 3TGUG 1KQGB 1NTZG 2NZ2A 3H1LD 2WWWA 1M56D 1NKZB 2HG5D 3L72D 1N7LA 3AE5C 4ZNCA 3L74J 1SQPG 1VDFA 2K9JB 5B66H 1JTHB 4JYBA 3V2PA 1AVYA 1LTBC 2YO3A 2QEXP 4PD4H 3RL0B 2FXMA 2AXTH 2V7QH 3ZDMA 3GG2A 5KKZB 3GMAA 1VQKP 1H89A 3B5ND 2IBZI 1PGJA 1KTMA 5AVUB 4C7NB 1VQOP 1ZR4A 1RY3A 1VQNP 5APQA 2D2CC 2J58A 5KAIH 4H13D 1BE3G 2OGUA 3A0BH 3CCJP 3I5CA 4GKGA 4DZOA 3CL3D 3OA7A 3GHGA 2MKVA 1NVOA 3AEBC 2E76C 3VP9A 1EXJA 3H1KJ 3IFMA 3HRNA 1RE3A 1FS0E 2YKQA 1L0NG 4AQRD 3F89A 3G3ZA 2POHA 4Y28J 2CPSA 3CCSP 1UIIA 5CCGC 4YTPC 1RF1A 3GHGB 1N2DC 1EXIA 4EIJA 2RN0A 3U1AA 4DCKA 1QGKB 2AEJA 4UB8H 3AE8C 2WPSA 4PD4E 2YO2A 3TGUD 2YMKA 1EQ7A 3MHVA 3O6QA 2WSSH 2Q7CA 1NTZK 1IFJA 1LT9A 1R5SA 4YXDC 3FWLA 4HJGH 1PPJE 1NTMJ 3H1IJ 5E79H 1RF1B 3HE5A 1ZP0C 4R4LA 1N7SB 1DEEG 1SQPK 2R32A 3CWBJ 5KAIE 1FZAA 1FZCA 4D6TE 3A0BE 2FFDB 2HR3A 3ABVC 2E75D 1S5LH 3RBZA 1VQ7P 1VQ6P 1JY3P 1Q2NA 2R5DA 3FWNA 1RE4C 1PPJD 3H1JJ 2B89A 5KLVJ 3O6QB 1IFNA 2QG4A 1GU4A 3BCCG 1MUUA 1S5LX 2NRGA 3RK3E 2ZJSE 1LT9B 3R2PA 1FJKA 1FDOA 5L8RJ 3L75E 1L4AD 3KPEA 2OYHC 1K9MQ 1VQPP 1YITP 1SFCD 5GTHH 1BSHA 2W83C 1BE3D 3LW5H 4N78E 1ZOYC 2PAJA 3RK3D 3USSA 3L75D 1FZFA 1YTZT 5CJ0A 5KAFH 5BU8B 1PGQA 3S4RA 3Q5PA 2E42A 3N4XA 1NU1J 2Q3EA 4WB4A 2UWJE 2XNDH 1DX7A 3A0HE 4NPFX 5CHXA 2WPQA 5CCHA 1L0ND 3PLNA 3V4WA 4XE5B 1L0NK 1T6AA 3V2NA 2WSFH 1TU3F 5AVWB 3B5NB 1KB9E 3BRTB 1YQ3C 3H6PA 3OAKA 2KLUA 2KOGA 4U3FJ 2A45I 4H13B 2W90A 2IYPA 2ZXXA 3KQGA 1S5LE 5CJ4A 4PJ0H 1KB9D 2J59M 4QMAA 1WMKA 5B5EH 3IF4A 2KI7B 2P10A 3M06A 4HB1A 2KXPB 1MV8A 3AE2C 3SWKA 1PV3A 2CPBA 3NFQA 5GTHE 4JQ0D 1SQXJ 2GUVA 3UIAA 3HTKA 1CZQA 1VQ8P 3IN6A 1ZRTE 2O01J 2PP6A 3HE4B 2WZ7A 3CCEP 4LLHA 2ZFCA 4A7PA 2Y9ZA 3V4QA 5KAFE 2M8RA 3A5TA 2YMYA 2HYNA 1YTZI 2R44A 3KYQA 4WBAA 4DJGA 3RL0C 2DW3A 4ZKPA 1ZRTD 1QEXA 2QJYB 3H1HE 1KQSO 1T8ZA 1L0LG 1XTGB 1PP9J 1T3JA 5AW3B 1OX3A 2LR2A 3MIWA 4L76A 2KLVA 3AE3C 3CXHI 3GF3A 3WU2H 1NTKJ 3AE7C 1L4AA 2A06E 2GM4A 2C0XA 1JOCA 1PGOA 3Q5RA 1FE6A 3BCCJ 1JNMA 4HYTB 3FXDA 1M1JA 3A2AA 3H1HD 3L74G 1QVGO 1OW7A 2K37A 2OTKE 2O1KA 2O3JA 2E75B 2B87A 2KSJA 1GU5A 1SQVE 1LTTC 3GF7A 1U57A 2L5GB 1OW6A 5H2FH 3AE6C 5APYA 3VMXA 4JBZA 1IC2A 3RGUA 3FGAD 5B5EE 3SFEC 1L4AB 1NKNA 2P58A 1JY3O 2H7HA 1M1JB 5AVYB 3B8EB 1SQVD 3AE1C 4N3YB 3L73J 1M8OB 3QWOC 1SQVK 2W6BA 4NPEA 1BCCJ 1WT6A 1EDJA 1NYHA 1GTWA 4H0LD 3RK3B 1S72P 1NWQA 3RBXA 2B87B 1AQTA 2L91A 4DOJA 1ZN5A 3KDPB 3D6YA 2W27A 3II6A 2Y0EA 1VL2A 3W67A 5AW9B 4C46A 3JSVC 1J1EB 3H1KG 2V4HA 3A7OA 3TF5A 2IDBA 1L0LE 1RF1C 2Q1KA 3D70A 2K3RA 1N7SC 1FOSF 3CCVP 3L70G 3Q2YA 4EDFA 2YKOA 3V2QA 1P84E 2SPZA 2E5YA 2FFDC 1OMIA 2B88A 3MP7B 1GK6A 2FY8A 3IAOA 1E5WA 1L0LD 3P32A 1H0TA 1GDTA 1L0LK 1GW3A 2XU6A 4LC1A 3JCUH 1LT9C 2VRSA 5H2FE 2BCCJ 4I7ZB 1P84D 4PV1B 4OH8B 1LP1A 1NTMG 1OW8A 3H1IG 1S1CX 1ZV8A 2WTYA 3L74D 2MJZA 1OVVA 1Q81Q 4OWFA 3I55P 2E74C 3CX5I 2OYIA 3H1LE 4JPZB 3D6ZA 1U7JA 2JR8A 1SS1A 3L72E 1H0TB 3OW2O 3TK1A 5KLVG 2JJLA 5K5GB 2ZVOB 4IFMA 1LP1B 2I1KA 2I8DA 2CK3H 