1HWTC

Structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
b'RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*CP*TP*AP*TP*TP*AP*TP*CP*GP*CP*TP*AP*TP*T
publication title Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/dna
total genus 22
structure length 70
sequence length 70
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hwtC02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1hwtC01
5APVA 5AW5B 3L37A 1HJBA 4AUWA 3TYYA 3L36A 1CSBA 3IR9A 3UIAA 4XE5B 2JJLA 5CMZA 2KP8A 2P2UA 1A02F 3A2AA 1GU4A 3TNUB 1D66A 2WTYA 4GT1A 1OXZA 3LIEA 1MV8A 3SWFA 2E42A 1AJYA 3B8EB 1S9KD 5APTA 5AW4B 1ZMEC 4LC1A 4C7NB 2XZRA 2C9LY 1FAVA 5AVRB 3VMZA 1KQLA 1NAFA 1CI6B 5AVXB 2YO2A 5AVVB 5AVZB 2QM8A 1H88A 5AVWB 3HE4B 3VYIA 1HBWA 2WPQA 1PYIA 3A3YB 1X8YA 1JUNA 3P8MC 5AW7B 5APUA 3LIDA 1FOSF 1A02J 2Z5HA 1G2CB 3HE5A 3M0AA 1GD2E 3V4WA 1GK4A 4M3LA 2P7JA 3M0DA 3L35A 5APXA 2P67A 5AVQB 5AW9B 5AW0B 3TK1A 5AVTB 2WPSA 1FOSE 3NFQA 2ALCA 1QP9A 4B86A 2Q5UA 2Z5IA 1MFZA 3COQA 5AW2B 5APYA 1F4SP 3M91A 1GTWA 1GU5A 3A7OA 3VMYA 1J2JB 4DZOA 2XV5A 1T2KC 1DH3A 2WT7B 3VN0A 3TNUA 3VMXA 1H8AA 3M06A 5APWA 4JYCA 2YNYA 5APQA 3P32A 5AVYB 2HAPC 3MD0A 4C7NA 3M9BA 2XU6A 2R5DA 3O8ZA 1JNMA 2IPPA 1PYCA 2Q7CA 5AW1B 1AW6A 1CI6A 2R5BA 4AYCA 2WWWA 2WPRA 3HE4A 3MGNA 1SP4A 5AW6B 4RESB 2ZFCA 3OAKA 3M9HA 4AQRD 3I5CA 2ER8A 1HUCA 1SLQA 1CZQA 2QM7A 2ERGA 2EREA 2C9NY 1F5EP 2BASA 3NMDA 3NTNA 1NWQA 4C46A 1GK6A 2R32A 3VTPC 2N9BA 3KQGA 1HWTC 3V5BA 1H89A 4I2LC 2Q3IA 1T2KD 4HYTB 1YYCA 2ZXEB 4JYBA 2W6AA 3P7KA 2E43A 2R3CA 3A5TA 4EOTA 1IO4A 2VRSA 1GZLA 5AVUB 2H7HA 2WT7A 2YO3A 2W27A 3NXSA 3V4QA 4KHXA 5AVSB 1OWAA 5AW3B 4GKGA 4I6MC 3HE5B 3ALCA 5AW8B 1MUUA 3T97A 3HTKA 1S9KE 3KDPB 5APSA
chains in the Genus database with same CATH superfamily
4BXLA 1EZVE 2PFXA 1SVFA 3WUTA 2KP8A 1FE6A 2WSFJ 2WSEH 2KNCA 2G8YA 3RL0C 1OVUA 4TLFA 4WBAA 3S9OA 2LXBA 1KQFB 1H0TB 1NTZD 1L0LE 5APUA 4WWIA 3HE5A 1JY2O 1FZFA 3GG2A 3L35A 1LTGC 3FWLA 1L0LJ 4W7YA 1GTWA 5B66H 3WMM0 4ZKUA 1P84E 3MD0A 1X79B 3CCLP 5DJTB 1S4XA 1RE3A 1FJPA 1OFCX 5TISE 1GW3A 1QGKB 3PRJA 1HUCA 3TGUG 1VQ5P 3AE4C 2EREA 2C9NY 4XA4A 2W83C 3L75D 1SS1A 1FDMA 1T2KD 1KILA 4EOTA 4KT0J 1NGMB 2E74B 2H7HA 2O1KA 4OGQD 3L73E 3HE5B 1NVOA 3RK3B 1Q82Q 3T97A 1U7MA 4GDOA 2W8ZA 1SFCA 1IFPA 1J1EB 4XE5B 3L73J 4JQ0D 1IJDB 1Y9BA 1D66A 3RK3E 2H8PD 2IZ1A 1SQPD 3C8VA 3L71D 2XZRA 2C9LY 1SQPG 3L71G 5EFWB 3O6QA 3FGAD 4IL6X 2IDBA 1Z56A 1PP9G 3CLQA 2FYUG 2ALCA 3NFQA 1T3UA 2N1TC 1KILB 2YKPA 1MKMA 1LJ2A 1LWUC 5APQA 5CCGC 3CXHH 2GA1A 3T97B 1KILE 2Y0EA 1SFCB 1SQQG 4PD4E 3EQ2A 2M5AA 2AEJA 2CPBA 3B5ND 5KLIB 1JB0J 1G2CA 2W6JH 2OYHC 2KLUA 1UIXA 3H1JD 3L72G 5L8RJ 3A0HE 3FWNA 5B5EH 1IFNA 3M9QA 2FBWC 3O6QB 4RJTA 4PJ0H 3SSUA 4JBZA 1IFIA 1URQA 2HG5D 3G4SP 2W90A 2Y9ZA 1VQ9P 5CMZA 5KLVG 3E1IA 2WSEJ 3RGUA 1OMIA 1EZVD 1ZR2A 1KORA 1YQ3C 1R5SA 1H88A 3Q1MA 3WUVA 2V4HA 4U7JA 3L74E 4Y28J 1GW4A 1J1DB 1PYIA 1JUNA 2M5AB 5AW7B 3LIDA 2Q3EA 1NAYA 5B66E 1G2CB 1NTKK 4M3LA 2A45G 4I7ZC 2QJKB 1LT9A 3L74J 1MFZA 3CWBE 1L0LD 1RF0C 3A7OA 3SFEC 1K05A 1BGYE 4EYYQ 1L0LG 3CCJP 2BEZF 1U7JA 4C7NA 3CWBJ 1URQB 3P8CE 1BGYJ 2K88A 1L0NK 3MGNA 1X9VA 1P84D 2OYIA 1ZV8A 3I5CA 3CCMP 2FYNB 2H43A 1NYHA 2R32A 3VTPC 2N9BA 1NU1K 1G1JA 2R44A 1S5LH 2VRSA 2E75C 3WU2H 5C39A 1OWAA 4LLHA 3TF5A 1PGQA 3D71A 5AW8B 1JM0A 3H1KG 4OVNF 4W80A 1JO5A 3TYYA 3QH9A 1N7SA 3L73D 2OTLP 4WY4A 2AEMA 1NH4A 2WTYA 2RKLA 5APTA 2E74D 4C7NB 2BCCE 2PGDA 1IK7A 1QEXA 2ZVNB 2DW3A 1IC2A 1L4AA 1VDFA 1N7LA 3RK3D 2ZYDA 4PV1C 2OYIB 3HUSA 2KIKA 1R5LA 2BCCJ 3GHGC 3QWOC 1KYOH 3IF4A 5CCHA 1JMMA 2RN0A 2FKWB 1OIPA 1BSHA 1EDIA 3CXHE 3SFDC 1WRGA 2N9YB 3N4XA 5APWA 1KQSO 2ZT9B 2WZ7A 2OTKE 2A45H 1JNMA 2IPPA 2POHA 1CI6A 2R5BA 1SP4A 4ASVA 2KK7A 2L91A 3S1KA 1LNQA 1SLQA 4WY4B 1ZRTD 1GK6A 5B5EE 1KILD 3GW6A 1W5CE 