1HWTC

Structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*GP*CP*GP*CP*TP*AP*TP*TP*AP*TP*CP*GP*CP*TP*AP*TP*T
total genus 22
structure length 70
sequence length 70
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hwtC02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1hwtC01
3V4QA 2R32A 5AVQB 3T97A 3KQGA 2KP8A 5APUA 5AW1B 2R5BA 3NFQA 3MGNA 1MFZA 1HBWA 5AVWB 4B86A 3L36A 3M0DA 2VRSA 3VMYA 3HE4A 3OAKA 1GTWA 1H88A 4I2LC 1PYCA 4AUWA 4GT1A 5AVZB 3LIDA 1CI6A 3VTPC 3COQA 5APTA 5AW3B 2EREA 2ALCA 2QM7A 2C9LY 3V5BA 1J2JB 2Q3IA 5APQA 5APWA 1GU5A 5AW6B 2WWWA 1CZQA 2ZFCA 3I5CA 2R3CA 4GKGA 1SLQA 3P32A 4RESB 1S9KE 1JNMA 2WPRA 1MUUA 5AVUB 5AVRB 4HYTB 3M91A 5AW2B 2Q7CA 1FOSE 1KQLA 1H8AA 3A5TA 4EOTA 2P67A 3L37A 2WT7A 3NXSA 2WPQA 5AVYB 3HTKA 3M9HA 1CI6B 5AVTB 2IPPA 1T2KD 2ERGA 3VN0A 1AW6A 3TYYA 2HAPC 3VYIA 1YYCA 3NMDA 3O8ZA 3HE4B 1HUCA 2YO2A 1SP4A 3P7KA 1IO4A 2XZRA 2C9NY 1GU4A 1MV8A 4XE5B 1A02J 1D66A 1DH3A 2YO3A 3B8EB 3NTNA 3VMXA 4M3LA 2ER8A 3M9BA 1OXZA 3V4WA 5AVVB 2P7JA 2Z5IA 1CSBA 3KDPB 1H89A 1F4SP 4I6MC 1OWAA 1QP9A 1NAFA 2WT7B 1GZLA 1GK6A 3VMZA 5AW0B 1FAVA 2ZXEB 1HWTC 2YNYA 2JJLA 2R5DA 4JYCA 1GD2E 2E43A 2E42A 3HE5B 5APYA 3A7OA 5APVA 1F5EP 4LC1A 5AW8B 5AW4B 1X8YA 2W6AA 4AQRD 3SWFA 1PYIA 3TNUA 2P2UA 2XV5A 4C46A 3M0AA 4C7NA 1GK4A 2Q5UA 3TK1A 1NWQA 1A02F 2XU6A 3P8MC 2BASA 1ZMEC 2WTYA 4C7NB 5AW9B 3L35A 5APSA 3MD0A 3LIEA 5APXA 3M06A 4KHXA 3TNUB 1S9KD 1HJBA 1T2KC 3IR9A 2QM8A 1G2CB 3A3YB 3HE5A 3A2AA 1FOSF 2Z5HA 4AYCA 1AJYA 1JUNA 5AVXB 5AVSB 3ALCA 4JYBA 5AW7B 2WPSA 4DZOA 3UIAA 2W27A 5AW5B 2N9BA 2H7HA 5CMZA
chains in the Genus database with same CATH superfamily
1MZ9A 3RL0C 1KB9D 1SFCA 2QEXP 2D2CD 1AQ5A 1VQ9P 4U3FE 4IOIH 2W8ZA 3T97A 3I56P 1BDDA 4A7PA 5CCHC 5KAIH 3H1KE 2KIKA 4DOJA 2QIWA 2R5BA 2ZVOB 5CCHA 5GTIE 1N73A 4B86A 3CCJP 4CPGA 1Q82Q 1KV4A 3L72E 1KILB 2XKMA 3M0DA 2AEMA 3PJSK 3HE4A 3PLNA 4GOEA 3TDKA 3VP8A 4I2LC 1FDIA 1OZHA 2KI7B 3B5ND 5CCHD 1PYCA 3TGUE 1P84H 2QVAA 5AVZB 3PTZA 1GL2D 5E79E 4WY4C 3HTKB 3L72G 3COQA 1NU1E 3OJAB 5AW3B 2OYIC 2QE7H 3BATA 2OYHA 3H1LD 1NTKD 1J2JB 1OMIA 4H44D 1GU5A 5KLVJ 2ZFCA 1CZQA 1URQB 2C0WA 3H1LG 3RK2C 2Y9ZA 1PIXA 3P32A 3Q2YA 1KYOE 4H44C 3L72D 4TLFA 1KFNA 1MUUA 5AVUB 5AVRB 1N7SB 2WSEJ 1JMMA 2IBZD 1GL2C 2KYVA 3H32B 3C8VA 5C39A 2Q7CA 1H0TA 2BCCJ 1T3JA 2M3BA 1Y47A 3FXEA 2FY8A 3N7NA 1H8AA 3HUSB 2P67A 3L37A 5DJUB 4EOTA 4JBZA 3NXSA 1NH4A 1IJDB 1LTSC 1QVFO 2J5UA 2YMKA 3M9HA 1OW7A 2WSFJ 4C7RA 2BCCD 5H2FH 1DD3A 3L70J 4H13D 3CX5D 1JCCA 3BCCG 1HUCA 1VQ5P 2J58A 5TJHA 2YO2A 3H1KG 2D2CC 1IO4A 3VOPA 2A06G 2KS1B 3RL0D 5TISE 1KYOD 1MV8A 4XE5B 1QL1A 2WSCH 3BCCE 4L74A 1NTKJ 1R8EA 3B8EB 3GHGA 3NTNA 2OTKE 1LWUB 1EZVE 2WVRA 1S5LX 2FYUG 4PD4I 4EIJA 2RKLA 2Z4EA 2H88C 2Z5IA 2A45G 2E76B 3BRTB 1H89A 1SQVJ 2K1AA 3W68A 4EDFA 5CBOA 2HODB 1OWAA 1J1DC 2K9JB 1QP9A 1NTZD 1JB0J 2YXQB 4DCKA 2OARA 5B5EH 3CCVP 1EZVD 1G1IA 1FZEA 3H1KD 1DD4A 2K88A 3SFEC 2O3JA 3H1ID 1LTJC 3BCCD 3R4YA 4U3FD 3H32A 2IDBA 1N7LA 2R5DA 3U59A 5KAFH 2FFDA 2E43A 1VQ6P 5APYA 3A7OA 5APVA 1F5EP 5AW8B 4IL6E 4R4LA 4ZMDA 1KD1Q 2W6AA 1VF5B 1PYIA 2KLVA 1RF1A 2YIUB 2XNDH 3II6A 1OFCX 1QX8A 1SQXE 2FBWC 4UB6E 2OYHC 1FZAA 2PP6A 2QJKC 1IFDA 1Y9BA 2JR8A 3H6PA 3O6QA 1NWQA 3MZWB 3FX0A 3L73G 1SQBK 3L71G 2Y0CA 4IL6H 4RKUJ 3RK2D 2KNCB 3L74G 2BASA 1JY2P 3CX5H 1KILA 2KOGA 2W90A 1LTIC 1M90Q 1VQKP 1ZRTE 1EXJA 1BGYJ 3MD0A 1NTZK 1JY2N 1P84I 1T3UA 3IN6A 3LIEA 1NOHA 3M06A 4KHXA 2WSEH 3B4SA 2Q6QA 3IR9A 2QM8A 2R3SA 1EZVI 3BVHA 3FGAD 3A3YB 1ZN5A 3HE5A 1KTMA 3A2AA 1K9MQ 1JOCA 4W80A 2Z5HA 3CCRP 1R5SA 3V2QA 1SQQD 2WZ7A 3CC7P 2JKVA 5AVXB 1QGKB 1RQUA 1S72P 3CXHE 1ZW0A 2P10A 3HD7B 3H1HJ 3H1JJ 2O1KA 5AW7B 1LP1B 1SFCD 3HD7A 3H1JE 1KQSO 2W27A 2ZYAA 3CD6P 1OVVA 3KPEA 2YXRB 3V6IA 1ZXGA 1EQ7A 3EWKA 5CMZA 1SQVE 2Y9YA 1OIPA 3CCUP 1GD2E 3TSIA 3WU2H 1NJIQ 2R32A 1SQXG 1IFNA 3B5NC 4EI2A 1BGYG 1LNQA 1QEXA 3H1HE 4JPZB 2WITA 1WMKA 1NTMD 3KQGA 2E76D 2KZJA 1TU3F 3AEEC 4HJGH 5APUA 2ZXXA 5AW1B 3RBXA 2KS1A 1MFZA 1HBWA 1PGOA 1FBMA 3L36A 1J1EB 1NKZB 4PD4D 3F89A 3VMXA 2E76C 3M9QA 4JQ0D 1N7SC 4RO0A 3WU2E 5CJ4A 3M0DC 5KLIB 3B71A 3K5BA 3Q5PA 1GTWA 1H88A 1FDMA 2OTJP 2B89A 4HKZH 3VTPC 1YJWP 1S3JA 3A0HH 3D71A 1N73C 2EREA 2O01H 1SQPG 2GA1A 2Q3IA 4N78E 