1LTSC 1NJIQ 2YXRB 2E43A 1NOHA 2WPVB 1RQUA 5AVSB 4EYYQ 2OYIB 1PYIA 2IBZE 2R3CA 2RH0A 1KC8Q 2IZ1A 1SQBJ 3B5NC 2PFXA 1HUCA 1FOSE 3MZWB 4UB6H 3B71A 4H13C 2IBZD 3NTNA 1NU1G 3SWYA 4W80A 3H1KD 2NPSC 3V5BA 1HJBA 3JCUE 2GUSA 3O8ZA 1OIPA 1EDLA 5CCHD 3F5HA 1CI6A 4RESB 5KTBA 1IFIA 1KYOI 2ZAEB 1JB0J 4K35A 1JCCA 1HWTC 1MFTA 4U3FG 1URQA 4H0LB 2KB7P 4I1LA 3AEDC 2G8YA 3CWBE 1KILA 4BXLA 2XDJA 1NTMD 3H1ID 3H1JE 4GODA 1CI6B 1NTMK 1G1JA 2LKMA 2M0BA 3TGUE 2M5AA 1BGYJ 2QJYC 1NTZE 3L70J 3RK2C 3CWBD 1JY3N 1X0TA 1SQXG 2A45G 1KMIZ 2AEFA 1YJWP 3A0HH 2IYOA 3H1JD 5KLVD 1SQPE 4L75A 1YJ9P 5KLVK 3PTZA 4DT0A 1YHQP 1NTZD 2W6JH 4UB6E 4XA4A 2JDIH 4WY4A 4WVZA 4WWIA 1KB9H 2EREA 5DJUB 2E75C 2M5AB 1SQPD 2QM8A 1M1KQ 2ZT9D 1PP9G 3VOPA 5AW1B 5AW2B 1IFDA 1RF0A 4KT0J 2AEMA 3G6EP 1LGHB 2JWAA 1L4AC 1NTKG 1LTJA 2BASA 2K88A 5AVRB 1BE3E 1SFCC 3PH0A 1M1JC 2QA4P 1K04A 1ZR2A 2WSEJ 1NU1D 2HODA 1NU1K 1AV1A 3RK3C 3BASA 3AEAC 2FYUG 3HE5B 3MUDA 1E79H 1EDKA 4U3FE 1ZXGA 2FBWC 1QX8A 1GL2D 1DD3A 4U7JA 2KZJA 1FZCB 3GW6A 3MGNA 4AYCA 1LTJB 1L0NE 1SQQJ 1F4SP 2AXCA 1AVOA 3CXHH 5AW8B 1FZGA 1SP4A 2HODB 2QJKB 4U3FD 1VQ5P 3L73G 1BCCG 4B86A 2JWDA 2V7QJ 1SLQA 4GOFA 3CD6P 1FBMA 5C39A 1SQXE 3TYYA 4TT3H 1OVRA 4IFFA 4TLFA 1EZVG 3VMYA 3C8VA 3WUUA 1Z56A 1JO5A 2PGDA 1HBWA 5CBNA 1YJNP 2QE7H 1J1DB 1N73A 2FYNC 1GD2E 4D6TJ 2PRRA 1SVFA 2XZRA 1LT1A 1SQXD 3AE9C 3HD7C 1SQXK 4I7ZC 2E5TA 2WT7A 1X22A 1AW6A 3HUSA 2IX7C 3EFGA 3U1CA 1PP9E 2XV5A 3M0AA 3R4YA 1NTKE 2C0WA 4PV1D 4W7ZA 1N73B 3BCCE 3G71P 2WSCH 3CCQP 2Z5IA 1Q82Q 1PP9D 2QM7A 3LIEA 2KNCA 2KS1A 2ERGA 1NTKD 3T97A 2BCCG 2G3AA 3HUSB 4H44D 5CMZA 1NTKK 2Y0CA 3CC2P 3GLMA 4GDOA 3BCCD 1KFNA 1QP9A 1CW5A 4OVNF 1IFPA 1WRGA 4R4MA 3V6IA 1VQ4P 3L36A 3CXHE 1YBKA 3L71J 2FYUK 1H8AA 5AW5B 2P67A 3L73E 1AFOA 1BCCE 2QIWA 2KS1B 4KJMA 3HTKB 5KKZC 3T97B 3CXHD 1HTLC 1LWUA 1BDDA 2N9BA 1CSBA 2HAPC 3L73D 1X79B 3K5BA 1BCCD 1W5CE 3H32A 1P84H 2ZT9B 1T2KD 1GL2A 2HPCA 2FYUJ 1VF5D 4L73A 1SQBG 1EZVD 1EZVI 2QVAA 1LWUB 5KJ7D 3M9QA 4H0LC 3LW5J 2JP3A 2OYHA 3ALCA 3P8CD 1GL2B 1D66A 4C7RA 1KV4A 2N1TD 3GHGC 2Z4EA 2BCCE 1VQMP 4EI2A 1PFIA 1FDMA 2I1JA 1KN7A 2WPRA 1KILE 1RHZB 2HFED 2IFNA 5AW7B 1RE3C 1FAVA 1AA0A 2WSFJ 1QL2A 2BCCD 3ITKA 1URQD 3M9BA 1K8AQ 1KILD 3VP8A 5APTA 1BGYG 3AEFC 3S1KA 3L4FA 2LXBA 3KHUA 3L74E 4IL6E 3CX5E 1KQLA 4HKZH 1VQLP 2KP8A 1X8YA 2OTLP 4NPDA 1BSNA 3KZIH 4ASVA 2WQYC 3E1RA 3CPWO 2YIUB 4BRYA 1Q90D 4WY4D 5BU5A 3CX5D 1FZCC 4RJTA 1JY2P 5AVTB 1SQBD 1LTJC 1SQBK 4H44B 3E1IA 1G1IA 1FC2C 4OGQD 1NGMB 2OYOA 2HLOA 2QJKC 2BEZF 1DEBA 5APVA 4YPCA 4I2LC 1XTCC 1D7MA 3TSIA 1JM0A 4BRYB 3U59A 2BEQD 3CCLP 2QRXA 2QJPB 2H43A 2QSIA 2ITAA 1R5LA 2OTJP 5BVZA 1J1DC 4O9BA 3M0DA 1PZQA 3H1KE 3AEEC 5KJ7A 5M1BA 3VN0A 1SQQG 2FKWB 4C7NA 1S9KE 2KIKA 2XNXA 1A02J 3D71A 1GW4A 1FJPA 1IZNB 3L35A 1PGPA 3AEGC 1BGYE 3AE4C 1Q7YQ 1JMMA 1VF5B 2KYVA 5CCHC 3L70E 5GTIE 3H25A 1KYOE 3CMEP 1PPJG 2N1TA 2O01N 1S9KD 1HF9A 2ZYAA 1VPCA 1N73C 2KUBA 3H1LJ 1BGYD 3KZIE 4D6TG 1OFCX 3A3YB 3L70D 