3TGUE 2CK3H 4PJ0E 2Q3IA 4HYTB 2ZXEB 4PD4D 1YBKA 1GZLA 1L4AB 4NPFX 1NHLA 3NXSA 3HUSB 1USEA 3TGUJ 4U3FG 4BRYA 1RF1C 3L70G 1SFCD 4I6MC 2KLVA 1XTCC 5AW5B 1QLED 4BWNA 1NOHA 1K8AQ 2O01N 1GU4A 1RE4A 1IFMA 4GT1A 2E42A 4HH2A 2MJZA 3M0DC 1CI6B 2QE7H 2YIUC 5AVXB 1FZCC 3JC22 4MN4C 4R4MA 1X8YA 2Y9YA 5KAFE 5AVQB 5AW9B 2A45I 2PP6A 3L74D 5AW2B 1PP9E 3M91A 1Q90D 3AE3C 3V2RA 1WT6A 1T2KC 1SQPK 2JWDA 1H8AA 1FZGA 2YNYA 4BRYB 1BE3G 1S1CX 2R5DA 3CWBD 1BSNA 1PP9J 3VP9A 2FYUJ 1BGYD 3RK2B 1BGYG 1LTJC 3EWKA 3CCRP 2FYUK 1CZQA 1S5LE 2QA4P 3WU2E 3IN6A 3P8CD 1SQQE 2OTJP 4A7PA 3CMAP 1JTHA 2E76D 3AEAC 1IO4A 1SQQJ 1URQD 3L72E 1H0TA 3RL0B 1SQQK 3KPEA 3R4YA 1PZQA 3HTKA 3KDPB 2FXPA 5APVA 3L37A 3L72J 2OQQA 1K9MQ 2J5UA 2FXMA 3LIEA 2KUBA 4DOJA 3BRTB 3MZWB 1KYOE 1D7MA 1JOCA 2BCCD 5KLVJ 1SQBG 1NTMG 2LXCB 2A06E 2P7JA 2BCCG 1JTHB 2Z5IA 5GTHH 5KLVK 3COQA 1KQGB 5APYA 1JMBA 2KZJA 2JP3A 3AE7C 1BCCG 1VQPP 5M1BA 1OW8A 2N1TA 3CXHD 3KXDA 3HTKB 1DD3A 2QJPC 5CJ0A 3CD6P 1KZUB 1LWUA 5K5GB 5CCGA 4GOFA 4IOIH 3MUDC 3KQGA 1SQXG 1WMKA 2JDIH 1L0LK 1USDA 1YIJP 2ZT9D 3A5TA 5AVUB 1IK9A 1JY3P 2YO3A 2R3SA 3TGUD 4PD4I 2QVAA 4GKGA 3IAOA 2BEQD 4L74A 1N7SD 1T8ZA 4WY4D 1BDDA 1ZW0A 1PGPA 3H1KE 3UIAA 2YMYA 3MP7B 3Q3DA 4D6TE 5AW4B 1L4AD 4O9BA 3H1LG 4R4LA 4H13C 3H1KJ 2N1TB 2IBZG 3VMZA 2SPZA 2O1JA 1PIXA 2KZIA 1LWUB 1IFJA 1M7LA 5CCHD 3AE6C 2C0XA 2Z5HA 1MFTA 2J59M 3H1HG 2WMMA 1HH0A 1KC8Q 1LTBC 2AEFA 4OWFA 2OYHB 3HD7C 1Q7YQ 5CBOA 1PP9D 4TT3H 2FYUD 1FDIA 3OA7A 3WUUA 1RQVA 4IFDK 4GODA 1KFNA 3VP8A 1VF5C 3AEEC 3CL3D 2B87A 2AXCA 3AE5C 4NPDA 1JEKA 4JYBA 2M0BA 2B9BA 3EFFK 4H0LC 1SQQD 3V6IA 3OW2O 1M1JC 3RK2D 4U3FE 3L70E 2OYOA 4I1LA 3L72D 3S4RA 1RH5B 1JY3O 4IFMA 1EXJA 5BU8B 1DX7A 2MKVA 3A2AA 4U3FJ 3L70J 4I7ZB 3B8EB 3MIWA 2KOGA 1RQUA 4L76A 2O3JA 5AVRB 3PH0A 3RL0D 5GTHE 5KLVD 1GK4A 2IFMA 2NRGA 2B87B 1KYOD 1LT1A 2HYNA 2IFNA 1VQ8P 3GHGA 3N7NA 2A06D 2V7QH 3FXEA 2A06G 2WITA 3O8ZA 1PYCA 1GL2C 1BE3E 2M3BA 2E75B 2IYPA 3Q5SA 3CC2P 3U1CA 2P1JA 3HE4A 5AW6B 1VQ7P 2ZFCA 1M90Q 3TDKA 3CXHI 5KAFH 1BE3J 3U1AA 5H2FH 3V5BA 2WSSH 4I2LC 3F89A 4HJGH 1R8EA 2M8RA 2YKOA 4HB1A 4Y99C 3RBZA 1EDJA 3V4QA 3Q2YA 2OGUA 5AW3B 1LTIC 1PGJA 2GUSA 1M1KQ 4AUWA 2Y0CA 4PV1B 1CSBA 1LTTC 1RF1A 4YXWH 3GHGB 4KJMA 1MV8A 3SWFA 2W6BA 4WB4A 4ZNCA 3GF7A 2FFDC 3H1KD 3AEDC 2IBZI 3HE4B 1OX3A 3OJAB 1A02J 1JCCA 4D6TG 3ITKA 2Q1KA 1FS0E 3M0DA 1OVVA 1SQBE 1NTME 2WPSA 4ZMDA 1FZCA 1F4SP 3CCVP 1N73C 3BCCE 1PPJE 3FX0A 2E76C 4DZOA 3H25A 1QVGO 3BRVB 1SQBJ 1NTMJ 1GDTA 1FC2C 1BCCE 2NPSC 2XU6A 4H44C 5CCGD 1NTMK 5KJ7C 5KKZC 1Y8AA 4RESB 3OAKA 2D2CC 1OW6A 2Q6QA 1RF1B 2ER8A 1BCCJ 2H89C 2IYOA 4Z1MH 2QJYC 2QM7A 4DT0A 5KTBA 3AE9C 1PL5A 1H89A 3AEBC 1X22A 1LTJA 2R3CA 1SQXE 2P10A 1LT9C 3CI9A 1SQXJ 2YIUB 2H88C 1FZCB 2UWJE 1S5LX 1SQXK 1A02F 1NO4A 4U3FD 1AQTA 1S2EA 3L70D 2ITAA 3VOPA 2GUVA 3H1LE 4JPZB 3CCUP 3BASA 5DJUB 1M8OB 2PAJA 3VYIA 2IBZE 3P8MC 1W2BO 2OARA 1PV3A 3AEGC 2XNDH 3CX5H 3C1LA 3L75E 2P67A 3H1LJ 5AVTB 3CCEP 3BVHA 2Q5UA 1YI2P 1LTJB 1ZN5A 1GU5A 1E79H 3H1HE 1KYOI 3L75J 3ABVC 2V7QJ 3I55P 1AW6A 1VL2A 3H1HJ 5E79H 5H2FE 1N7SC 3D6ZA 1KFMA 2XNXA 3TSIA 1AQ5A 1BE3D 1HJ0A 4ASWA 2Y0DA 1NTKG 3HRNA 4OGQC 1ZXGA 3MUDA 1AFOA 2E75D 3ALCA 1SQVE 1U57A 1MUUA 1S9KE 4IFFA 3G6EP 2JR8A 5CHXA 1SQVJ 3CCQP 1KD1Q 5GTIH 3G3ZA 3GLMA 3CX5I 3H1IE 1JY3N 3KYQA 5BU5A 2ZVOB 1NAFA 4QMAA 1IFDA 1FBMA 2WPQA 1QX8A 3H1IJ 4PV1D 3V4WA 1AA0A 3PJSK 2QJPB 1J2JB 1JCDA 4HKZH 4JYCA 1SQBD 1NTMD 2HAPC 1FJKA 1UIIA 2FXOA 2AXTH 4AYCA 2WWWA 4N78E 3BCCG 1PPJG 3B5NC 2KI7B 4C7RA 1BCCD 3HD7A 1AVOA 1YTZT 3II6A 2LKMA 4NPEA 2W6AA 3V2QA 3P7KA 1MZ9A 2FY8A 1YHQP 2W27A 2WVRA 3CPWO 1NKNA 5KAIH 4H13B 3K5BA 3A0BH 1SQXD 1Q2NA 1OZHA 5APSA 1ZOYC 1LP1A 3Q5PA 2G3AA 1CW5A 4WVZA 1NTZG 1M1JA 1BDCA 4IL6H 4GOEA 1AJYA 3E7KA 1EXIA 2OYHA 1KB9H 4YPCA 1KQLA 3CX5E 5AVZB 5AVWB 1VQOP 