3Q5RA 2WWWA 2G8YA 2M3EA 2ZYGA 1LTJA 3I5CA 1SQQJ 3B5NB 1YHQP 1JNMA 1N8RQ 2WPRA 3AEFC 1LTBC 1YIJP 4HYTB 2PGDA 3RK3D 3CMEP 1EDJA 1Y8AA 3M91A 1SQXJ 3KHUA 1BSHA 1HJ0A 5K5GB 1IK7A 3A5TA 5EFWB 1SQQG 3AE8C 4D6TG 4GDOA 4MN4C 3L75E 2A45H 1Q2NA 5AVTB 4RJTA 1SQPK 1SQVG 4N78D 2AXCA 3HD7C 1VQPP 3TYYA 2HAPC 1LT1A 3KYQA 2OTLP 3Q5SA 1BE3G 1W5CE 2CPBA 1GW3A 3HE4B 3KZIE 2AEFA 1PL5A 2WPVB 1VPCA 4TT3H 2A45I 3P7KA 2XZRA 3PRJA 4BXLA 1GU4A 1DEBA 1M7LA 5KLVK 1K73Q 1D7MA 3F5HA 1L0ND 3CLQA 1YTZI 3GHGB 5L8RJ 5KKZC 5APXA 2YO3A 1KILD 1U57A 2FYUJ 3A0HE 3L74D 5KLVD 3VP9A 3QH9A 1NTKE 1IK9A 1L0LE 1USDA 5AVVB 2IZ1A 1CSBA 2N1TC 1FZCA 1T8ZA 1S2EA 3BRVB 3JCUE 4I6MC 4U7JA 3FWNA 3MTUE 5H2FE 1RF0C 3KXDA 3P8CE 2IBZI 4D6TJ 3V2NA 2QJKB 4WY4A 1YJNP 2HYNA 1NAFA 2LXCB 5B5EE 2WT7B 1S4XA 3G4SP 2QRXA 1GK6A 4U3FG 4WWIA 5AW0B 3RL0B 3H1HG 2ZXEB 3L70D 1URQD 2H89C 2YNYA 3PHLA 4IFMA 4JYCA 4YTPC 3H1IE 1EZVG 4PV1D 3HE5B 3WMM0 1M8OB 4ZKUA 3CCMP 2KSEA 3D70A 4LC1A 2KLUA 3S1KA 4H0LD 2NPSD 1LTJB 1AA0A 1FJKA 2H8PD 1URQA 2LXBA 2RMZA 4KJMA 4AQRD 2P1JA 5KJ7A 1JMBA 1HF9A 3U1AA 1ZLLA 2NPSB 1ZOYC 2V7QH 2QJYB 5CHXA 1VQOP 5KLVG 1M1KQ 2FFDC 3L73J 1NU1G 2J59M 1J1DB 2JDIH 3AE3C 3TK1A 1L0NG 1BDCA 3L72J 1S1CX 1PGPA 5KLIC 1FJPA 2OQQA 1RHZB 2C0XA 1KORA 1KYOH 1RF1C 1DIPA 1BE3D 1NU1J 5APSA 3CWBE 2KXPB 4Y28J 1S9KD 2HPCA 4O9BA 3AE6C 2ITAA 3CXHH 3L75D 1VF5C 3N4XA 3T97B 2GM4A 1PV3A 1JO5A 3CX5E 1G2CB 2YMYA 4D6TD 2BCCG 2PFXA 3VMAA 2P58A 1UIIA 1VQ8P 3AECC 3H1IJ 4L76A 4AYCA 1FE6A 1QL2A 1WRGA 3H1KJ 4UB8H 2IFMA 1BE3E 5BVZA 2IBZG 3H1LJ 4NPFX 1K8AQ 1DX7A 1RE4C 2WPSA 2K9JA 4IFFA 1FZFA 1VQLP 3G3ZA 5AW5B 3SWYA 2IYOA 1SQPD 4D6TE 1JY3O 2ZT9C 5KJ7D 3MUDA 1WT6A 2FYNC 1NTKG 2HR3A 1FZBA 2Q9IA 2E5YA 2M8RA 1BCCJ 5AVQB 5KKZB 3L4FA 4PD4E 2KK7A 1L0LJ 1RE4A 4YXDC 2KP8A 1OX3A 5KTBA 2W83C 2WMMA 2HPCB 1JCDA 3IAOA 3Q3DA 3AE1C 1FS0E 4W7YA 2VRSA 3SWKA 3VMYA 4OWFA 1VQ7P 2KNCA 3OAKA 1JTHA 1SQXD 2G3AA 1RF0A 1PPJG 2I1JA 4GT1A 5KAFE 3LIDA 2OYIA 3L75J 3AE9C 2IYPA 1L4AA 1IC2A 3RGUA 4Z1MH 1KB9I 2ZT9D 5APQA 5KJ7C 2IZ0A 2PRRA 1SVFA 1JEKA 1BGYE 1KB9E 2R3CA 2YKOA 1SLQA 2KSJA 3MHVA 3PH0A 4GKGA 4RESB 5CCGC 1L4AD 3CCQP 1H0TB 1FC2C 1SQQE 3V2PA 2O01N 2BEQD 1L2PA 5BU5A 1BCCG 3CPWO 1FOSE 3EQ2A 1KQLA 1J1EC 3WUTA 4K3AA 1L0LK 2R44A 3FWLA 1NTKK 3TGUG 1NAYA 2POHA 1ZR2A 4WY4B 1CI6B 1T2KD 2OYIB 2ERGA 1GW4A 3C9IA 1HTLC 1NKNA 1YYCA 3GMAA 1LJ2A 2FYNB 4BWNA 3D6YA 2K37A 5B66E 2JO1A 1S5LH 1IFMA 2HFED 1KILE 2FYZA 4NPEA 1LT9A 3CC2P 3CCLP 1U7MA 2E74B 3CCSP 3EFFK 3L71D 2WSSH 3L73D 1D66A 4NPDA 1ZP0C 1OW8A 3R2PA 2WSCJ 2ER8A 3M9BA 4OGQB 1PZQA 2ZJSE 3AE4C 3V4WA 4DJGA 1LT9B 3L71J 2B9BA 1SQXK 1EC5A 3CXHI 2IFNA 3KDPB 4GOFA 1UIXA 1VDFA 3H1JG 2L91A 3AE2C 4OGQC 1HH0A 4UB6H 1AFOA 5GTHH 2QJPC 3CWBJ 5GTIH 1GMJA 1GDTA 3CL3D 3A0BE 1L0NJ 3H1IG 1L0LD 3RK3B 3GF3A 2E74C 2A06E 2NZ2A 2O1JA 3WUVA 2V7QJ 3GLMA 3VMZA 5E79H 1P84E 3JCUH 1RE3C 1NTZG 1U7JA 2RH0A 1SQBJ 3GF7A 4PJ0H 1HGZA 3CI9A 3JC22 2E42A 1LWUC 2AEJA 3B5NA 1YI2P 5AW4B 1NU1D 3AEGC 3C1LA 4OVNF 1KQFB 3TNUA 4PD4H 2P2UA 3ABVC 1L0NK 4C46A 1NTZJ 5KAIE 1PPJE 1NU1K 1HVVA 1BCCD 3M0AA 1GK4A 2GUSA 2IX7C 2PAJA 5GTHE 1E79H 2HLOA 1P84D 4UB8E 1RQVA 3MIWA 2CK3H 4WBAA 4EYYQ 3KZIH 1OVUA 4ASWA 3I55P 1A02F 3E1IA 1KILC 2A06D 3P8MC 3CC4P 1M56D 1ZMEC 1NTME 2WTYA 3L70G 1Q7YQ 3S9OA 2JEEA 3H1HD 4QMAA 2N9BA 1JM0A 1HJBA 3CCEP 1EDIA 4LLHA 2JWAA 1PPJD 1JY3P 1PGJA 3CWBD 3E7KA 1N86A 4L73A 1T2KC 1M1JA 2LKMA 2OYOA 2QSIA 1SFCB 3U1CA 2YKQA 1Q86Q 1KQGB 2N1TB 2FKWB 3AE5C 3ZDMA 4ZKPA 4OGQD 1MKMA 2FYUE 1L0NE 2B87A 1LTTC 3ITKA 3L71E 1YQ3C 5CJ0A 5AVSB 1YQ4C 4BRYA 2N1TD 4JYBA 1X22A 1NO4A 4K35A 2RN0A 1RH5B 3WUUA 1IFPA 5CCGD 2HODA 1VQNP 2QA4P 3MP7B 2Q3EA 2H7HA 4DT0A 1K05A 3G6EP 1NGMB 1AQTA 3V4QA 2Q1KA 1SQQK 1LWUA 1EDKA 1R5LA 2FXOA 2B88A 3AEBC 4WY4D 4JF7A 4ASVA 2MKVA 2W6BA 2FYUK 3FXDA 1Z56A 1QVGO 1YBKA 3NFQA 4GIFA 4W7ZA 3HD7D 3MGNA 3USSA 1FDOA 5BU8B 3RL0g 5AVWB 1BE3J 2Y0EA 2JP3A 1KC8Q 3L70E 1FZCC 1YJ9P 1PFIA 2Y0DA 1N2DC 4AUWA 3L75G 1AVOA 2M0BA 3V2RA 3G9RA 3O6QB 5CBNA 1CI6A 4I7ZB 1ZV8A 5APTA 4H44B 2N9YB 3IF4A 2ALCA 2NPSA 2QM7A 2BEZF 2C9LY 1NTMK 4IFDK 1XTGB 1L4AC 1VL2A 3V5BA 3EFGA 4R4MA 1QLED 4OH8B 5APWA 5AW6B 3TF5A 1GL2B 2O01J 3G71P 3CMAP 2QG4A 3PP5A 1S9KE 1YITP 1LTAC 1K04A 1KYOI 1FU1A 3AEAC 2HG5D 