4KHXA 1KYOD 3L72J 1W2EA 1NTME 3H1IE 3HUSC 2J5UA 1K73Q 3FX0A 2NPSD 5CBOA 5DJTB 2N1TB 3L75G 5KLIB 3CC7P 2D2CD 4Y99B 2ZYDA 5KLVE 2P1JA 3SWFA 2XKMA 2C9NY 2FXOA 2K1AA 2O1JA 4EOTA 1EDIA 4GT1A 1NO4A 2K9YA 4M3LA 1AQ5A 1URQB 1VQ9P 2WVRA 3CCUP 3WUVA 2E76D 1YYCA 2A45H 1KILB 1W2BO 3B4SA 1N7SA 2O01H 2FYZA 2ZT9C 3L71G 1ZLLA 1MFZA 1GMJA 1KORA 5B66E 1LTAC 1SQQE 5CCGD 2ZYGA 3CLQA 2FFDA 3BRVB 1UIXA 1U7MA 2R3SA 2AXTE 3RK2D 2R5BA 1IK9A 1NU1E 3G9RA 2Z5HA 1LWUC 1DD4A 1N86A 1SQQD 1SQQK 2W8ZA 3VTPC 4HH2A 4PD4D 1HVVA 4PD4I 1Q86Q 4WY4B 1GL2C 2H88C 1JMBA 1M57D 1K05A 3EQ2A 1T3UA 3Q1MA 2H89C 4RKUJ 2YXQB 2ZXEB 4N6JA 4OGQB 3TGUJ 3VMAA 2RKLA 1JY2O 1NTZJ 3SSUA 5TJHA 4IOIH 4D6TD 3VYIA 1KFMA 1ZMEC 1J1EC 1M7LA 1SQPJ 3S9OA 2E74B 3PJSK 5APSA 1Y9BA 4JYCA 1IK7A 3LIDA 5AVXB 3B5NA 1RH5B 1L2PA 1N8RQ 2KZIA 4N78D 1USEA 1LJ2A 2Q5UA 3H1HG 1KQFB 1MKMA 2GA1A 1Y47A 4UB8E 3L71E 2NPSA 4CPGA 1BE3J 2A06G 4ZMDA 1ZW0A 2OQQA 4PV1C 4GOEA 1S4XA 1OZHA 2LXCB 5E79E 3L75J 3TNUA 3L37A 2YIUC 4AUWA 5EFWB 1X9VA 4ZKUA 3L71D 1SQVG 2Q3IA 4MN4C 1FZEA 2P2UA 4H44C 3CC4P 3VMZA 2NPSB 1QLED 3HE4A 1KB9I 3HD7D 3M91A 2D2CB 1L0NJ 2FYUE 1J2JB 3CI9A 2WT7B 3TDKA 2OARA 2H8PD 3TNUB 4BWNA 3QH9A 1FDIA 5CCGA 1M90Q 3I56P 2QJPC 3P7KA 1YQ4C 3G4SP 5AW6B 1Y8AA 1NHLA 1LTIC 2OYIC 3KXDA 2N9YB 2FYUD 2ZVNB 1BDCA 1OVUA 2IPPA 3PRJA 4L74A 2E76B 2KNCB 2YNYA 1HGVA 3EFFK 3Q5SA 3PHLA 4YXWH 3CCRP 3N7NA 1T2KC 1VF5C 2B9BA 1RQVA 1EZVE 5AVQB 3RK2B 3CCMP 3M0DC 2P7JA 2ER8A 5KJ7C 3RL0D 4IL6H 4K3AA 2M3EA 3CX5H 1JCDA 2IFMA 1RE4A 4Z1MH 3P8CE 1SFCA 2C9LY 3W68A 4IL6X 1HGZA 2JKVA 5APWA 5TISH 1QL1A 2N1TC
chains in the Genus database with same CATH topology
5KLIC 2IDBA 1KTMA 1KMIZ 3AE7C 4OGQB 2D2CB 2V7QJ 1YQ3C 1ZP0C 4R4LA 4OGQC 2D2CC 3Q5RA 1KILE 3D70A 4H13D 1PIXA 4TT3H 3EWKA 1OW7A 3RL0g 4H13B 3B71A 2BEQD 3Q2YA 2QIWA 3ABVC 2WSFJ 2E75D 1FDIA 4H13C 2QSIA 5KKZC 2QJPC 2K9YA 3T97B 1ZMEC 3C8VA 1YQ4C 2JO1A 1F5EP 2E75B 1OMIA 2EREA 3S9OA 3IAOA 2E74B 2E75C 3Q3DA 1S5LX 2FYNC 2MKVA 1Y9BA 3GF7A 1U57A 1PYCA 1OW6A 1WMKA 2E76D 3RK3E 3AEEC 1IK7A 3AE6C 5M1BA 2HAPC 5L8RJ 1FDOA 3SFDC 4XFJA 2ZT9D 2E76B 2P10A 3AE9C 3COQA 4I7ZB 3AEBC 3FGAD 3AEFC 2E76C 3SFEC 4I7ZC 4PV1B 4KT0J 2ZT9B 3AE2C 3D71A 1OW8A 1EXJA 2ZT9C 1AJYA 1AW6A 1S1CX 1VF5D 1PV3A 3AECC 3Q5SA 2E74D 1GMJA 1R8EA 3AEGC 1KORA 1ZOYC 3AE4C 3AE1C 1KQFB 1VF5B 3H25A 1KQGB 1UIXA 2NZ2A 1K04A 4Y28J 1VF5C 1MKMA 1JB0J 2E74C 1NYHA 4H0LD 2WSEJ 1HJ0A 1RQVA 3R4YA 3D6ZA 1HWTC 3IN6A 4YTPC 4PV1D 1ZRTE 2ALCA 2O01J 4H0LB 1EXIA 3AE5C 3G9RA 3AEAC 1HF9A 4H0LC 3LW5J 2JP3A 1DD4A 3AEDC 2G8YA 1DIPA 2OQQA 3Q5PA 2WQYC 4PV1C 3ALCA 2ER8A 2FBWC 3D6YA 1DD3A 4U7JA 1Q90D 1PL5A 1VL2A 2YIUC 2ERGA 3AE8C 4Z1MH 2G3AA 4H44D 1D66A 2H88C 2YMKA 4IL6X 2WSCJ 3O6QA 3GLMA 2FXPA 4GDOA 1K05A 2J5UA 4H44B 3GMAA 2QJYC 2WPVB 1QP9A 1RQUA 3Q1MA 1F4SP 4H44C 2H89C 4RKUJ 4YXDC 1PYIA 4R4MA 4OGQD 3AE3C 2D2CD 1NGMB 1TU3F 3GF3A 2QJKC 2BEZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H25 A;  1PYC A;  2ERG A;  1WMK A;  2HAP C;  1FDO A;  1HWT C;  1D66 A;  3IN6 A;  2P10 A;  3COQ A;  2ALC A;  3O6Q A;  3EWK A;  1QP9 A;  1F4S P;  1FDI A;  2G8Y A;  1PYI A;  1AJY A;  1ZME C;  1AW6 A;  3ALC A;  2ER8 A;  1F5E P;  2ERE A;  1OMI A; 