1KV4A 3V2NA 1VPCA 1FDOA 3GMAA 3HD7B 2KXPB 1VQLP 3V2PA 3M0AA 1GD2E 1TU3F 3H1LD 5AW0B 3TK1A 4DJGA 2IBZD 2WQYC 4EIJA 2I1JA 1VF5B 2KNCB 5E79E 1RHZB 4D6TJ 3L75G 1RY3A 3H1HD 1FZAA 4H0LB 1YJ9P 1LP1B 2XDJA 4N6JA 1M1JB 2NZ2A 2ERGA 3NTNA 2Z4EA 1Q86Q 1GL2A 4L75A 1E5WA 4L73A 2O01H 1RF0A 2HFED 4KHXA 1VQ4P 2KS1A 3E1RA 2B88A 3AE2C 5GTIE 1KB9I 3LW5H 3PLNA 2CPSA 2E74C 1W2EA 1SQVD 4N3YB 3EFGA 1N2DC 1OXZA 3AE1C 1S9KD 1SQVG 3R2PA 1EDKA 2ZXXA 3IFMA 2JWAA 3RK3C 1DD4A 2XKMA 3W67A 1J1EC 4GIFA 1HBWA 2K9YA 2ZJSE 1ZRTE 3L4FA 2J58A 3H1ID 2FFDA 1GL2B 3H1IG 3D6YA 2HODA 2WPVB 1FOSE 4B86A 2QIWA 1RE3C 1QL1A 1HF9A 2AXTE 2K37A 5CJ4A 2QG4A 2KS1B 3AE8C 2YMKA 3H32A 3GF3A 2KSEA 1N73A 2Q7CA 2YKQA 3H1JG 1YITP 4Y99B 5CBNA 1N8RQ 1KILC 2NPSA 3NMDA 1NWQA 4C46A 1OW7A 3G71P 3CC4P 4UB6H 1DEBA 4DCKA 4N78D 5KJ7A 2WSCH 5KAIE 3USSA 2FYZA 3ZDMA 1NTKE 3A0BE 1SFCC 2WT7A 4UB8H 4RO0A 3RBXA 1HVVA 2FFDB 5KLIC 4IL6E 1EZVG 1NTKJ 2HODB 1S3JA 3F5HA 1HJBA 2RH0A 3IR9A 1KB9E 2JJLA 2P2UA 1L0NE 2M3EA 3D70A 3H6PA 3H32B 1HGZA 1G1IA 1N73B 2E76B 2HPCA 1FZBA 1NU1E 3PTZA 4H13D 1L0NJ 3JCUH 3A3YB 1T6AA 3BATA 1QVFO 1FOSF 1QL2A 2NPSB 4H44B 1LGHB 3CX5D 1YJWP 1NU1J 5KKZB 1QP9A 3MTUE 2D2CB 2K3RA 4CPGA 2YXQB 2QJYB 2WT7B 3KZIH 3VMXA 2ZYAA 3AEFC 3U59A 1J1DC 4YXDC 4D6TD 3JSVC 4OH8B 4EDFA 1LTSC 1ZLLA 5AW1B 3HD7D 2QJKC 3MHVA 3KHUA 1L2PA 2C0WA 1LT9B 1HWTC 2N1TD 1YTZI 1VF5D 1YYCA 3SWKA 1URQC 2E43A 2HPCB 3BCCJ 4K3AA 1EC5A 2ZYGA 2O01J 3L73G 1SQBK 1NKZB 2FYNC 2QSIA 4H0LD 3C9IA 2I8DA 1AV1A 1LTAC 3LW5J 3L36A 4EI2A 1YJNP 1KMIZ 3FXDA 2WSFH 1NTZE 2PRRA 4W7ZA 1ZMEC 4LC1A 2P58A 1FAVA 3VMAA 1JY2N 5AVVB 2IZ0A 1FZEA 1EDLA 1NTZJ 3W68A 1OVRA 2E5YA 5TJHA 3AECC 1S72P 1NTZK 1Q81Q 2JEEA 1N7SB 1AVYA 2JKVA 2XV5A 3CCSP 3VN0A 3TNUA 2OYIC 3M9BA 1ZR4A 1XTGB 4OGQB 1K73Q 1PGOA 1K04A 1P84H 2HLOA 4UB6E 1GL2D 4LGDE 1F5EP 2BASA 4XFJA 2K9JA 1GMJA 2K1AA 1T3JA 4UB8E 2E5TA 2ZT9C 5TISH 3B5NA 1IZNB 2WSCJ 2L5GB 4ZKPA 1DIPA 4WY4C 1KTMA 5BVZA 2KYVA 1SQPE 1VQMP 1NTKD 3L71E 1EZVI 3Q5RA 1FU1A 3I56P 1HTLC 1L4AC 3TNUB 1ZP0C 2HR3A 1SQPJ 3HUSC 3PHLA 1VQ6P 3L71J 3JCUE 1JY2P 1EQ7A 2FYUE 3L74G 1KB9D 2QRXA 2YO2A 2QM8A 1VQKP 5CCHC 1L0ND 1YQ4C 2QEXP 3SWYA 1M57D 2KSJA 3B4SA 1L0NG 4RKUJ 2K9JB 3CWBG 3KZIE 2RMZA 5APXA 2I1KA 1PFIA 1NU1D 3B5NB 3RL0g 2KB7P 1NU1G 1SQVK 3VMYA 4YTPC 1DH3A 1P84I 3M06A 1N86A 3CC7P 3CMEP 5AVYB 3P32A 4K35A 1HGVA 1NJIQ 3PP5A 3B71A 3G9RA 1DEEG 2JO1A 2NPSD 2WPRA 1VQNP 4H44D 1KN7A 3M9HA 2B89A 4AQRD 4JF7A 3H1JE 5KJ7D 1M56D 1X0TA 2D2CD 4PD4H 3H1JJ 3BCCD 1PPJD 1Y47A 2LR2A 3RK2C 2ZAEB 5KLVE 5AVSB 2YXRB 2Q9IA 1RE4C 3A0HH 2IX7C 2GM4A
chains in the Genus database with same CATH topology
2GUSA 3LW5H 5AW5B 4AUWA 1CSBA 1LTTC 1SVFA 1NOHA 1RF1A 2CPSA 2KP8A 3GHGB 1W2EA 4N3YB 1GU4A 1RE4A 1IFMA 3EFGA 1N2DC 1OXZA 1MV8A 4GT1A 2WSEH 3SWFA 2W6BA 2E42A 4WB4A 1S9KD 3R2PA 4HH2A 2MJZA 3IFMA 2FFDC 3RK3C 3RL0C 2XKMA 3M0DC 4WBAA 1CI6B 5AVXB 3HE4B 1J1EC 4GIFA 1FZCC 1HBWA 3OJAB 1X8YA 5APUA 1A02J 1JCCA 3L4FA 2J58A 3HE5A 2FFDA 1JY2O 1FZFA 5AVQB 1GL2B 3M0DA 3L35A 1LTGC 5AW9B 2HODA 2WPSA 1FOSE 2A45I 4B86A 2PP6A 5AW2B 1FZCA 4W7YA 3M91A 1F4SP 1N73C 1RE3C 1GTWA 1QL1A 3V2RA 4DZOA 1WT6A 1T2KC 3WMM0 1SQPK 4ZKUA 3BRVB 1H8AA 5CJ4A 1FZGA 2YNYA 1GDTA 3MD0A 2NPSC 1X79B 2XU6A 2R5DA 3H32A 3VP9A 1N73A 1RE3A 2Q7CA 2YKQA 5CCGD 1NTMK 4Y99B 5KJ7C 1FJPA 4RESB 3OAKA 3RK2B 1LTJC 1GW3A 1KILC 1RF1B 2ER8A 1HUCA 2FYUK 1CZQA 2QM7A 2EREA 2NPSA 2C9NY 3NMDA 4XA4A 1NWQA 4C46A 3P8CD 5KTBA 1DEBA 1JTHA 1H89A 4N78D 5KJ7A 1FDMA 1T2KD 2WSCH 1LTJA 1KILA 2FYZA 2R3CA 4EOTA 1IO4A 1SFCC 2H7HA 2O1KA 2WT7A 1URQD 1HVVA 2FFDB 3HE5B 3RK3B 1LT9C 3CI9A 3RL0B 1SQQK 3T97A 3KPEA 3HTKA 3KDPB 2HODB 1SFCA 5APVA 1J1EB 1HJBA 3L37A 1FZCB 3IR9A 4XE5B 2JJLA 1SQXK 2P2UA 1A02F 1NO4A 1IJDB 1D66A 2H8PD 2FXMA 3LIEA 3VOPA 2GUVA 2XZRA 3H6PA 3H32B 2C9LY 4DOJA 3BRTB 