4HB1A 1T6AA 3RK2B 1IFIA 5AW2B 5KLVE 1NHLA 1GL2A 1NTZE 2NPSC 1AV1A 1SQBG 4XFJA 1N7SD 2WT7A 4ZNCA 2OYHB 1AVYA 1IFJA 1L4AB 2JWDA 2WPQA 2YIUC 4I7ZC 3HTKA 5AVYB 5M1BA 1NTMG 1VF5D 2IPPA 2W6JH 3VN0A 3HRNA 1AW6A 1SQBE 1SQPE 3VYIA 2ZT9B 3NMDA 3W67A 3CWBG 3O8ZA 1KFMA 3OW2O 1XTCC 3LW5J 3RK3E 2FXMA 1SP4A 4N3YB 2C9NY 2KZIA 3CXHD 1LT9C 1X9VA 1VQMP 2FXPA 1A02J 1LGHB 3E1RA 4YXWH 1BCCE 1DH3A 1OVRA 1M57D 2L5GB 2WSFH 3CX5I 4M3LA 1NYHA 1M1JC 1IZNB 1OXZA 1PP9D 3HUSC 2P7JA 2ZAEB 1S5LE 3MUDC 3LW5H 1EXIA 1RE3A 2DW3A 1F4SP 1HGVA 4PJ0E 1E5WA 4Y99B 1ZRTD 3H1LE 1LP1A 2E75D 3BCCJ 4HH2A 4PV1C 5B66H 2I8DA 3GHGC 1MFTA 1URQC 2LR2A 2XNXA 1NTMJ 4LGDE 1RY3A 3SFDC 3HUSA 2B87B 3Q1MA 2OGUA 4I1LA 1GZLA 2I1KA 3L74E 2E74D 1FAVA 2NRGA 2N1TA 3H25A 1HWTC 3BASA 2JJLA 5CCGA 1Q81Q 1X79B 4IL6X 1N7SA 1L0LG 1M1JB 1G2CA 1SQVD 4H13B 2ZVNB 3D6ZA 2QJYC 2E75C 1KB9H 2ZYDA 1X8YA 1SQPJ 2KB7P 2UWJE 4YPCA 1OW6A 2XV5A 2BCCE 1PP9G 2GUVA 2YKPA 1JY3N 3H1JD 5TISH 1PGQA 1W2BO 2AXTE 4H0LB 4C7NA 3AE7C 1FZGA 1RF1B 2Q5UA 4WB4A 4XA4A 3JSVC 2QJPB 3AEDC 1KZUB 2V4HA 3OA7A 1JTHB 1PP9E 2WQYC 2XU6A 4N6JA 1ZR4A 4GODA 4H0LC 1JY2O 1PP9J 2IBZE 3SSUA 2CPSA 2K9YA 4BRYB 2K3RA 4C7NB 3GG2A 5AW9B 1CW5A 1EDLA 2AXTH 3L35A 3L73E 3P8CD 2KUBA 4L75A 2SPZA 3TNUB 1N73B 2E75B 1X0TA 4KT0J 3TGUJ 4H13C 5DJTB 1NVOA 1KMIZ 1BSNA 2H43A 3S4RA 4U3FJ 1USEA 1SQBD 1FOSF 1SS1A 2FFDB 1VQ4P 3TGUD 1W2EA 2MJZA 2M5AB 1AJYA 3RBZA 1JUNA 3QWOC 3RK3C 3A0BH 3ALCA 4PV1B 2E5TA 2FYUD 3L74J 1BGYD 3GW6A 1KN7A 3IFMA 4Y99C 1Q90D 1G1JA 2XDJA 3UIAA 4DZOA 3SWFA 1DEEG 1YTZT 2M5AA 2D2CB 1LTGC 4WVZA 1FZCB 1SQVK 1SFCC
chains in the Genus database with same CATH topology
1MZ9A 3RL0C 1SFCA 1AQ5A 3T97A 5CCHC 1N73A 4DOJA 2R5BA 5CCHA 4B86A 1KILB 2XKMA 3M0DA 3HE4A 3VP8A 4I2LC 1PYCA 3B5ND 5CCHD 5AVZB 1GL2D 3COQA 4WY4C 3HTKB 5AW3B 3OJAB 2OYIC 3BATA 2OYHA 1J2JB 1GU5A 2ZFCA 1CZQA 1URQB 3RK2C 3P32A 1KFNA 1MUUA 5AVUB 5AVRB 1N7SB 1JMMA 3H32B 1GL2C 2KYVA 2Q7CA 1T3JA 2M3BA 1H8AA 3N7NA 3HUSB 2P67A 3L37A 4EOTA 3NXSA 1NH4A 1IJDB 1LTSC 3M9HA 4C7RA 1JCCA 1HUCA 2J58A 2YO2A 1IO4A 3VOPA 3RL0D 1MV8A 4XE5B 1QL1A 2WSCH 3B8EB 3GHGA 3NTNA 1LWUB 4EIJA 2Z4EA 2Z5IA 2A45G 3BRTB 1H89A 2HODB 1OWAA 1J1DC 1QP9A 2OARA 1G1IA 1FZEA 1LTJC 2FFDA 3H32A 1N7LA 2R5DA 2E43A 5APYA 3A7OA 5APVA 1F5EP 5AW8B 2W6AA 1PYIA 2KLVA 1RF1A 1SQVK 3II6A 2OYHC 1SFCC 1FZAA 2PP6A 1IFDA 3H6PA 1NWQA 3RK2D 1SQBK 2BASA 1JY2P 1KILA 2KOGA 1LTIC 3MD0A 1NTZK 1JY2N 1T3UA 3LIEA 3M06A 4KHXA 1NOHA 5APXA 2WSEH 3IR9A 2QM8A 3BVHA 3A3YB 1ZN5A 3HE5A 3A2AA 1JOCA 4W80A 2Z5HA 3V2QA 2WZ7A 5AVXB 3HD7B 2O1KA 5AW7B 1SFCD 3HD7A 2W27A 3KPEA 1EQ7A 5CMZA 3TSIA 2R32A 1IFNA 3B5NC 2WITA 3KQGA 5APUA 5AW1B 1MFZA 1HBWA 1FBMA 3L36A 1J1EB 1NKZB 5CJ4A 3M9QA 1N7SC 1GTWA 3M0DC 1H88A 1FDMA 3VTPC 1N73C 2EREA 2O01H 2Q3IA 4N78E 2WWWA 3I5CA 1LTJA 3B5NB 1JNMA 2WPRA 1LTBC 4HYTB 3RK3D 3M91A 3A5TA 2A45H 5AVTB 1SQPK 4N78D 3HD7C 3TYYA 2HAPC 3KYQA 2CPBA 3HE4B 1GW3A 1VPCA 2A45I 3P7KA 2XZRA 1GU4A 1DEBA 1M7LA 5KLVK 3CLQA 3GHGB 1YTZI 2YO3A 1KILD 3VP9A 1IK9A 5AVVB 1CSBA 2N1TC 1FZCA 1T8ZA 3BRVB 4I6MC 3MTUE 1RF0C 3P8CE 3V2NA 4WY4A 2HYNA 1NAFA 2WT7B 1GK6A 3RL0B 5AW0B 2ZXEB 1URQD 2YNYA 4IFMA 4JYCA 1GD2E 3WMM0 4ZKUA 3HE5B 4LC1A 2NPSD 1LTJB 2H8PD 1FJKA 4AQRD 1URQA 3SWFA 5KJ7A 2P1JA 3U1AA 1ZLLA 2NPSB 5CHXA 2FFDC 2J59M 1J1DB 3TK1A 1FJPA 2C0XA 1RF1C 5APSA 1S9KD 2HPCA 4O9BA 3N4XA 2GM4A 1JO5A 1G2CB 2YMYA 4AYCA 1QL2A 1WRGA 2IFMA 5BVZA 1DX7A 1RE4C 2WPSA 4IFFA 1FZFA 3G3ZA 5AW5B 3SWYA 1JY3O 5KJ7D 3MUDA 1WT6A 1FZBA 2Q9IA 2M8RA 5AVQB 3L4FA 1RE4A 2KP8A 5KTBA 2HPCB 1JCDA 4W7YA 2VRSA 3VMYA 3OAKA 1JTHA 1RF0A 2I1JA 4GT1A 3LIDA 2OYIA 1L4AA 1IC2A 5APQA 5KJ7C 1SVFA 2H43A 3U59A 2R3CA 2YKOA 1SLQA 2KSJA 4GKGA 4RESB 5CCGC 1L4AD 3V2PA 5BU5A 1FOSE 3EQ2A 1KQLA 1J1EC 1L0LK 1NTKK 1ZR2A 2POHA 4WY4B 1CI6B 1T2KD 2OYIB 2ERGA 1GW4A 3C9IA 1HTLC 1NKNA 1YYCA 1IFMA 2HFED 2FYZA 1LT9A 1D66A 3R2PA 2ER8A 3M9BA 3V4WA 1LT9B 1SQXK 2IFNA 3KDPB 1VDFA 1HH0A 1AFOA 1GDTA 3CL3D 3RK3B 2O1JA 3VMZA 1RE3C 1HGZA 3CI9A 2E42A 1LWUC 3B5NA 5AW4B 3TNUA 2P2UA 1L0NK 4C46A 1NU1K 1HVVA 3M0AA 1GK4A 2GUSA 2IX7C 2PAJA 2HLOA 4WBAA 3MIWA 1A02F 3E1IA 1KILC 3P8MC 1ZMEC 2WTYA 2JEEA 1HJBA 4LLHA 1T2KC 1JY3P 1N86A 1M1JA 2LKMA 1SFCB 3U1CA 2YKQA 2N1TB 2FKWB 4ZKPA 5AVSB 