#chains in the Genus database with same CATH topology
 5KLI C;  4Y99 C;  2A06 D;  3H32 B;  4PJ0 E;  1A02 F;  5APX A;  2WMM A;  2YKP A;  2HPC B;  3PP5 A;  1EC5 A;  3EWK A;  1LNQ A;  3H1L G;  3M9H A;  3C1L A;  1MZ9 A;  1SFC B;  2JO1 A;  2KSE A;  1NAY A;  3L72 G;  1URQ C;  4GIF A;  3H1H J;  3C9I A;  3SFD C;  4JF7 A;  3BVH A;  2OYH B;  3MD0 A;  2Y9Y A;  3COQ A;  2IZ0 A;  1KIL C;  3WUT A;  1G2C A;  2KK7 A;  2WIT A;  1AJY A;  4IFD K;  1DH3 A;  1R8E A;  1S2E A;  1IFM A;  1FU1 A;  2IBZ G;  1FZB A;  1HJ0 A;  1JY2 N;  5AW0 B;  3BAT A;  1YI2 P;  2ALC A;  4I6M C;  4ASW A;  1NH4 A;  1SQV J;  1GZL A;  3HD7 A;  1DIP A;  1IO4 A;  5GTI H;  5APU A;  1KYO H;  3WU2 E;  1PL5 A;  4W7Y A;  5AW4 B;  1G2C B;  1S3J A;  5AVZ B;  3MTU E;  2WSC J;  1HH0 A;  1OXZ A;  4WY4 C;  1SQB E;  2FXP A;  1LTG C;  1KZU B;  5AVV B;  2M3B A;  3P8M C;  5TIS E;  2FYN B;  2W6A A;  1N7S D;  4RO0 A;  2Q6Q A;  4OGQ C;  1YIJ P;  1NAF A;  2RMZ A;  3JC2 2;  1RF0 C;  3HD7 B;  3IR9 A;  3OJA B;  3E7K A;  1PIX A;  2Y0D A;  1GK4 A;  3WMM 0;  3RL0 g;  1IJD B;  1P84 I;  3V2R A;  1JEK A;  1F5E P;  1USD A;  1KD1 Q;  3FXE A;  3Q3D A;  3NXS A;  4LGD E;  3NMD A;  1PYC A;  3CWB G;  2K9J A;  1OWA A;  1QVF O;  1JTH A;  2Q9I A;  4XFJ A;  1JUN A;  3MUD C;  2WSE H;  3H1J G;  2JEE A;  1L0L J;  3AEC C;  3CMA P;  2E74 D;  1H88 A;  3TGU G;  1KQG B;  1NTZ G;  2NZ2 A;  3H1L D;  2WWW A;  1M56 D;  1NKZ B;  2HG5 D;  3L72 D;  1N7L A;  3AE5 C;  4ZNC A;  3L74 J;  1SQP G;  1VDF A;  2K9J B;  5B66 H;  1JTH B;  4JYB A;  3V2P A;  1AVY A;  1LTB C;  2YO3 A;  2QEX P;  4PD4 H;  3RL0 B;  2FXM A;  2AXT H;  2V7Q H;  3ZDM A;  3GG2 A;  5KKZ B;  3GMA A;  1VQK P;  1H89 A;  3B5N D;  2IBZ I;  1PGJ A;  1KTM A;  5AVU B;  4C7N B;  1VQO P;  1ZR4 A;  1RY3 A;  1VQN P;  5APQ A;  2D2C C;  2J58 A;  5KAI H;  4H13 D;  1BE3 G;  2OGU A;  3A0B H;  3CCJ P;  3I5C A;  4GKG A;  4DZO A;  3CL3 D;  3OA7 A;  3GHG A;  2MKV A;  1NVO A;  3AEB C;  2E76 C;  3VP9 A;  1EXJ A;  3H1K J;  3IFM A;  3HRN A;  1RE3 A;  1FS0 E;  2YKQ A;  1L0N G;  4AQR D;  3F89 A;  3G3Z A;  2POH A;  4Y28 J;  2CPS A;  3CCS P;  1UII A;  5CCG C;  4YTP C;  1RF1 A;  3GHG B;  1N2D C;  1EXI A;  4EIJ A;  2RN0 A;  3U1A A;  4DCK A;  1QGK B;  2AEJ A;  4UB8 H;  3AE8 C;  2WPS A;  4PD4 E;  2YO2 A;  3TGU D;  2YMK A;  1EQ7 A;  3MHV A;  3O6Q A;  2WSS H;  2Q7C A;  1NTZ K;  1IFJ A;  1LT9 A;  1R5S A;  4YXD C;  3FWL A;  4HJG H;  1PPJ E;  1NTM J;  3H1I J;  5E79 H;  1RF1 B;  3HE5 A;  1ZP0 C;  4R4L A;  1N7S B;  1DEE G;  1SQP K;  2R32 A;  3CWB J;  5KAI E;  1FZA A;  1FZC A;  4D6T E;  3A0B E;  2FFD B;  2HR3 A;  3ABV C;  2E75 D;  1S5L H;  3RBZ A;  1VQ7 P;  1VQ6 P;  1JY3 P;  1Q2N A;  2R5D A;  3FWN A;  1RE4 C;  1PPJ D;  3H1J J;  2B89 