1HGZA 1G1IA 1N73B 2HPCA 1FZBA 3BASA 2PAJA 3VYIA 1JOCA 3A3YB 3P8MC 3BATA 1FOSF 1QL2A 2NPSB 2OARA 1LGHB 1Z56A 2P7JA 2P67A 1JTHB 3CLQA 5AVTB 3BVHA 3NFQA 2ALCA 1QP9A 3MTUE 2Q5UA 1T3UA 2Z5IA 5KLVK 3COQA 5APYA 1LTJB 2N1TC 1ZN5A 1KILB 1GU5A 2YKPA 2WT7B 3VMXA 3U59A 1J1DC 1LWUC 5APQA 5CCGC 4OH8B 2N1TA 1LTSC 1ZLLA 1AW6A 5AW1B 3HTKB 3HD7D 1SFCB 1N7SC 5CJ0A 1KZUB 1LWUA 3EQ2A 5CCGA 2CPBA 3B5ND 1KFMA 1G2CA 2XNXA 2C0WA 3TSIA 1LT9B 1AQ5A 3KQGA 2OYHC 1HWTC 2N1TD 1YTZI 1L0LK 3HRNA 1YYCA 1URQC 2E43A 3A5TA 2HPCB 5AVUB 1IK9A 1IFNA 1JY3P 3M9QA 3MUDA 1SQBK 1NKZB 2YO3A 1AFOA 4GKGA 1IFIA 3C9IA 3ALCA 1URQA 1MUUA 2HG5D 1N7SD 1T8ZA 1LTAC 1S9KE 4IFFA 4WY4D 3L36A 5CHXA 3UIAA 5CMZA 2WSFH 2YMYA 3E1IA 3G3ZA 5AW4B 4W7ZA 1ZMEC 1L4AD 4LC1A 4O9BA 1FAVA 1JY3N 3KYQA 2N1TB 5BU5A 3VMZA 1ZR2A 1NAFA 1JY2N 2O1JA 5AVVB 1H88A 1IFDA 1FZEA 1FBMA 1GW4A 1J1DB 2WPQA 1PYIA 1LWUB 1JUNA 1IFJA 5AW7B 1M7LA 5CCHD 3LIDA 2C0XA 2Z5HA 1G2CB 3V4WA 1NTKK 4M3LA 2A45G 1NTZK 2J59M 1LT9A 1MFZA 2JEEA 1N7SB 1HH0A 1RF0C 1LTBC 3A7OA 1J2JB 2XV5A 1JCDA 3VN0A 3TNUA 2OYIC 2OYHB 4JYCA 2HAPC 3HD7C 4C7NA 3M9BA 1ZR4A 1FJKA 1XTGB 1URQB 3P8CE 1L0NK 4AYCA 2WWWA 2HLOA 3MGNA 4N78E 3B5NC 1X9VA 3OA7A 4IFDK 1GL2D 2OYIA 4C7RA 1ZV8A 3I5CA 4LGDE 1KFNA 3HD7A 3VP8A 2H43A 1F5EP 2BASA 2R32A 3VTPC 1YTZT 3II6A 1T3JA 2N9BA 1NU1K 3CL3D 2LKMA 3B5NA 1G1JA 4JYBA 2W6AA 3V2QA 2L5GB 3P7KA 1MZ9A 2VRSA 4ZKPA 2W27A 1NKNA 1M1JC 1OWAA 4LLHA 4WY4C 5BVZA 3RK2D 5AW8B 2KYVA 4I1LA 5APSA 4W80A 1FU1A 1JO5A 1JY3O 3TYYA 4IFMA 1CW5A 5BU8B 1HTLC 1N7SA 1M1JA 1DX7A 1L4AC 4WY4A 3A2AA 3TNUB 1NH4A 2WTYA 3HUSC 1AJYA 3B8EB 3MIWA 5APTA 2KOGA 4C7NB 1JY2P 2OYHA 1EQ7A 5AVRB 1KQLA 1IC2A 2YO2A 5AVZB 2QM8A 5CCHC 5AVWB 1L4AA 1VDFA 1N7LA 3RK3D 3RL0D 2OYIB 3V2NA 1VPCA 3HUSA 3SWYA 2KSJA 3HD7B 3GHGC 3V2PA 3M0AA 1GD2E 1GK4A 2IFMA 5APXA 2I1KA 5AW0B 3TK1A 5CCHA 1PFIA 1JMMA 3B5NB 2FKWB 2HYNA 4EIJA 2KB7P 1SQVK 2IFNA 3VMYA 2I1JA 1DH3A 1WRGA 3GHGA 3N7NA 3N4XA 3M06A 1N86A 5APWA 2WZ7A 5AVYB 3P32A 2A45H 2WITA 3O8ZA 1JNMA 1HGVA 2IPPA 1PYCA 3PP5A 1GL2C 1RY3A 2POHA 1CI6A 2R5BA 2M3BA 2NPSD 3U1CA 2WPRA 2P1JA 3HE4A 1FZAA 1SP4A 5AW6B 2ZFCA 3M9HA 2XDJA 4N6JA 4AQRD 4JF7A 1M1JB 1SLQA 5KJ7D 4WY4B 2ERGA 3NTNA 1GK6A 2Z4EA 1KILD 1GL2A 3U1AA 3V5BA 4I2LC 2Q3IA 4HYTB 2ZXEB 2M8RA 2YKOA 1E5WA 2O01H 1GZLA 1L4AB 1RF0A 4Y99C 1NHLA 3NXSA 2HFED 3HUSB 3RK2C 3V4QA 4KHXA 1RF1C 5AVSB 1SFCD 5AW3B 2Q9IA 4I6MC 1LTIC 1RE4C 2IX7C 2KLVA 1XTCC 2GM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APV A;  5AW5 B;  3L37 A;  1HJB A;  4AUW A;  3TYY A;  3L36 A;  1CSB A;  3IR9 A;  3UIA A;  4XE5 B;  2JJL A;  5CMZ A;  2KP8 A;  2P2U A;  1A02 F;  3A2A A;  1GU4 A;  3TNU B;  1D66 A;  2WTY A;  4GT1 A;  1OXZ A;  3LIE A;  1MV8 A;  3SWF A;  2E42 A;  1AJY A;  3B8E B;  1S9K D;  5APT A;  5AW4 B;  1ZME C;  4LC1 A;  4C7N B;  2XZR A;  2C9L Y;  1FAV A;  5AVR B;  3VMZ A;  1KQL A;  1NAF A;  1CI6 B;  5AVX B;  2YO2 A;  5AVV B;  5AVZ B;  2QM8 A;  1H88 A;  5AVW B;  3HE4 B;  3VYI A;  1HBW A;  2WPQ A;  1PYI A;  3A3Y B;  1X8Y A;  1JUN A;  3P8M C;  5AW7 B;  5APU A;  3LID A;  1FOS F;  1A02 J;  2Z5H A;  1G2C B;  3HE5 A;  3M0A A;  1GD2 E;  3V4W A;  1GK4 A;  4M3L A;  2P7J A;  3M0D A;  3L35 A;  5APX A;  2P67 A;  5AVQ B;  5AW9 B;  5AW0 B;  3TK1 A;  5AVT B;  2WPS A;  1FOS E;  3NFQ A;  2ALC A;  1QP9 A;  4B86 A;  2Q5U A;  2Z5I A;  1MFZ A;  3COQ A;  5AW2 B;  5APY A;  1F4S P;  3M91 A;  1GTW A;  1GU5 A;  3A7O A;  3VMY A;  1J2J B;  4DZO A;  2XV5 A;  1T2K C;  1DH3 A;  2WT7 B;  3VN0 A;  3TNU A;  3VMX A;  1H8A A;  3M06 A;  5APW A;  4JYC A;  2YNY A;  5APQ A;  3P32 A;  5AVY B;  2HAP C;  3MD0 A;  4C7N A;  3M9B A;  2XU6 A;  2R5D A;  3O8Z A;  1JNM A;  2IPP A;  1PYC A;  2Q7C A;  5AW1 B;  1AW6 A;  1CI6 A;  2R5B A;  4AYC A;  2WWW A;  2WPR A;  3HE4 A;  3MGN A;  1SP4 A;  5AW6 B;  