1LTTC 5CJ0A 2N1TD 4JYBA 1NO4A 5CCGD 2HODA 2H7HA 3V4QA 1SQQK 1LWUA 4WY4D 4JF7A 2W6BA 2FYUK 1Z56A 3NFQA 4GIFA 4W7ZA 5BU8B 3HD7D 3MGNA 5AVWB 1FZCC 1PFIA 1N2DC 4AUWA 3V2RA 1CI6A 1ZV8A 5APTA 2ALCA 2NPSA 2QM7A 2C9LY 4IFDK 1NTMK 1XTGB 1L4AC 3V5BA 3EFGA 5APWA 4OH8B 5AW6B 1RF1B 1GL2B 3PP5A 1S9KE 1LTAC 1FU1A 2HG5D 3RK2B 1IFIA 5AW2B 1NHLA 1GL2A 2NPSC 2WT7A 1N7SD 2OYHB 1IFJA 1L4AB 2WPQA 5AVYB 3HTKA 2IPPA 1AW6A 3VN0A 3HRNA 3VYIA 3NMDA 3O8ZA 1KFMA 1XTCC 2FXMA 1SP4A 4N3YB 2C9NY 1LT9C 1X9VA 1A02J 1LGHB 1DH3A 2L5GB 3VMXA 2WSFH 4M3LA 1M1JC 1OXZA 3HUSC 2P7JA 3LW5H 1RE3A 1F4SP 1HGVA 1E5WA 4Y99B 4HH2A 3GHGC 1URQC 2XNXA 4LGDE 1RY3A 3HUSA 4I1LA 1GZLA 2I1KA 1FAVA 2N1TA 1HWTC 3BASA 2JJLA 5CCGA 1X79B 1N7SA 1M1JB 1G2CA 1X8YA 2KB7P 2XV5A 2GUVA 2YKPA 1JY3N 4C7NA 1FZGA 2Q5UA 4WB4A 4XA4A 1KZUB 3OA7A 1JTHB 2XU6A 4N6JA 1ZR4A 1JY2O 2CPSA 4C7NB 5AW9B 1CW5A 3L35A 3P8CD 1N73B 3TNUB 1FOSF 2FFDB 1W2EA 2MJZA 1AJYA 1JUNA 3RK3C 3ALCA 3IFMA 4Y99C 2XDJA 1G1JA 3UIAA 4DZOA 1YTZT 1LTGC 1FZCB 2N9BA 2C0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  2R32 A;  5AVQ B;  3T97 A;  3KQG A;  2KP8 A;  5APU A;  5AW1 B;  2R5B A;  3NFQ A;  3MGN A;  1MFZ A;  1HBW A;  5AVW B;  4B86 A;  3L36 A;  3M0D A;  2VRS A;  3VMY A;  3HE4 A;  3OAK A;  1GTW A;  1H88 A;  4I2L C;  1PYC A;  4AUW A;  4GT1 A;  5AVZ B;  3LID A;  1CI6 A;  3VTP C;  3COQ A;  5APT A;  5AW3 B;  2ERE A;  2ALC A;  2QM7 A;  2C9L Y;  3V5B A;  1J2J B;  2Q3I A;  5APQ A;  5APW A;  1GU5 A;  5AW6 B;  2WWW A;  1CZQ A;  2ZFC A;  3I5C A;  2R3C A;  4GKG A;  1SLQ A;  3P32 A;  4RES B;  1S9K E;  1JNM A;  2WPR A;  1MUU A;  5AVU B;  5AVR B;  4HYT B;  3M91 A;  5AW2 B;  2Q7C A;  1FOS E;  1KQL A;  1H8A A;  3A5T A;  4EOT A;  2P67 A;  3L37 A;  2WT7 A;  3NXS A;  2WPQ A;  5AVY B;  3HTK A;  3M9H A;  1CI6 B;  5AVT B;  2IPP A;  1T2K D;  2ERG A;  3VN0 A;  1AW6 A;  3TYY A;  2HAP C;  3VYI A;  1YYC A;  3NMD A;  3O8Z A;  3HE4 B;  1HUC A;  2YO2 A;  1SP4 A;  3P7K A;  1IO4 A;  2XZR A;  2C9N Y;  1GU4 A;  1MV8 A;  4XE5 B;  1A02 J;  1D66 A;  1DH3 A;  2YO3 A;  3B8E B;  3NTN A;  3VMX A;  4M3L A;  2ER8 A;  3M9B A;  1OXZ A;  3V4W A;  5AVV B;  2P7J A;  2Z5I A;  1CSB A;  3KDP B;  1H89 A;  1F4S P;  4I6M C;  1OWA A;  1QP9 A;  1NAF A;  2WT7 B;  1GZL A;  1GK6 A;  3VMZ A;  5AW0 B;  1FAV A;  2ZXE B;  1HWT C;  2YNY A;  2JJL A;  2R5D A;  4JYC A;  1GD2 E;  2E43 A;  2E42 A;  3HE5 B;  5APY A;  3A7O A;  5APV A;  1F5E P;  4LC1 A;  5AW8 B;  5AW4 B;  1X8Y A;  2W6A A;  4AQR D;  3SWF A;  1PYI A;  3TNU A;  2P2U A;  2XV5 A;  4C46 A;  3M0A A;  4C7N A;  1GK4 A;  2Q5U A;  3TK1 A;  1NWQ A;  1A02 F;  2XU6 A;  3P8M C;  2BAS A;  1ZME C;  2WTY A;  4C7N B;  5AW9 B;  3L35 A;  5APS A;  3MD0 A;  3LIE A;  5APX A;  3M06 A;  4KHX A;  3TNU B;  1S9K D;  1HJB A;  1T2K C;  3IR9 A;  2QM8 A;  1G2C B;  3A3Y B;  3HE5 A;  3A2A A;  1FOS F;  2Z5H A;  4AYC A;  1AJY A;  1JUN A;  5AVX B;  5AVS B;  3ALC A;  4JYB A;  5AW7 B;  2WPS A;  4DZO A;  3UIA A;  2W27 A;  5AW5 B;  2N9B A;  2H7H A;  5CMZ A; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  3RL0 C;  1KB9 D;  1SFC A;  2QEX P;  2D2C D;  1AQ5 A;  1VQ9 P;  4U3F E;  4IOI H;  2W8Z A;  3T97 A;  3I56 P;  1BDD A;  4A7P A;  5CCH C;  5KAI H;  3H1K E;  2KIK A;  4DOJ A;  2QIW A;  2R5B A;  2ZVO B;  5CCH A;  5GTI E;  1N73 A;  4B86 A;  3CCJ P;  4CPG A;  1Q82 Q;  1KV4 A;  3L72 E;  1KIL B;  2XKM A;  3M0D A;  2AEM A;  3PJS K;  3HE4 A;  3PLN A;  4GOE A;  3TDK A;  3VP8 A;  4I2L C;  1FDI A;  1OZH A;  2KI7 B;  3B5N D;  5CCH D;  1PYC A;  3TGU E;  1P84 H;  2QVA A;  5AVZ B;  3PTZ A;  1GL2 D;  5E79 E;  4WY4 C;  3HTK B;  3L72 G;  3COQ A;  1NU1 E;  3OJA B;  5AW3 B;  2OYI C;  2QE7 H;  3BAT A;  2OYH A;  3H1L D;  1NTK D;  1J2J B;  1OMI A;  4H44 D;  1GU5 A;  5KLV J;  2ZFC A;  1CZQ A;  1URQ B;  2C0W A;  3H1L G;  3RK2 C;  2Y9Z A;  1PIX A;  3P32 A;  3Q2Y A;  1KYO E;  4H44 C;  3L72 D;  4TLF A;  1KFN A;  1MUU A;  5AVU B;  5AVR B;  1N7S B;  2WSE J;  1JMM A;  2IBZ D;  1GL2 C;  2KYV A;  3H32 B;  3C8V A;  5C39 A;  2Q7C A;  1H0T A;  2BCC J;  1T3J A;  2M3B A;  1Y47 A;  3FXE A;  2FY8 A;  3N7N A;  1H8A A;  3HUS B;  2P67 A;  3L37 A;  5DJU B;  4EOT A;  4JBZ A;  3NXS A;  1NH4 A;  1IJD B;  1LTS C;  1QVF O;  2J5U A;  2YMK