A;  5KLV J;  3O6Q B;  1IFN A;  2QG4 A;  1GU4 A;  3BCC G;  1MUU A;  1S5L X;  2NRG A;  3RK3 E;  2ZJS E;  1LT9 B;  3R2P A;  1FJK A;  1FDO A;  5L8R J;  3L75 E;  1L4A D;  3KPE A;  2OYH C;  1K9M Q;  1VQP P;  1YIT P;  1SFC D;  5GTH H;  1BSH A;  2W83 C;  1BE3 D;  3LW5 H;  4N78 E;  1ZOY C;  2PAJ A;  3RK3 D;  3USS A;  3L75 D;  1FZF A;  1YTZ T;  5CJ0 A;  5KAF H;  5BU8 B;  1PGQ A;  3S4R A;  3Q5P A;  2E42 A;  3N4X A;  1NU1 J;  2Q3E A;  4WB4 A;  2UWJ E;  2XND H;  1DX7 A;  3A0H E;  4NPF X;  5CHX A;  2WPQ A;  5CCH A;  1L0N D;  3PLN A;  3V4W A;  4XE5 B;  1L0N K;  1T6A A;  3V2N A;  2WSF H;  1TU3 F;  5AVW B;  3B5N B;  1KB9 E;  3BRT B;  1YQ3 C;  3H6P A;  3OAK A;  2KLU A;  2KOG A;  4U3F J;  2A45 I;  4H13 B;  2W90 A;  2IYP A;  2ZXX A;  3KQG A;  1S5L E;  5CJ4 A;  4PJ0 H;  1KB9 D;  2J59 M;  4QMA A;  1WMK A;  5B5E H;  3IF4 A;  2KI7 B;  2P10 A;  3M06 A;  4HB1 A;  2KXP B;  1MV8 A;  3AE2 C;  3SWK A;  1PV3 A;  2CPB A;  3NFQ A;  5GTH E;  4JQ0 D;  1SQX J;  2GUV A;  3UIA A;  3HTK A;  1CZQ A;  1VQ8 P;  3IN6 A;  1ZRT E;  2O01 J;  2PP6 A;  3HE4 B;  2WZ7 A;  3CCE P;  4LLH A;  2ZFC A;  4A7P A;  2Y9Z A;  3V4Q A;  5KAF E;  2M8R A;  3A5T A;  2YMY A;  2HYN A;  1YTZ I;  2R44 A;  3KYQ A;  4WBA A;  4DJG A;  3RL0 C;  2DW3 A;  4ZKP A;  1ZRT D;  1QEX A;  2QJY B;  3H1H E;  1KQS O;  1T8Z A;  1L0L G;  1XTG B;  1PP9 J;  1T3J A;  5AW3 B;  1OX3 A;  2LR2 A;  3MIW A;  4L76 A;  2KLV A;  3AE3 C;  3CXH I;  3GF3 A;  3WU2 H;  1NTK J;  3AE7 C;  1L4A A;  2A06 E;  2GM4 A;  2C0X A;  1JOC A;  1PGO A;  3Q5R A;  1FE6 A;  3BCC J;  1JNM A;  4HYT B;  3FXD A;  1M1J A;  3A2A A;  3H1H D;  3L74 G;  1QVG O;  1OW7 A;  2K37 A;  2OTK E;  2O1K A;  2O3J A;  2E75 B;  2B87 A;  2KSJ A;  1GU5 A;  1SQV E;  1LTT C;  3GF7 A;  1U57 A;  2L5G B;  1OW6 A;  5H2F H;  3AE6 C;  5APY A;  3VMX A;  4JBZ A;  1IC2 A;  3RGU A;  3FGA D;  5B5E E;  3SFE C;  1L4A B;  1NKN A;  2P58 A;  1JY3 O;  2H7H A;  1M1J B;  5AVY B;  3B8E B;  1SQV D;  3AE1 C;  4N3Y B;  3L73 J;  1M8O B;  3QWO C;  1SQV K;  2W6B A;  4NPE A;  1BCC J;  1WT6 A;  1EDJ A;  1NYH A;  1GTW A;  4H0L D;  3RK3 B;  1S72 P;  1NWQ A;  3RBX A;  2B87 B;  1AQT A;  2L91 A;  4DOJ A;  1ZN5 A;  3KDP B;  3D6Y A;  2W27 A;  3II6 A;  2Y0E A;  1VL2 A;  3W67 A;  5AW9 B;  4C46 A;  3JSV C;  1J1E B;  3H1K G;  2V4H A;  3A7O A;  3TF5 A;  2IDB A;  1L0L E;  1RF1 C;  2Q1K A;  3D70 A;  2K3R A;  1N7S C;  1FOS F;  3CCV P;  3L70 G;  3Q2Y A;  4EDF A;  2YKO A;  3V2Q A;  1P84 E;  2SPZ A;  2E5Y A;  2FFD C;  1OMI A;  2B88 A;  3MP7 B;  1GK6 A;  2FY8 A;  3IAO A;  1E5W A;  1L0L D;  3P32 A;  1H0T A;  1GDT A;  1L0L K;  1GW3 A;  2XU6 A;  4LC1 A;  3JCU H;  1LT9 C;  2VRS A;  5H2F E;  2BCC J;  4I7Z B;  1P84 D;  4PV1 B;  4OH8 B;  1LP1 A;  1NTM G;  1OW8 A;  3H1I G;  1S1C X;  1ZV8 A;  2WTY A;  3L74 D;  2MJZ A;  1OVV A;  1Q81 Q;  4OWF A;  3I55 P;  2E74 C;  3CX5 I;  2OYI A;  3H1L E;  4JPZ B;  3D6Z A;  1U7J A;  2JR8 A;  1SS1 A;  3L72 E;  1H0T B;  3OW2 O;  3TK1 A;  5KLV G;  2JJL A;  5K5G B;  2ZVO B;  4IFM A;  1LP1 B;  2I1K A;  2I8D A;  2CK3 H;  1LTS C;  1NJI Q;  2YXR B;  2E43 A;  1NOH A;  2WPV B;  1RQU A;  5AVS B;  4EYY Q;  2OYI B;  1PYI A;  2IBZ E;  2R3C A;  2RH0 A;  1KC8 Q;  2IZ1 A;  1SQB J;  3B5N C;  2PFX A;  1HUC A;  1FOS E;  3MZW B;  4UB6 H;  3B71 A;  4H13 C;  2IBZ D;  3NTN A;  1NU1 G;  3SWY A;  4W80 A;  3H1K D;  2NPS C;  3V5B A;  1HJB A;  3JCU E;  2GUS A;  3O8Z A;  1OIP A;  1EDL A;  5CCH D;  3F5H A;  1CI6 A;  4RES B;  5KTB A;  1IFI A;  1KYO I;  2ZAE B;  1JB0 J;  4K35 A;  1JCC A;  1HWT C;  1MFT A;  4U3F G;  1URQ A;  4H0L B;  2KB7 P;  4I1L A;  3AED C;  2G8Y A;  3CWB E;  1KIL A;  4BXL A;  2XDJ A;  1NTM D;  3H1I D;  3H1J E;  4GOD A;  1CI6 B;  1NTM K;  1G1J A;  2LKM A;  2M0B A;  3TGU E;  2M5A A;  1BGY J;  2QJY C;  1NTZ E;  3L70 J;  3RK2 C;  3CWB D;  1JY3 N;  1X0T A;  1SQX G;  2A45 G;  1KMI Z;  2AEF A;  1YJW P;  3A0H H;  2IYO A;  3H1J D;  5KLV D;  1SQP E;  4L75 A;  1YJ9 P;  5KLV K;  3PTZ A;  4DT0 A;  1YHQ P;  1NTZ D;  2W6J H;  4UB6 E;  4XA4 A;  2JDI H;  4WY4 A;  4WVZ A;  4WWI A;  1KB9 H;  2ERE A;  5DJU B;  2E75 C;  2M5A B;  1SQP D;  2QM8 A;  1M1K Q;  2ZT9 D;  1PP9 G;  3VOP A;  5AW1 B;  5AW2 B;  1IFD A;  1RF0 A;  4KT0 J;  2AEM A;  3G6E P;  1LGH B;  2JWA A;  1L4A C;  1NTK G;  1LTJ A;  2BAS A;  2K88 A;  5AVR B;  1BE3 E;  1SFC C;  3PH0 A;  1M1J C;  2QA4 P;  1K04 A;  1ZR2 A;  2WSE J;  1NU1 D;  2HOD A;  1NU1 K;  1AV1 A;  3RK3 C;  3BAS A;  3AEA C;  2FYU G;  3HE5 B;  3MUD A;  1E79 H;  1EDK A;  4U3F E;  1ZXG A;  2FBW C;  1QX8 A;  1GL2 D;  1DD3 A;  4U7J A;  2KZJ A;  1FZC B;  3GW6 A;  3MGN A;  4AYC A;  1LTJ B;  1L0N E;  1SQQ J;  1F4S P;  2AXC A;  1AVO A;  3CXH H;  5AW8 B;  1FZG A;  1SP4 A;  2HOD B;  2QJK B;  4U3F D;  1VQ5 P;  3L73 G;  1BCC G;  4B86 A;  2JWD A;  2V7Q J;  1SLQ A;  4GOF A;  3CD6 P;  1FBM A;  5C39 A;  1SQX E;  3TYY A;  4TT3 H;  1OVR A;  4IFF A;  4TLF A;  1EZV G;  3VMY A;  3C8V A;  3WUU A;  1Z56 A;  1JO5 A;  2PGD A;  1HBW A;  5CBN A;  1YJN P;  2QE7 H;  1J1D B;  1N73 A;  2FYN C;  1GD2 E;  4D6T J;  2PRR A;  1SVF A;  2XZR A;  1LT1 A;  1SQX D;  3AE9 C;  3HD7 C;  1SQX K;  4I7Z C;  2E5T A;  2WT7 A;  1X22 A;  1AW6 A;  3HUS A;  2IX7 C;  3EFG A;  3U1C A;  1PP9 E;  2XV5 A;  3M0A A;  3R4Y A;  1NTK E;  2C0W A;  4PV1 D;  4W7Z A;  1N73 B;  3BCC E;  3G71 P;  2WSC H;  3CCQ P;  2Z5I A;  1Q82 Q;  1PP9 D;  2QM7 A;  3LIE A;  2KNC A;  2KS1 A;  2ERG A;  1NTK D;  3T97 A;  2BCC G;  2G3A A;  3HUS B;  4H44 D;  5CMZ A;  1NTK K;  2Y0C A;  3CC2 P;  3GLM A;  4GDO A;  3BCC D;  1KFN A;  1QP9 A;  1CW5 A;  4OVN F;  1IFP A;  1WRG A;  4R4M A;  3V6I A;  1VQ4 P;  3L36 A;  3CXH E;  1YBK A;  3L71 J;  2FYU K;  1H8A A;  5AW5 B;  2P67 A;  3L73 E;  1AFO A;  1BCC E;  2QIW A;  2KS1 B;  4KJM A;  3HTK B;  5KKZ C;  3T97 B;  3CXH D;  1HTL C;  1LWU A;  1BDD A;  2N9B A;  1CSB A;  2HAP C;  3L73 D;  1X79 B;  3K5B A;  1BCC D;  1W5C E;  3H32 A;  1P84 H;  2ZT9 B;  1T2K D;  1GL2 