4RES B;  2ZFC A;  3OAK A;  3M9H A;  4AQR D;  3I5C A;  2ER8 A;  1HUC A;  1SLQ A;  1CZQ A;  2QM7 A;  2ERG A;  2ERE A;  2C9N Y;  1F5E P;  2BAS A;  3NMD A;  3NTN A;  1NWQ A;  4C46 A;  1GK6 A;  2R32 A;  3VTP C;  2N9B A;  3KQG A;  1HWT C;  3V5B A;  1H89 A;  4I2L C;  2Q3I A;  1T2K D;  4HYT B;  1YYC A;  2ZXE B;  4JYB A;  2W6A A;  3P7K A;  2E43 A;  2R3C A;  3A5T A;  4EOT A;  1IO4 A;  2VRS A;  1GZL A;  5AVU B;  2H7H A;  2WT7 A;  2YO3 A;  2W27 A;  3NXS A;  3V4Q A;  4KHX A;  5AVS B;  1OWA A;  5AW3 B;  4GKG A;  4I6M C;  3HE5 B;  3ALC A;  5AW8 B;  1MUU A;  3T97 A;  3HTK A;  1S9K E;  3KDP B;  5APS A; 
#chains in the Genus database with same CATH topology
 4BXL A;  1EZV E;  2PFX A;  1SVF A;  3WUT A;  2KP8 A;  1FE6 A;  2WSF J;  2WSE H;  2KNC A;  2G8Y A;  3RL0 C;  1OVU A;  4TLF A;  4WBA A;  3S9O A;  2LXB A;  1KQF B;  1H0T B;  1NTZ D;  1L0L E;  5APU A;  4WWI A;  3HE5 A;  1JY2 O;  1FZF A;  3GG2 A;  3L35 A;  1LTG C;  3FWL A;  1L0L J;  4W7Y A;  1GTW A;  5B66 H;  3WMM 0;  4ZKU A;  1P84 E;  3MD0 A;  1X79 B;  3CCL P;  5DJT B;  1S4X A;  1RE3 A;  1FJP A;  1OFC X;  5TIS E;  1GW3 A;  1QGK B;  3PRJ A;  1HUC A;  3TGU G;  1VQ5 P;  3AE4 C;  2ERE A;  2C9N Y;  4XA4 A;  2W83 C;  3L75 D;  1SS1 A;  1FDM A;  1T2K D;  1KIL A;  4EOT A;  4KT0 J;  1NGM B;  2E74 B;  2H7H A;  2O1K A;  4OGQ D;  3L73 E;  3HE5 B;  1NVO A;  3RK3 B;  1Q82 Q;  3T97 A;  1U7M A;  4GDO A;  2W8Z A;  1SFC A;  1IFP A;  1J1E B;  4XE5 B;  3L73 J;  4JQ0 D;  1IJD B;  1Y9B A;  1D66 A;  3RK3 E;  2H8P D;  2IZ1 A;  1SQP D;  3C8V A;  3L71 D;  2XZR A;  2C9L Y;  1SQP G;  3L71 G;  5EFW B;  3O6Q A;  3FGA D;  4IL6 X;  2IDB A;  1Z56 A;  1PP9 G;  3CLQ A;  2FYU G;  2ALC A;  3NFQ A;  1T3U A;  2N1T C;  1KIL B;  2YKP A;  1MKM A;  1LJ2 A;  1LWU C;  5APQ A;  5CCG C;  3CXH H;  2GA1 A;  3T97 B;  1KIL E;  2Y0E A;  1SFC B;  1SQQ G;  4PD4 E;  3EQ2 A;  2M5A A;  2AEJ A;  2CPB A;  3B5N D;  5KLI B;  1JB0 J;  1G2C A;  2W6J H;  2OYH C;  2KLU A;  1UIX A;  3H1J D;  3L72 G;  5L8R J;  3A0H E;  3FWN A;  5B5E H;  1IFN A;  3M9Q A;  2FBW C;  3O6Q B;  4RJT A;  4PJ0 H;  3SSU A;  4JBZ A;  1IFI A;  1URQ A;  2HG5 D;  3G4S P;  2W90 A;  2Y9Z A;  1VQ9 P;  5CMZ A;  5KLV G;  3E1I A;  2WSE J;  3RGU A;  1OMI A;  1EZV D;  1ZR2 A;  1KOR A;  1YQ3 C;  1R5S A;  1H88 A;  3Q1M A;  3WUV A;  2V4H A;  4U7J A;  3L74 E;  4Y28 J;  1GW4 A;  1J1D B;  1PYI A;  1JUN A;  2M5A B;  5AW7 B;  3LID A;  2Q3E A;  1NAY A;  5B66 E;  1G2C B;  1NTK K;  4M3L A;  2A45 G;  4I7Z C;  2QJK B;  1LT9 A;  3L74 J;  1MFZ A;  3CWB E;  1L0L D;  1RF0 C;  3A7O A;  3SFE C;  1K05 A;  1BGY E;  4EYY Q;  1L0L G;  3CCJ P;  2BEZ F;  1U7J A;  4C7N A;  3CWB J;  1URQ B;  3P8C E;  1BGY J;  2K88 A;  1L0N K;  3MGN A;  1X9V A;  1P84 D;  2OYI A;  1ZV8 A;  3I5C A;  3CCM P;  2FYN B;  2H43 A;  1NYH A;  2R32 A;  3VTP C;  2N9B A;  1NU1 K;  1G1J A;  2R44 A;  1S5L H;  2VRS A;  2E75 C;  3WU2 H;  5C39 A;  1OWA A;  4LLH A;  3TF5 A;  1PGQ A;  3D71 A;  5AW8 B;  1JM0 A;  3H1K G;  4OVN F;  4W80 A;  1JO5 A;  3TYY A;  3QH9 A;  1N7S A;  3L73 D;  2OTL P;  4WY4 A;  2AEM A;  1NH4 A;  2WTY A;  2RKL A;  5APT A;  2E74 D;  4C7N B;  2BCC E;  2PGD A;  1IK7 A;  1QEX A;  2ZVN B;  2DW3 A;  1IC2 A;  1L4A A;  1VDF A;  1N7L A;  3RK3 D;  2ZYD A;  4PV1 C;  2OYI B;  3HUS A;  2KIK A;  1R5L A;  2BCC J;  3GHG C;  3QWO C;  1KYO H;  3IF4 A;  5CCH A;  1JMM A;  2RN0 A;  2FKW B;  1OIP A;  1BSH A;  1EDI A;  3CXH E;  3SFD C;  1WRG A;  2N9Y B;  3N4X A;  5APW A;  1KQS O;  2ZT9 B;  2WZ7 A;  2OTK E;  2A45 H;  1JNM A;  2IPP A;  2POH A;  1CI6 A;  2R5B A;  1SP4 A;  4ASV A;  2KK7 A;  2L91 A;  3S1K A;  1LNQ A;  1SLQ A;  4WY4 B;  1ZRT D;  1GK6 A;  5B5E E;  1KIL D;  3GW6 A;  1W5C E;  3TGU E;  2CK3 H;  4PJ0 E;  2Q3I A;  4HYT B;  2ZXE B;  4PD4 D;  1YBK A;  1GZL A;  1L4A B;  4NPF