A;  3M9H A;  1OW7 A;  2WSF J;  4C7R A;  2BCC D;  5H2F H;  1DD3 A;  3L70 J;  4H13 D;  3CX5 D;  1JCC A;  3BCC G;  1HUC A;  1VQ5 P;  2J58 A;  5TJH A;  2YO2 A;  3H1K G;  2D2C C;  1IO4 A;  3VOP A;  2A06 G;  2KS1 B;  3RL0 D;  5TIS E;  1KYO D;  1MV8 A;  4XE5 B;  1QL1 A;  2WSC H;  3BCC E;  4L74 A;  1NTK J;  1R8E A;  3B8E B;  3GHG A;  3NTN A;  2OTK E;  1LWU B;  1EZV E;  2WVR A;  1S5L X;  2FYU G;  4PD4 I;  4EIJ A;  2RKL A;  2Z4E A;  2H88 C;  2Z5I A;  2A45 G;  2E76 B;  3BRT B;  1H89 A;  1SQV J;  2K1A A;  3W68 A;  4EDF A;  5CBO A;  2HOD B;  1OWA A;  1J1D C;  2K9J B;  1QP9 A;  1NTZ D;  1JB0 J;  2YXQ B;  4DCK A;  2OAR A;  5B5E H;  3CCV P;  1EZV D;  1G1I A;  1FZE A;  3H1K D;  1DD4 A;  2K88 A;  3SFE C;  2O3J A;  3H1I D;  1LTJ C;  3BCC D;  3R4Y A;  4U3F D;  3H32 A;  2IDB A;  1N7L A;  2R5D A;  3U59 A;  5KAF H;  2FFD A;  2E43 A;  1VQ6 P;  5APY A;  3A7O A;  5APV A;  1F5E P;  5AW8 B;  4IL6 E;  4R4L A;  4ZMD A;  1KD1 Q;  2W6A A;  1VF5 B;  1PYI A;  2KLV A;  1RF1 A;  2YIU B;  2XND H;  3II6 A;  1OFC X;  1QX8 A;  1SQX E;  2FBW C;  4UB6 E;  2OYH C;  1FZA A;  2PP6 A;  2QJK C;  1IFD A;  1Y9B A;  2JR8 A;  3H6P A;  3O6Q A;  1NWQ A;  3MZW B;  3FX0 A;  3L73 G;  1SQB K;  3L71 G;  2Y0C A;  4IL6 H;  4RKU J;  3RK2 D;  2KNC B;  3L74 G;  2BAS A;  1JY2 P;  3CX5 H;  1KIL A;  2KOG A;  2W90 A;  1LTI C;  1M90 Q;  1VQK P;  1ZRT E;  1EXJ A;  1BGY J;  3MD0 A;  1NTZ K;  1JY2 N;  1P84 I;  1T3U A;  3IN6 A;  3LIE A;  1NOH A;  3M06 A;  4KHX A;  2WSE H;  3B4S A;  2Q6Q A;  3IR9 A;  2QM8 A;  2R3S A;  1EZV I;  3BVH A;  3FGA D;  3A3Y B;  1ZN5 A;  3HE5 A;  1KTM A;  3A2A A;  1K9M Q;  1JOC A;  4W80 A;  2Z5H A;  3CCR P;  1R5S A;  3V2Q A;  1SQQ D;  2WZ7 A;  3CC7 P;  2JKV A;  5AVX B;  1QGK B;  1RQU A;  1S72 P;  3CXH E;  1ZW0 A;  2P10 A;  3HD7 B;  3H1H J;  3H1J J;  2O1K A;  5AW7 B;  1LP1 B;  1SFC D;  3HD7 A;  3H1J E;  1KQS O;  2W27 A;  2ZYA A;  3CD6 P;  1OVV A;  3KPE A;  2YXR B;  3V6I A;  1ZXG A;  1EQ7 A;  3EWK A;  5CMZ A;  1SQV E;  2Y9Y A;  1OIP A;  3CCU P;  1GD2 E;  3TSI A;  3WU2 H;  1NJI Q;  2R32 A;  1SQX G;  1IFN A;  3B5N C;  4EI2 A;  1BGY G;  1LNQ A;  1QEX A;  3H1H E;  4JPZ B;  2WIT A;  1WMK A;  1NTM D;  3KQG A;  2E76 D;  2KZJ A;  1TU3 F;  3AEE C;  4HJG H;  5APU A;  2ZXX A;  5AW1 B;  3RBX A;  2KS1 A;  1MFZ A;  1HBW A;  1PGO A;  1FBM A;  3L36 A;  1J1E B;  1NKZ B;  4PD4 D;  3F89 A;  3VMX A;  2E76 C;  3M9Q A;  4JQ0 D;  1N7S C;  4RO0 A;  3WU2 E;  5CJ4 A;  3M0D C;  5KLI B;  3B71 A;  3K5B A;  3Q5P A;  1GTW A;  1H88 A;  1FDM A;  2OTJ P;  2B89 A;  4HKZ H;  3VTP C;  1YJW P;  1S3J A;  3A0H H;  3D71 A;  1N73 C;  2ERE A;  2O01 H;  1SQP G;  2GA1 A;  2Q3I A;  4N78 E;  3Q5R A;  2WWW A;  2G8Y A;  2M3E A;  2ZYG A;  1LTJ A;  3I5C A;  1SQQ J;  3B5N B;  1YHQ P;  1JNM A;  1N8R Q;  2WPR A;  3AEF C;  1LTB C;  1YIJ P;  4HYT B;  2PGD A;  3RK3 D;  3CME P;  1EDJ A;  1Y8A A;  3M91 A;  1SQX J;  3KHU A;  1BSH A;  1HJ0 A;  5K5G B;  1IK7 A;  3A5T A;  5EFW B;  1SQQ G;  3AE8 C;  4D6T G;  4GDO A;  4MN4 C;  3L75 E;  2A45 H;  1Q2N A;  5AVT B;  4RJT A;  1SQP K;  1SQV G;  4N78 D;  2AXC A;  3HD7 C;  1VQP P;  3TYY A;  2HAP C;  1LT1 A;  3KYQ A;  2OTL P;  3Q5S A;  1BE3 G;  1W5C E;  2CPB A;  1GW3 A;  3HE4 B;  3KZI E;  2AEF A;  1PL5 A;  2WPV B;  1VPC A;  4TT3 H;  2A45 I;  3P7K A;  2XZR A;  3PRJ A;  4BXL A;  1GU4 A;  1DEB A;  1M7L A;  5KLV K;  1K73 Q;  1D7M A;  3F5H A;  1L0N D;  3CLQ A;  1YTZ I;  3GHG B;  5L8R J;  5KKZ C;  5APX A;  2YO3 A;  1KIL D;  1U57 A;  2FYU J;  3A0H E;  3L74 D;  5KLV D;  3VP9 A;  3QH9 A;  1NTK E;  1IK9 A;  1L0L E;  1USD A;  5AVV B;  2IZ1 A;  1CSB A;  2N1T C;  1FZC A;  1T8Z A;  1S2E A;  3BRV B;  3JCU E;  4I6M C;  4U7J A;  3FWN A;  3MTU E;  5H2F E;  1RF0 C;  3KXD A;  3P8C E;  2IBZ I;  4D6T J;  3V2N A;  2QJK B;  4WY4 A;  1YJN P;  2HYN A;  1NAF A;  2LXC B;  5B5E E;  2WT7 B;  1S4X A;  3G4S P;  2QRX A;  1GK6 A;  4U3F G;  4WWI A;  5AW0 B;  3RL0 B;  3H1H G;  2ZXE B;  3L70 D;  1URQ D;  2H89 C;  2YNY A;  3PHL A;  4IFM A;  4JYC A;  4YTP C;  3H1I E;  1EZV G;  4PV1 D;  3HE5 B;  3WMM 0;  1M8O B;  4ZKU A;  3CCM P;  2KSE A;  3D70 A;  4LC1 A;  2KLU A;  3S1K A;  4H0L D;  2NPS D;  1LTJ B;  1AA0 A;  1FJK A;  2H8P D;  1URQ A;  2LXB A;  2RMZ A;  4KJM A;  4AQR D;  2P1J A;  5KJ7 A;  1JMB A;  1HF9 A;  3U1A A;  1ZLL A;  2NPS B;  1ZOY C;  2V7Q H;  2QJY B;  5CHX A;  1VQO P;  5KLV G;  1M1K Q;  2FFD C;  3L73 J;  1NU1 G;  2J59 M;  1J1D B;  2JDI H;  3AE3 C;  3TK1 A;  1L0N G;  1BDC A;  3L72 J;  1S1C X;  1PGP A;  5KLI C;  1FJP A;  2OQQ A;  1RHZ B;  2C0X A;  1KOR A;  1KYO H;  1RF1 C;  1DIP A;  1BE3 D;  1NU1 J;  5APS A;  3CWB E;  2KXP B;  4Y28 J;  1S9K D;  2HPC A;  4O9B A;  3AE6 C;  2ITA A;  3CXH H;  3L75 D;  1VF5 C;  3N4X A;  3T97 B;  2GM4 A;  1PV3 A;  1JO5 A;  3CX5 E;  1G2C B;  2YMY A;  4D6T D;  2BCC G;  2PFX A;  3VMA A;  2P58 A;  1UII A;  1VQ8 P;  3AEC C;  3H1I J;  4L76 A;  4AYC A;  1FE6 A;  1QL2 A;  1WRG A;  3H1K J;  4UB8 H;  2IFM A;  1BE3 E;  5BVZ A;  2IBZ G;  3H1L J;  4NPF X;  1K8A Q;  1DX7 A;  1RE4 C;  2WPS A;  2K9J A;  4IFF A;  1FZF A;  1VQL P;  3G3Z A;  5AW5 B;  3SWY A;  2IYO A;  1SQP D;  4D6T E;  1JY3 O;  2ZT9 C;  5KJ7 D;  3MUD A;  1WT6 A;  2FYN C;  1NTK G;  2HR3 A;  1FZB A;  2Q9I A;  2E5Y A;  2M8R A;  1BCC J;  5AVQ B;  5KKZ B;  3L4F A;  4PD4 E;  2KK7 A;  1L0L J;  1RE4 A;  4YXD C;  2KP8 A;  1OX3 A;  5KTB A;  2W83 C;  2WMM A;  2HPC B;  1JCD A;  3IAO A;  3Q3D A;  3AE1 C;  1FS0 E;  4W7Y A;  2VRS A;  3SWK A;  3VMY A;  4OWF A;  1VQ7 P;  2KNC A;  3OAK A;  1JTH A;  1SQX D;  2G3A A;  1RF0 A;  1PPJ G;  2I1J A;  4GT1 A;  5KAF E;  3LID A;  2OYI A;  3L75 J;  3AE9 C;  2IYP A;  1L4A A;  1IC2 A;  3RGU A;  4Z1M H;  1KB9 I;  2ZT9 D;  5APQ A;  5KJ7 C;  2IZ0 A;  2PRR A;  1SVF A;  1JEK A;  1BGY E;  1KB9 E;  2R3C A;  2YKO A;  1SLQ A;  2KSJ A;  3MHV A;  3PH0 A;  4GKG A;  4RES B;  5CCG C;  1L4A D;  3CCQ P;  1H0T B;  1FC2 C;  1SQQ E;  3V2P A;  2O01 N;  2BEQ D;  1L2P A;  5BU5 A;  1BCC G;  3CPW O;  1FOS E;  3EQ2 A;  1KQL A;  1J1E C;  3WUT A;  4K3A A;  1L0L K;  2R44 A;  3FWL A;  1NTK K;  3TGU G;  1NAY A;  2POH A;  1ZR2 A;  4WY4 B;  1CI6 B;  1T2K D;  2OYI B;  2ERG A;  1GW4 A;  3C9I A;  1HTL C;  1NKN A;  1YYC A;  3GMA A;  1LJ2 A;  2FYN B;  4BWN A;  3D6Y A;  2K37 A;  5B66 E;  2JO1 A;  1S5L H;  1IFM A;  2HFE D;  1KIL E;  2FYZ A;  4NPE A;  1LT9 A;  3CC2 P;  3CCL P;  1U7M A;  2E74 B;  3CCS P;  3EFF K;  3L71 D;  2WSS H;  3L73 D;  1D66 A;  4NPD A;  1ZP0 C;  1OW8 A;  3R2P A;  2WSC J;  2ER8 A;  3M9B A;  4OGQ B;  1PZQ A;  2ZJS E;  3AE4 C;  3V4W A;  4DJG A;  1LT9 B;  3L71 J;  2B9B A;  1SQX K;  1EC5 A;  3CXH I;  2IFN A;  3KDP B;  4GOF A;  1UIX A;  1VDF A;  3H1J G;  2L91 A;  3AE2 C;  4OGQ C;  1HH0 A;  4UB6 H;  1AFO A;  5GTH H;  2QJP C;  3CWB J;  5GTI H;  1GMJ A;  1GDT A;  3CL3 D;  3A0B E;  1L0N J;  3H1I G;  1L0L D;  3RK3 B;  3GF3 A;  2E74 C;  2A06 E;  2NZ2 A;  2O1J A;  3WUV A;  2V7Q J;  3GLM A;  3VMZ A;  5E79 H;  1P84 E;  3JCU H;  1RE3 C;  1NTZ G;  1U7J A;  2RH0 A;  1SQB J;  3GF7 A;  4PJ0 H;  1HGZ A;  3CI9 A;  3JC2 2;  2E42 A;  1LWU C;  2AEJ A;  3B5N A;  1YI2 P;  5AW4 B;  1NU1 D;  3AEG C;  3C1L A;  4OVN F;  1KQF B;  3TNU A;  4PD4 H;  2P2U A;  3ABV C;  1L0N K;  4C46 A;  1NTZ J;  5KAI E;  1PPJ E;  1NU1 K;  1HVV A;  1BCC D;  3M0A A;  1GK4 A;  2GUS A;  2IX7 C;  2PAJ A;  5GTH E;  1E79 H;  2HLO A;  1P84 D;  4UB8 E;  1RQV A;  3MIW A;  2CK3 H;  4WBA A;  4EYY Q;  3KZI H;  1OVU A;  4ASW A;  3I55 P;  1A02 F;  3E1I A;  1KIL C;  2A06 D;  3P8M C;  3CC4 P;  1M56 D;  1ZME C;  1NTM E;  2WTY A;  3L70 G;  1Q7Y Q;  3S9O A;  2JEE A;  3H1H D;  4QMA A;  2N9B A;  1JM0 A;  1HJB A;  3CCE P;  1EDI A;  4LLH A;  2JWA A;  1PPJ D;  1JY3 P;  1PGJ A;  3CWB D;  3E7K A;  1N86 A;  4L73 A;  1T2K C;  1M1J A;  2LKM A;  2OYO A;  2QSI A;  1SFC B;  3U1C A;  2YKQ A;  1Q86 Q;  1KQG B;  2N1T B;  2FKW B;  3AE5 C;  3ZDM A;  4ZKP A;  4OGQ D;  1MKM A;  2FYU E;  1L0N E;  2B87 A;  1LTT C;  3ITK A;  3L71 E;  1YQ3 C;  5CJ0 A;  5AVS B;  1YQ4 C;  4BRY A;  2N1T D;  4JYB A;  1X22 A;  1NO4 A;  4K35 A;  2RN0 A;  1RH5 B;  3WUU A;  1IFP A;  5CCG D;  2HOD A;  1VQN P;  2QA4 P;  3MP7 B;  2Q3E A;  2H7H A;  4DT0 A;  1K05 A;  3G6E P;  1NGM B;  1AQT A;  3V4Q A;  2Q1K A;  1SQQ K;  1LWU A;  1EDK A;  1R5L A;  2FXO A;  2B88 A;  3AEB C;  4WY4 D;  4JF7 A;  4ASV A;  2MKV A;  2W6B A;  2FYU K;  3FXD A;  1Z56 A;  1QVG O;  1YBK A;  3NFQ A;  4GIF A;  4W7Z A;  3HD7 D;  3MGN A;  3USS A;  1FDO A;  5BU8 