A;  2HPC A;  2FYU J;  1VF5 D;  4L73 A;  1SQB G;  1EZV D;  1EZV I;  2QVA A;  1LWU B;  5KJ7 D;  3M9Q A;  4H0L C;  3LW5 J;  2JP3 A;  2OYH A;  3ALC A;  3P8C D;  1GL2 B;  1D66 A;  4C7R A;  1KV4 A;  2N1T D;  3GHG C;  2Z4E A;  2BCC E;  1VQM P;  4EI2 A;  1PFI A;  1FDM A;  2I1J A;  1KN7 A;  2WPR A;  1KIL E;  1RHZ B;  2HFE D;  2IFN A;  5AW7 B;  1RE3 C;  1FAV A;  1AA0 A;  2WSF J;  1QL2 A;  2BCC D;  3ITK A;  1URQ D;  3M9B A;  1K8A Q;  1KIL D;  3VP8 A;  5APT A;  1BGY G;  3AEF C;  3S1K A;  3L4F A;  2LXB A;  3KHU A;  3L74 E;  4IL6 E;  3CX5 E;  1KQL A;  4HKZ H;  1VQL P;  2KP8 A;  1X8Y A;  2OTL P;  4NPD A;  1BSN A;  3KZI H;  4ASV A;  2WQY C;  3E1R A;  3CPW O;  2YIU B;  4BRY A;  1Q90 D;  4WY4 D;  5BU5 A;  3CX5 D;  1FZC C;  4RJT A;  1JY2 P;  5AVT B;  1SQB D;  1LTJ C;  1SQB K;  4H44 B;  3E1I A;  1G1I A;  1FC2 C;  4OGQ D;  1NGM B;  2OYO A;  2HLO A;  2QJK C;  2BEZ F;  1DEB A;  5APV A;  4YPC A;  4I2L C;  1XTC C;  1D7M A;  3TSI A;  1JM0 A;  4BRY B;  3U59 A;  2BEQ D;  3CCL P;  2QRX A;  2QJP B;  2H43 A;  2QSI A;  2ITA A;  1R5L A;  2OTJ P;  5BVZ A;  1J1D C;  4O9B A;  3M0D A;  1PZQ A;  3H1K E;  3AEE C;  5KJ7 A;  5M1B A;  3VN0 A;  1SQQ G;  2FKW B;  4C7N A;  1S9K E;  2KIK A;  2XNX A;  1A02 J;  3D71 A;  1GW4 A;  1FJP A;  1IZN B;  3L35 A;  1PGP A;  3AEG C;  1BGY E;  3AE4 C;  1Q7Y Q;  1JMM A;  1VF5 B;  2KYV A;  5CCH C;  3L70 E;  5GTI E;  3H25 A;  1KYO E;  3CME P;  1PPJ G;  2N1T A;  2O01 N;  1S9K D;  1HF9 A;  2ZYA A;  1VPC A;  1N73 C;  2KUB A;  3H1L J;  1BGY D;  3KZI E;  4D6T G;  1OFC X;  3A3Y B;  3L70 D;  4KHX A;  1KYO D;  3L72 J;  1W2E A;  1NTM E;  3H1I E;  3HUS C;  2J5U A;  1K73 Q;  3FX0 A;  2NPS D;  5CBO A;  5DJT B;  2N1T B;  3L75 G;  5KLI B;  3CC7 P;  2D2C D;  4Y99 B;  2ZYD A;  5KLV E;  2P1J A;  3SWF A;  2XKM A;  2C9N Y;  2FXO A;  2K1A A;  2O1J A;  4EOT A;  1EDI A;  4GT1 A;  1NO4 A;  2K9Y A;  4M3L A;  1AQ5 A;  1URQ B;  1VQ9 P;  2WVR A;  3CCU P;  3WUV A;  2E76 D;  1YYC A;  2A45 H;  1KIL B;  1W2B O;  3B4S A;  1N7S A;  2O01 H;  2FYZ A;  2ZT9 C;  3L71 G;  1ZLL A;  1MFZ A;  1GMJ A;  1KOR A;  5B66 E;  1LTA C;  1SQQ E;  5CCG D;  2ZYG A;  3CLQ A;  2FFD A;  3BRV B;  1UIX A;  1U7M A;  2R3S A;  2AXT E;  3RK2 D;  2R5B A;  1IK9 A;  1NU1 E;  3G9R A;  2Z5H A;  1LWU C;  1DD4 A;  1N86 A;  1SQQ D;  1SQQ K;  2W8Z A;  3VTP C;  4HH2 A;  4PD4 D;  1HVV A;  4PD4 I;  1Q86 Q;  4WY4 B;  1GL2 C;  2H88 C;  1JMB A;  1M57 D;  1K05 A;  3EQ2 A;  1T3U A;  3Q1M A;  2H89 C;  4RKU J;  2YXQ B;  2ZXE B;  4N6J A;  4OGQ B;  3TGU J;  3VMA A;  2RKL A;  1JY2 O;  1NTZ J;  3SSU A;  5TJH A;  4IOI H;  4D6T D;  3VYI A;  1KFM A;  1ZME C;  1J1E C;  1M7L A;  1SQP J;  3S9O A;  2E74 B;  3PJS K;  5APS A;  1Y9B A;  4JYC A;  1IK7 A;  3LID A;  5AVX B;  3B5N A;  1RH5 B;  1L2P A;  1N8R Q;  2KZI A;  4N78 D;  1USE A;  1LJ2 A;  2Q5U A;  3H1H G;  1KQF B;  1MKM A;  2GA1 A;  1Y47 A;  4UB8 E;  3L71 E;  2NPS A;  4CPG A;  1BE3 J;  2A06 G;  4ZMD A;  1ZW0 A;  2OQQ A;  4PV1 C;  4GOE A;  1S4X A;  1OZH A;  2LXC B;  5E79 E;  3L75 J;  3TNU A;  3L37 A;  2YIU C;  4AUW A;  5EFW B;  1X9V A;  4ZKU A;  3L71 D;  1SQV G;  2Q3I A;  4MN4 C;  1FZE A;  2P2U A;  4H44 C;  3CC4 P;  3VMZ A;  2NPS B;  1QLE D;  3HE4 A;  1KB9 I;  3HD7 D;  3M91 A;  2D2C B;  1L0N J;  2FYU E;  1J2J B;  3CI9 A;  2WT7 B;  3TDK A;  2OAR A;  2H8P D;  3TNU B;  4BWN A;  3QH9 A;  1FDI A;  5CCG A;  1M90 Q;  3I56 P;  2QJP C;  3P7K A;  1YQ4 C;  3G4S P;  5AW6 B;  1Y8A A;  1NHL A;  1LTI C;  2OYI C;  3KXD A;  2N9Y B;  2FYU D;  2ZVN B;  1BDC A;  1OVU A;  2IPP A;  3PRJ A;  4L74 A;  2E76 B;  2KNC B;  2YNY A;  1HGV A;  3EFF K;  3Q5S A;  3PHL A;  4YXW H;  3CCR P;  3N7N A;  1T2K C;  1VF5 C;  2B9B A;  1RQV A;  1EZV E;  5AVQ B;  3RK2 B;  3CCM P;  3M0D C;  2P7J A;  2ER8 A;  5KJ7 C;  3RL0 D;  4IL6 H;  4K3A A;  2M3E A;  3CX5 H;  1JCD A;  2IFM A;  1RE4 A;  4Z1M H;  3P8C E;  1SFC A;  2C9L Y;  3W68 A;  4IL6 X;  1HGZ A;  2JKV A;  5APW A;  5TIS H;  1QL1 A;  2N1T C; 
#chains in the Genus database with same CATH homology
 5KLI C;  2IDB A;  1KTM A;  1KMI Z;  3AE7 C;  4OGQ B;  2D2C B;  2V7Q J;  1YQ3 C;  1ZP0 C;  4R4L A;  4OGQ C;  2D2C C;  3Q5R A;  1KIL E;  3D70 A;  4H13 D;  1PIX A;  4TT3 H;  3EWK A;  1OW7 A;  3RL0 g;  4H13 B;  3B71 A;  2BEQ D;  3Q2Y A;  2QIW A;  3ABV C;  2WSF J;  2E75 D;  1FDI A;  4H13 C;  2QSI A;  5KKZ C;  2QJP C;  2K9Y A;  3T97 B;  1ZME C;  3C8V A;  1YQ4 C;  2JO1 A;  1F5E P;  2E75 B;  1OMI A;  2ERE A;  3S9O A;  3IAO A;  2E74 B;  2E75 C;  3Q3D A;  1S5L X;  2FYN C;  2MKV A;  1Y9B A;  3GF7 A;  1U57 A;  1PYC A;  1OW6 A;  1WMK A;  2E76 D;  3RK3 E;  3AEE C;  1IK7 A;  3AE6 C;  5M1B A;  2HAP C;  5L8R J;  1FDO A;  3SFD C;  4XFJ A;  2ZT9 D;  2E76 B;  2P10 A;  3AE9 C;  3COQ A;  4I7Z B;  3AEB C;  3FGA D;  3AEF C;  2E76 C;  3SFE C;  4I7Z C;  4PV1 B;  4KT0 J;  2ZT9 B;  3AE2 C;  3D71 A;  1OW8 A;  1EXJ A;  2ZT9 C;  1AJY A;  1AW6 A;  1S1C X;  1VF5 D;  1PV3 A;  3AEC C;  3Q5S A;  2E74 D;  1GMJ A;  1R8E A;  3AEG C;  1KOR A;  1ZOY C;  3AE4 C;  3AE1 C;  1KQF B;  1VF5 B;  3H25 A;  1KQG B;  1UIX A;  2NZ2 A;  1K04 A;  4Y28 J;  1VF5 C;  1MKM A;  1JB0 J;  2E74 C;  1NYH A;  4H0L D;  2WSE J;  1HJ0 A;  1RQV A;  3R4Y A;  3D6Z A;  1HWT C;  3IN6 A;  4YTP C;  4PV1 D;  1ZRT E;  2ALC A;  2O01 J;  4H0L B;  1EXI A;  3AE5 C;  3G9R A;  3AEA C;  1HF9 A;  4H0L C;  3LW5 J;  2JP3 A;  1DD4 A;  3AED C;  2G8Y A;  1DIP A;  2OQQ A;  3Q5P A;  2WQY C;  4PV1 C;  3ALC A;  2ER8 A;  2FBW C;  3D6Y A;  1DD3 A;  4U7J A;  1Q90 D;  1PL5 A;  1VL2 A;  2YIU C;  2ERG A;  3AE8 C;  4Z1M H;  2G3A A;  4H44 D;  1D66 A;  2H88 C;  2YMK A;  4IL6 X;  2WSC J;  3O6Q A;  3GLM A;  2FXP A;  4GDO A;  1K05 A;  2J5U A;  4H44 B;  3GMA A;  2QJY C;  2WPV B;  1QP9 A;  1RQU A;  3Q1M A;  1F4S P;  4H44 C;  2H89 C;  4RKU J;  4YXD C;  1PYI A;  4R4M A;  4OGQ D;  3AE3 C;  2D2C D;  1NGM B;  1TU3 F;  3GF3 A;  2QJK C;  2BEZ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...