X;  1NHL A;  3NXS A;  3HUS B;  1USE A;  3TGU J;  4U3F G;  4BRY A;  1RF1 C;  3L70 G;  1SFC D;  4I6M C;  2KLV A;  1XTC C;  5AW5 B;  1QLE D;  4BWN A;  1NOH A;  1K8A Q;  2O01 N;  1GU4 A;  1RE4 A;  1IFM A;  4GT1 A;  2E42 A;  4HH2 A;  2MJZ A;  3M0D C;  1CI6 B;  2QE7 H;  2YIU C;  5AVX B;  1FZC C;  3JC2 2;  4MN4 C;  4R4M A;  1X8Y A;  2Y9Y A;  5KAF E;  5AVQ B;  5AW9 B;  2A45 I;  2PP6 A;  3L74 D;  5AW2 B;  1PP9 E;  3M91 A;  1Q90 D;  3AE3 C;  3V2R A;  1WT6 A;  1T2K C;  1SQP K;  2JWD A;  1H8A A;  1FZG A;  2YNY A;  4BRY B;  1BE3 G;  1S1C X;  2R5D A;  3CWB D;  1BSN A;  1PP9 J;  3VP9 A;  2FYU J;  1BGY D;  3RK2 B;  1BGY G;  1LTJ C;  3EWK A;  3CCR P;  2FYU K;  1CZQ A;  1S5L E;  2QA4 P;  3WU2 E;  3IN6 A;  3P8C D;  1SQQ E;  2OTJ P;  4A7P A;  3CMA P;  1JTH A;  2E76 D;  3AEA C;  1IO4 A;  1SQQ J;  1URQ D;  3L72 E;  1H0T A;  3RL0 B;  1SQQ K;  3KPE A;  3R4Y A;  1PZQ A;  3HTK A;  3KDP B;  2FXP A;  5APV A;  3L37 A;  3L72 J;  2OQQ A;  1K9M Q;  2J5U A;  2FXM A;  3LIE A;  2KUB A;  4DOJ A;  3BRT B;  3MZW B;  1KYO E;  1D7M A;  1JOC A;  2BCC D;  5KLV J;  1SQB G;  1NTM G;  2LXC B;  2A06 E;  2P7J A;  2BCC G;  1JTH B;  2Z5I A;  5GTH H;  5KLV K;  3COQ A;  1KQG B;  5APY A;  1JMB A;  2KZJ A;  2JP3 A;  3AE7 C;  1BCC G;  1VQP P;  5M1B A;  1OW8 A;  2N1T A;  3CXH D;  3KXD A;  3HTK B;  1DD3 A;  2QJP C;  5CJ0 A;  3CD6 P;  1KZU B;  1LWU A;  5K5G B;  5CCG A;  4GOF A;  4IOI H;  3MUD C;  3KQG A;  1SQX G;  1WMK A;  2JDI H;  1L0L K;  1USD A;  1YIJ P;  2ZT9 D;  3A5T A;  5AVU B;  1IK9 A;  1JY3 P;  2YO3 A;  2R3S A;  3TGU D;  4PD4 I;  2QVA A;  4GKG A;  3IAO A;  2BEQ D;  4L74 A;  1N7S D;  1T8Z A;  4WY4 D;  1BDD A;  1ZW0 A;  1PGP A;  3H1K E;  3UIA A;  2YMY A;  3MP7 B;  3Q3D A;  4D6T E;  5AW4 B;  1L4A D;  4O9B A;  3H1L G;  4R4L A;  4H13 C;  3H1K J;  2N1T B;  2IBZ G;  3VMZ A;  2SPZ A;  2O1J A;  1PIX A;  2KZI A;  1LWU B;  1IFJ A;  1M7L A;  5CCH D;  3AE6 C;  2C0X A;  2Z5H A;  1MFT A;  2J59 M;  3H1H G;  2WMM A;  1HH0 A;  1KC8 Q;  1LTB C;  2AEF A;  4OWF A;  2OYH B;  3HD7 C;  1Q7Y Q;  5CBO A;  1PP9 D;  4TT3 H;  2FYU D;  1FDI A;  3OA7 A;  3WUU A;  1RQV A;  4IFD K;  4GOD A;  1KFN A;  3VP8 A;  1VF5 C;  3AEE C;  3CL3 D;  2B87 A;  2AXC A;  3AE5 C;  4NPD A;  1JEK A;  4JYB A;  2M0B A;  2B9B A;  3EFF K;  4H0L C;  1SQQ D;  3V6I A;  3OW2 O;  1M1J C;  3RK2 D;  4U3F E;  3L70 E;  2OYO A;  4I1L A;  3L72 D;  3S4R A;  1RH5 B;  1JY3 O;  4IFM A;  1EXJ A;  5BU8 B;  1DX7 A;  2MKV A;  3A2A A;  4U3F J;  3L70 J;  4I7Z B;  3B8E B;  3MIW A;  2KOG A;  1RQU A;  4L76 A;  2O3J A;  5AVR B;  3PH0 A;  3RL0 D;  5GTH E;  5KLV D;  1GK4 A;  2IFM A;  2NRG A;  2B87 B;  1KYO D;  1LT1 A;  2HYN A;  2IFN A;  1VQ8 P;  3GHG A;  3N7N A;  2A06 D;  2V7Q H;  3FXE A;  2A06 G;  2WIT A;  3O8Z A;  1PYC A;  1GL2 C;  1BE3 E;  2M3B A;  2E75 B;  2IYP A;  3Q5S A;  3CC2 P;  3U1C A;  2P1J A;  3HE4 A;  5AW6 B;  1VQ7 P;  2ZFC A;  1M90 Q;  3TDK A;  3CXH I;  5KAF H;  1BE3 J;  3U1A A;  5H2F H;  3V5B A;  2WSS H;  4I2L C;  3F89 A;  4HJG H;  1R8E A;  2M8R A;  2YKO A;  4HB1 A;  4Y99 C;  3RBZ A;  1EDJ A;  3V4Q A;  3Q2Y A;  2OGU A;  5AW3 B;  1LTI C;  1PGJ A;  2GUS A;  1M1K Q;  4AUW A;  2Y0C A;  4PV1 B;  1CSB A;  1LTT C;  1RF1 A;  4YXW H;  3GHG B;  4KJM A;  1MV8 A;  3SWF A;  2W6B A;  4WB4 A;  4ZNC A;  3GF7 A;  2FFD C;  3H1K D;  3AED C;  2IBZ I;  3HE4 B;  1OX3 A;  3OJA B;  1A02 J;  1JCC A;  4D6T G;  3ITK A;  2Q1K A;  1FS0 E;  3M0D A;  1OVV A;  1SQB E;  1NTM E;  2WPS A;  4ZMD A;  1FZC A;  1F4S P;  3CCV P;  1N73 C;  3BCC E;  1PPJ E;  3FX0 A;  2E76 C;  4DZO A;  3H25 A;  1QVG O;  3BRV B;  1SQB J;  1NTM J;  1GDT A;  1FC2 C;  1BCC E;  2NPS C;  2XU6 A;  4H44 C;  5CCG D;  1NTM K;  5KJ7 C;  5KKZ C;  1Y8A A;  4RES B;  3OAK A;  2D2C C;  1OW6 A;  2Q6Q A;  1RF1 B;  2ER8 A;  1BCC J;  2H89 C;  2IYO A;  4Z1M H;  2QJY C;  2QM7 A;  4DT0 A;  5KTB A;  3AE9 C;  1PL5 A;  1H89 A;  3AEB C;  1X22 A;  1LTJ A;  2R3C A;  1SQX E;  2P10 A;  1LT9 C;  3CI9 A;  1SQX J;  2YIU B;  2H88 C;  1FZC B;  2UWJ E;  1S5L X;  1SQX K;  1A02 F;  1NO4 A;  4U3F D;  1AQT A;  1S2E A;  3L70 D;  2ITA A;  3VOP A;  2GUV A;  3H1L E;  4JPZ B;  3CCU P;  3BAS A;  5DJU B;  1M8O B;  2PAJ A;  3VYI A;  2IBZ E;  3P8M C;  1W2B O;  2OAR A;  1PV3 A;  3AEG C;  2XND H;  3CX5 H;  3C1L A;  3L75 E;  2P67 A;  3H1L J;  5AVT B;  3CCE P;  3BVH A;  2Q5U A;  1YI2 P;  1LTJ B;  1ZN5 A;  1GU5 A;  1E79 H;  3H1H E;  1KYO I;  3L75 J;  3ABV C;  2V7Q J;  3I55 P;  1AW6 A;  1VL2 A;  3H1H J;  5E79 H;  5H2F E;  1N7S C;  3D6Z A;  1KFM A;  2XNX A;  3TSI A;  1AQ5 A;  1BE3 D;  1HJ0 A;  4ASW A;  2Y0D A;  1NTK G;  3HRN A;  4OGQ C;  1ZXG A;  3MUD A;  1AFO A;  2E75 D;  3ALC A;  1SQV E;  1U57 A;  1MUU A;  1S9K E;  4IFF A;  3G6E P;  2JR8 A;  5CHX A;  1SQV J;  3CCQ P;  1KD1 Q;  5GTI H;  3G3Z A;  3GLM A;  3CX5 I;  3H1I E;  1JY3 N;  3KYQ A;  5BU5 A;  2ZVO B;  1NAF A;  4QMA A;  1IFD A;  1FBM A;  2WPQ A;  1QX8 A;  3H1I J;  4PV1 D;  3V4W A;  1AA0 A;  3PJS K;  2QJP B;  1J2J B;  1JCD A;  4HKZ H;  4JYC A;  1SQB D;  1NTM D;  2HAP C;  1FJK A;  1UII A;  2FXO A;  2AXT H;  4AYC A;  2WWW A;  4N78 E;  3BCC G;  1PPJ G;  3B5N C;  2KI7 B;  4C7R A;  1BCC D;  3HD7 A;  1AVO A;  1YTZ T;  3II6 A;  2LKM A;  4NPE A;  2W6A A;  3V2Q A;  3P7K A;  1MZ9 A;  2FY8 A;  1YHQ P;  2W27 A;  2WVR A;  3CPW O;  1NKN A;  5KAI H;  4H13 B;  3K5B A;  3A0B H;  1SQX D;  1Q2N A;  1OZH A;  5APS A;  1ZOY C;  1LP1 A;  3Q5P A;  2G3A A;  1CW5 A;  4WVZ A;  1NTZ G;  1M1J A;  1BDC A;  4IL6 H;  4GOE A;  1AJY A;  3E7K A;  1EXI A;  2OYH A;  1KB9 H;  4YPC A;  1KQL A;  3CX5 E;  5AVZ B;  5AVW B;  1VQO P;  1KV4 A;  3V2N A;  1VPC A;  1FDO A;  3GMA A;  3HD7 B;  2KXP B;  1VQL P;  3V2P A;  3M0A A;  1GD2 E;  1TU3 F;  3H1L D;  5AW0 B;  3TK1 A;  4DJG A;  2IBZ D;  2WQY C;  4EIJ A;  2I1J A;  1VF5 B;  2KNC B;  5E79 E;  1RHZ B;  4D6T J;  3L75 G;  1RY3 A;  3H1H D;  1FZA A;  4H0L B;  1YJ9 P;  1LP1 B;  2XDJ A;  4N6J A;  1M1J B;  2NZ2 A;  2ERG A;  3NTN A;  2Z4E A;  1Q86 Q;  1GL2 A;  4L75 A;  1E5W A;  4L73 A;  2O01 H;  1RF0 A;  2HFE D;  4KHX A;  1VQ4 P;  2KS1 A;  3E1R A;  2B88 A;  3AE2 C;  5GTI E;  1KB9 I;  3LW5 H;  3PLN A;  2CPS A;  2E74 C;  1W2E A;  1SQV D;  4N3Y B;  3EFG A;  1N2D C;  1OXZ A;  3AE1 C;  1S9K D;  1SQV G;  3R2P A;  1EDK A;  2ZXX A;  3IFM A;  2JWA A;  3RK3 C;  1DD4 A;  2XKM A;  3W67 A;  1J1E C;  4GIF A;  1HBW A;  2K9Y A;  2ZJS E;  1ZRT E;  3L4F A;  2J58 A;  3H1I D;  2FFD A;  1GL2 B;  3H1I G;  3D6Y A;  2HOD A;  2WPV B;  1FOS E;  4B86 A;  2QIW A;  1RE3 C;  1QL1 A;  1HF9 A;  2AXT E;  2K37 A;  5CJ4 A;  2QG4 A;  2KS1 B;  3AE8 C;  2YMK A;  3H32 A;  3GF3 A;  2KSE A;  1N73 A;  2Q7C A;  2YKQ A;  3H1J G;  1YIT P;  4Y99 B;  5CBN A;  1N8R Q;  1KIL C;  2NPS A;  3NMD A;  1NWQ A;  4C46 A;  1OW7 A;  3G71 P;  3CC4 P;  4UB6 H;  1DEB A;  4DCK A;  4N78 D;  5KJ7 A;  2WSC H;  5KAI E;  3USS A;  2FYZ A;  3ZDM A;  1NTK E;  3A0B E;  1SFC C;  2WT7 A;  4UB8 H;  4RO0 A;  3RBX A;  1HVV A;  2FFD B;  5KLI C;  4IL6 E;  1EZV G;  1NTK J;  2HOD B;  1S3J A;  3F5H A;  1HJB A;  2RH0 A;  3IR9 A;  1KB9 E;  2JJL A;  2P2U A;  1L0N E;  2M3E A;  3D70 A;  3H6P A;  3H32 B;  1HGZ A;  1G1I A;  1N73 B;  2E76 B;  2HPC A;  1FZB A;  1NU1 E;  3PTZ A;  4H13 D;  1L0N J;  3JCU H;  3A3Y B;  1T6A A;  3BAT A;  1QVF O;  1FOS F;  1QL2 A;  2NPS B;  4H44 B;  1LGH B;  3CX5 D;  1YJW P;  1NU1 J;  5KKZ B;  1QP9 A;  3MTU E;  2D2C B;  2K3R A;  4CPG A;  2YXQ B;  2QJY B;  2WT7 B;  3KZI H;  3VMX A;  2ZYA A;  3AEF C;  3U59 A;  1J1D C;  4YXD C;  4D6T D;  3JSV C;  4OH8 B;  4EDF A;  1LTS C;  1ZLL A;  5AW1 B;  3HD7 D;  2QJK C;  3MHV A;  3KHU A;  1L2P