B;  3RL0 g;  5AVW B;  1BE3 J;  2Y0E A;  2JP3 A;  1KC8 Q;  3L70 E;  1FZC C;  1YJ9 P;  1PFI A;  2Y0D A;  1N2D C;  4AUW A;  3L75 G;  1AVO A;  2M0B A;  3V2R A;  3G9R A;  3O6Q B;  5CBN A;  1CI6 A;  4I7Z B;  1ZV8 A;  5APT A;  4H44 B;  2N9Y B;  3IF4 A;  2ALC A;  2NPS A;  2QM7 A;  2BEZ F;  2C9L Y;  1NTM K;  4IFD K;  1XTG B;  1L4A C;  1VL2 A;  3V5B A;  3EFG A;  4R4M A;  1QLE D;  4OH8 B;  5APW A;  5AW6 B;  3TF5 A;  1GL2 B;  2O01 J;  3G71 P;  3CMA P;  2QG4 A;  3PP5 A;  1S9K E;  1YIT P;  1LTA C;  1K04 A;  1KYO I;  1FU1 A;  3AEA C;  2HG5 D;  4HB1 A;  1T6A A;  3RK2 B;  1IFI A;  5AW2 B;  5KLV E;  1NHL A;  1GL2 A;  1NTZ E;  2NPS C;  1AV1 A;  1SQB G;  4XFJ A;  1N7S D;  2WT7 A;  4ZNC A;  2OYH B;  1AVY A;  1IFJ A;  1L4A B;  2JWD A;  2WPQ A;  2YIU C;  4I7Z C;  3HTK A;  5AVY B;  5M1B A;  1NTM G;  1VF5 D;  2IPP A;  2W6J H;  3VN0 A;  3HRN A;  1AW6 A;  1SQB E;  1SQP E;  3VYI A;  2ZT9 B;  3NMD A;  3W67 A;  3CWB G;  3O8Z A;  1KFM A;  3OW2 O;  1XTC C;  3LW5 J;  3RK3 E;  2FXM A;  1SP4 A;  4N3Y B;  2C9N Y;  2KZI A;  3CXH D;  1LT9 C;  1X9V A;  1VQM P;  2FXP A;  1A02 J;  1LGH B;  3E1R A;  4YXW H;  1BCC E;  1DH3 A;  1OVR A;  1M57 D;  2L5G B;  2WSF H;  3CX5 I;  4M3L A;  1NYH A;  1M1J C;  1IZN B;  1OXZ A;  1PP9 D;  3HUS C;  2P7J A;  2ZAE B;  1S5L E;  3MUD C;  3LW5 H;  1EXI A;  1RE3 A;  2DW3 A;  1F4S P;  1HGV A;  4PJ0 E;  1E5W A;  4Y99 B;  1ZRT D;  3H1L E;  1LP1 A;  2E75 D;  3BCC J;  4HH2 A;  4PV1 C;  5B66 H;  2I8D A;  3GHG C;  1MFT A;  1URQ C;  2LR2 A;  2XNX A;  1NTM J;  4LGD E;  1RY3 A;  3SFD C;  3HUS A;  2B87 B;  3Q1M A;  2OGU A;  4I1L A;  1GZL A;  2I1K A;  3L74 E;  2E74 D;  1FAV A;  2NRG A;  2N1T A;  3H25 A;  1HWT C;  3BAS A;  2JJL A;  5CCG A;  1Q81 Q;  1X79 B;  4IL6 X;  1N7S A;  1L0L G;  1M1J B;  1G2C A;  1SQV D;  4H13 B;  2ZVN B;  3D6Z A;  2QJY C;  2E75 C;  1KB9 H;  2ZYD A;  1X8Y A;  1SQP J;  2KB7 P;  2UWJ E;  4YPC A;  1OW6 A;  2XV5 A;  2BCC E;  1PP9 G;  2GUV A;  2YKP A;  1JY3 N;  3H1J D;  5TIS H;  1PGQ A;  1W2B O;  2AXT E;  4H0L B;  4C7N A;  3AE7 C;  1FZG A;  1RF1 B;  2Q5U A;  4WB4 A;  4XA4 A;  3JSV C;  2QJP B;  3AED C;  1KZU B;  2V4H A;  3OA7 A;  1JTH B;  1PP9 E;  2WQY C;  2XU6 A;  4N6J A;  1ZR4 A;  4GOD A;  4H0L C;  1JY2 O;  1PP9 J;  2IBZ E;  3SSU A;  2CPS A;  2K9Y A;  4BRY B;  2K3R A;  4C7N B;  3GG2 A;  5AW9 B;  1CW5 A;  1EDL A;  2AXT H;  3L35 A;  3L73 E;  3P8C D;  2KUB A;  4L75 A;  2SPZ A;  3TNU B;  1N73 B;  2E75 B;  1X0T A;  4KT0 J;  3TGU J;  4H13 C;  5DJT B;  1NVO A;  1KMI Z;  1BSN A;  2H43 A;  3S4R A;  4U3F J;  1USE A;  1SQB D;  1FOS F;  1SS1 A;  2FFD B;  1VQ4 P;  3TGU D;  1W2E A;  2MJZ A;  2M5A B;  1AJY A;  3RBZ A;  1JUN A;  3QWO C;  3RK3 C;  3A0B H;  3ALC A;  4PV1 B;  2E5T A;  2FYU D;  3L74 J;  1BGY D;  3GW6 A;  1KN7 A;  3IFM A;  4Y99 C;  1Q90 D;  1G1J A;  2XDJ A;  3UIA A;  4DZO A;  3SWF A;  1DEE G;  1YTZ T;  2M5A A;  2D2C B;  1LTG C;  4WVZ A;  1FZC B;  1SQV K;  1SFC C; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  3RL0 C;  1SFC A;  1AQ5 A;  3T97 A;  5CCH C;  1N73 A;  4DOJ A;  2R5B A;  5CCH A;  4B86 A;  1KIL B;  2XKM A;  3M0D A;  3HE4 A;  3VP8 A;  4I2L C;  1PYC A;  3B5N D;  5CCH D;  5AVZ B;  1GL2 D;  3COQ A;  4WY4 C;  3HTK B;  5AW3 B;  3OJA B;  2OYI C;  3BAT A;  2OYH A;  1J2J B;  1GU5 A;  2ZFC A;  1CZQ A;  1URQ B;  3RK2 C;  3P32 A;  1KFN A;  1MUU A;  5AVU B;  5AVR B;  1N7S B;  1JMM A;  3H32 B;  1GL2 C;  2KYV A;  2Q7C A;  1T3J A;  2M3B A;  1H8A A;  3N7N A;  3HUS B;  2P67 A;  3L37 A;  4EOT A;  3NXS A;  1NH4 A;  1IJD B;  1LTS C;  3M9H A;  4C7R A;  1JCC A;  1HUC A;  2J58 A;  2YO2 A;  1IO4 A;  3VOP A;  3RL0 D;  1MV8 A;  4XE5 B;  1QL1 A;  2WSC H;  3B8E B;  3GHG A;  3NTN A;  1LWU B;  4EIJ A;  2Z4E A;  2Z5I A;  2A45 G;  3BRT B;  1H89 A;  2HOD B;  1OWA A;  1J1D C;  1QP9 A;  2OAR A;  1G1I A;  1FZE A;  1LTJ C;  2FFD A;  3H32 A;  1N7L A;  2R5D A;  2E43 A;  5APY A;  3A7O A;  5APV A;  1F5E P;  5AW8 B;  2W6A A;  1PYI A;  2KLV A;  1RF1 A;  1SQV K;  3II6 A;  2OYH C;  1SFC C;  1FZA A;  2PP6 A;  1IFD A;  3H6P A;  1NWQ A;  3RK2 D;  1SQB K;  2BAS A;  1JY2 P;  1KIL A;  2KOG A;  1LTI C;  3MD0 A;  1NTZ K;  1JY2 N;  1T3U A;  3LIE A;  3M06 A;  4KHX A;  1NOH A;  5APX A;  2WSE H;  3IR9 A;  2QM8 A;  3BVH A;  3A3Y B;  1ZN5 A;  3HE5 A;  3A2A A;  1JOC A;  4W80 A;  2Z5H A;  3V2Q A;  2WZ7 A;  5AVX B;  3HD7 B;  2O1K A;  5AW7 B;  1SFC D;  3HD7 A;  2W27 A;  3KPE A;  1EQ7 A;  5CMZ A;  3TSI A;  2R32 A;  1IFN A;  3B5N C;  2WIT A;  3KQG A;  5APU A;  5AW1 B;  1MFZ A;  1HBW A;  1FBM A;  3L36 A;  1J1E B;  1NKZ B;  5CJ4 A;  3M9Q A;  1N7S C;  1GTW A;  3M0D C;  1H88 A;  1FDM A;  3VTP C;  1N73 C;  2ERE A;  2O01 H;  2Q3I A;  4N78 E;  2WWW A;  3I5C A;  1LTJ A;  3B5N B;  1JNM A;  2WPR A;  1LTB C;  4HYT B;  3RK3 D;  3M91 A;  3A5T A;  2A45 H;  5AVT B;  1SQP K;  4N78 D;  3HD7 C;  3TYY A;  2HAP C;  3KYQ A;  2CPB A;  3HE4 B;  1GW3 A;  1VPC A;  2A45 I;  3P7K A;  2XZR A;  1GU4 A;  1DEB A;  1M7L A;  5KLV K;  3CLQ A;  3GHG B;  1YTZ I;  2YO3 A;  1KIL D;  3VP9 A;  1IK9 A;  5AVV B;  1CSB A;  2N1T C;  1FZC A;  1T8Z A;  3BRV B;  4I6M C;  3MTU E;  1RF0 C;  3P8C E;  3V2N A;  4WY4 A;  2HYN A;  1NAF A;  2WT7 B;  1GK6 A;  3RL0 B;  5AW0 B;  2ZXE B;  1URQ D;  2YNY A;  4IFM A;  4JYC A;  1GD2 E;  3WMM 0;  4ZKU A;  3HE5 B;  4LC1 A;  2NPS D;  1LTJ B;  2H8P D;  1FJK A;  4AQR D;  1URQ A;  3SWF A;  5KJ7 A;  2P1J A;  3U1A A;  1ZLL A;  2NPS B;  5CHX A;  2FFD C;  2J59 M;  1J1D B;  3TK1 A;  1FJP A;  2C0X A;  1RF1 C;  5APS A;  1S9K D;  2HPC A;  4O9B A;  3N4X A;  2GM4 A;  1JO5 A;  1G2C B;  2YMY A;  4AYC A;  1QL2 A;  1WRG A;  2IFM A;  5BVZ A;  1DX7 A;  1RE4 C;  2WPS A;  4IFF A;  1FZF A;  3G3Z A;  5AW5 B;  3SWY A;  1JY3 O;  5KJ7 D;  3MUD A;  1WT6 A;  1FZB A;  2Q9I A;  2M8R A;  5AVQ B;  3L4F A;  1RE4 A;  2KP8 A;  5KTB A;  2HPC B;  1JCD A;  4W7Y A;  2VRS A;  3VMY A;  3OAK A;  1JTH A;  1RF0 A;  2I1J A;  4GT1 A;  3LID A;  2OYI A;  1L4A A;  1IC2 A;  5APQ A;  5KJ7 C;  1SVF A;  2H43 A;  3U59 A;  2R3C A;  2YKO A;  1SLQ A;  2KSJ A;  4GKG A;  4RES B;  5CCG C;  1L4A D;  3V2P A;  5BU5 A;  1FOS E;  3EQ2 A;  1KQL A;  1J1E C;  1L0L K;  1NTK K;  1ZR2 A;  2POH A;  4WY4 B;  1CI6 B;  1T2K D;  2OYI B;  2ERG A;  1GW4 A;  3C9I A;  1HTL C;  1NKN A;  1YYC A;  1IFM A;  2HFE D;  2FYZ A;  1LT9 A;  1D66 A;  3R2P A;  2ER8 A;  3M9B A;  3V4W A;  1LT9 B;  1SQX K;  2IFN A;  3KDP B;  1VDF A;  1HH0 A;  1AFO A;  1GDT A;  3CL3 D;  3RK3 B;  2O1J A;  3VMZ A;  1RE3 C;  1HGZ A;  3CI9 A;  2E42 A;  1LWU C;  3B5N A;  5AW4 B;  3TNU A;  2P2U A;  1L0N K;  4C46 A;  1NU1 K;  1HVV A;  3M0A A;  1GK4 A;  2GUS A;  2IX7 C;  2PAJ A;  2HLO A;  4WBA A;  3MIW A;  1A02 F;  3E1I A;  1KIL C;  3P8M C;  1ZME C;  2WTY A;  2JEE A;  1HJB A;  4LLH A;  1T2K C;  1JY3 P;  1N86 A;  1M1J A;  2LKM A;  1SFC B;  3U1C A;  2YKQ A;  2N1T B;  2FKW B;  4ZKP A;  5AVS B;  1LTT C;  5CJ0 A;  2N1T D;  4JYB A;  1NO4 A;  5CCG D;  2HOD A;  2H7H A;  3V4Q A;  1SQQ K;  1LWU A;  4WY4 D;  4JF7 A;  2W6B A;  2FYU K;  1Z56 A;  3NFQ A;  4GIF A;  4W7Z A;  5BU8 B;  3HD7 D;  3MGN A;  5AVW B;  1FZC C;  1PFI A;  1N2D C;  4AUW A;  3V2R A;  1CI6 A;  1ZV8 A;  5APT A;  2ALC A;  2NPS A;  2QM7 A;  2C9L Y;  4IFD K;  1NTM K;  1XTG B;  1L4A C;  3V5B A;  3EFG A;  5APW A;  4OH8 B;  5AW6 B;  1RF1 B;  1GL2 B;  3PP5 A;  1S9K E;  1LTA C;  1FU1 A;  2HG5 D;  3RK2 B;  1IFI A;  5AW2 B;  1NHL A;  1GL2 A;  2NPS C;  2WT7 A;  1N7S D;  2OYH B;  1IFJ A;  1L4A B;  2WPQ A;  5AVY B;  3HTK A;  2IPP A;  1AW6 A;  3VN0 A;  3HRN A;  3VYI A;  3NMD A;  3O8Z A;  1KFM A;  1XTC C;  2FXM A;  1SP4 A;  4N3Y B;  2C9N Y;  1LT9 C;  1X9V A;  1A02 J;  1LGH B;  1DH3 A;  2L5G B;  3VMX A;  2WSF H;  4M3L A;  1M1J C;  1OXZ A;  3HUS C;  2P7J A;  3LW5 H;  1RE3 A;  1F4S P;  1HGV A;  1E5W A;  4Y99 B;  4HH2 A;  3GHG C;  1URQ C;  2XNX A;  4LGD E;  1RY3 A;  3HUS A;  4I1L A;  1GZL A;  2I1K A;  1FAV A;  2N1T A;  1HWT C;  3BAS A;  2JJL A;  5CCG A;  1X79 B;  1N7S A;  1M1J B;  1G2C A;  1X8Y A;  2KB7 P;  2XV5 A;  2GUV A;  2YKP A;  1JY3 N;  4C7N A;  1FZG A;  2Q5U A;  4WB4 A;  4XA4 A;  1KZU B;  3OA7 A;  1JTH B;  2XU6 A;  4N6J A;  1ZR4 A;  1JY2 O;  2CPS A;  4C7N B;  5AW9 B;  1CW5 A;  3L35 A;  3P8C D;  1N73 B;  3TNU B;  1FOS F;  2FFD B;  1W2E A;  2MJZ A;  1AJY A;  1JUN A;  3RK3 C;  3ALC A;  3IFM A;  4Y99 C;  2XDJ A;  1G1J A;  3UIA A;  4DZO A;  1YTZ T;  1LTG C;  1FZC B;  2N9B A;  2C0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...