A;  2C0W A;  1LT9 B;  1HWT C;  2N1T D;  1YTZ I;  1VF5 D;  1YYC A;  3SWK A;  1URQ C;  2E43 A;  2HPC B;  3BCC J;  4K3A A;  1EC5 A;  2ZYG A;  2O01 J;  3L73 G;  1SQB K;  1NKZ B;  2FYN C;  2QSI A;  4H0L D;  3C9I A;  2I8D A;  1AV1 A;  1LTA C;  3LW5 J;  3L36 A;  4EI2 A;  1YJN P;  1KMI Z;  3FXD A;  2WSF H;  1NTZ E;  2PRR A;  4W7Z A;  1ZME C;  4LC1 A;  2P58 A;  1FAV A;  3VMA A;  1JY2 N;  5AVV B;  2IZ0 A;  1FZE A;  1EDL A;  1NTZ J;  3W68 A;  1OVR A;  2E5Y A;  5TJH A;  3AEC C;  1S72 P;  1NTZ K;  1Q81 Q;  2JEE A;  1N7S B;  1AVY A;  2JKV A;  2XV5 A;  3CCS P;  3VN0 A;  3TNU A;  2OYI C;  3M9B A;  1ZR4 A;  1XTG B;  4OGQ B;  1K73 Q;  1PGO A;  1K04 A;  1P84 H;  2HLO A;  4UB6 E;  1GL2 D;  4LGD E;  1F5E P;  2BAS A;  4XFJ A;  2K9J A;  1GMJ A;  2K1A A;  1T3J A;  4UB8 E;  2E5T A;  2ZT9 C;  5TIS H;  3B5N A;  1IZN B;  2WSC J;  2L5G B;  4ZKP A;  1DIP A;  4WY4 C;  1KTM A;  5BVZ A;  2KYV A;  1SQP E;  1VQM P;  1NTK D;  3L71 E;  1EZV I;  3Q5R A;  1FU1 A;  3I56 P;  1HTL C;  1L4A C;  3TNU B;  1ZP0 C;  2HR3 A;  1SQP J;  3HUS C;  3PHL A;  1VQ6 P;  3L71 J;  3JCU E;  1JY2 P;  1EQ7 A;  2FYU E;  3L74 G;  1KB9 D;  2QRX A;  2YO2 A;  2QM8 A;  1VQK P;  5CCH C;  1L0N D;  1YQ4 C;  2QEX P;  3SWY A;  1M57 D;  2KSJ A;  3B4S A;  1L0N G;  4RKU J;  2K9J B;  3CWB G;  3KZI E;  2RMZ A;  5APX A;  2I1K A;  1PFI A;  1NU1 D;  3B5N B;  3RL0 g;  2KB7 P;  1NU1 G;  1SQV K;  3VMY A;  4YTP C;  1DH3 A;  1P84 I;  3M06 A;  1N86 A;  3CC7 P;  3CME P;  5AVY B;  3P32 A;  4K35 A;  1HGV A;  1NJI Q;  3PP5 A;  3B71 A;  3G9R A;  1DEE G;  2JO1 A;  2NPS D;  2WPR A;  1VQN P;  4H44 D;  1KN7 A;  3M9H A;  2B89 A;  4AQR D;  4JF7 A;  3H1J E;  5KJ7 D;  1M56 D;  1X0T A;  2D2C D;  4PD4 H;  3H1J J;  3BCC D;  1PPJ D;  1Y47 A;  2LR2 A;  3RK2 C;  2ZAE B;  5KLV E;  5AVS B;  2YXR B;  2Q9I A;  1RE4 C;  3A0H H;  2IX7 C;  2GM4 A; 
#chains in the Genus database with same CATH homology
 2GUS A;  3LW5 H;  5AW5 B;  4AUW A;  1CSB A;  1LTT C;  1SVF A;  1NOH A;  1RF1 A;  2CPS A;  2KP8 A;  3GHG B;  1W2E A;  4N3Y B;  1GU4 A;  1RE4 A;  1IFM A;  3EFG A;  1N2D C;  1OXZ A;  1MV8 A;  4GT1 A;  2WSE H;  3SWF A;  2W6B A;  2E42 A;  4WB4 A;  1S9K D;  3R2P A;  4HH2 A;  2MJZ A;  3IFM A;  2FFD C;  3RK3 C;  3RL0 C;  2XKM A;  3M0D C;  4WBA A;  1CI6 B;  5AVX B;  3HE4 B;  1J1E C;  4GIF A;  1FZC C;  1HBW A;  3OJA B;  1X8Y A;  5APU A;  1A02 J;  1JCC A;  3L4F A;  2J58 A;  3HE5 A;  2FFD A;  1JY2 O;  1FZF A;  5AVQ B;  1GL2 B;  3M0D A;  3L35 A;  1LTG C;  5AW9 B;  2HOD A;  2WPS A;  1FOS E;  2A45 I;  4B86 A;  2PP6 A;  5AW2 B;  1FZC A;  4W7Y A;  3M91 A;  1F4S P;  1N73 C;  1RE3 C;  1GTW A;  1QL1 A;  3V2R A;  4DZO A;  1WT6 A;  1T2K C;  3WMM 0;  1SQP K;  4ZKU A;  3BRV B;  1H8A A;  5CJ4 A;  1FZG A;  2YNY A;  1GDT A;  3MD0 A;  2NPS C;  1X79 B;  2XU6 A;  2R5D A;  3H32 A;  3VP9 A;  1N73 A;  1RE3 A;  2Q7C A;  2YKQ A;  5CCG D;  1NTM K;  4Y99 B;  5KJ7 C;  1FJP A;  4RES B;  3OAK A;  3RK2 B;  1LTJ C;  1GW3 A;  1KIL C;  1RF1 B;  2ER8 A;  1HUC A;  2FYU K;  1CZQ A;  2QM7 A;  2ERE A;  2NPS A;  2C9N Y;  3NMD A;  4XA4 A;  1NWQ A;  4C46 A;  3P8C D;  5KTB A;  1DEB A;  1JTH A;  1H89 A;  4N78 D;  5KJ7 A;  1FDM A;  1T2K D;  2WSC H;  1LTJ A;  1KIL A;  2FYZ A;  2R3C A;  4EOT A;  1IO4 A;  1SFC C;  2H7H A;  2O1K A;  2WT7 A;  1URQ D;  1HVV A;  2FFD B;  3HE5 B;  3RK3 B;  1LT9 C;  3CI9 A;  3RL0 B;  1SQQ K;  3T97 A;  3KPE A;  3HTK A;  3KDP B;  2HOD B;  1SFC A;  5APV A;  1J1E B;  1HJB A;  3L37 A;  1FZC B;  3IR9 A;  4XE5 B;  2JJL A;  1SQX K;  2P2U A;  1A02 F;  1NO4 A;  1IJD B;  1D66 A;  2H8P D;  2FXM A;  3LIE A;  3VOP A;  2GUV A;  2XZR A;  3H6P A;  3H32 B;  2C9L Y;  4DOJ A;  3BRT B;  1HGZ A;  1G1I A;  1N73 B;  2HPC A;  1FZB A;  3BAS A;  2PAJ A;  3VYI A;  1JOC A;  3A3Y B;  3P8M C;  3BAT A;  1FOS F;  1QL2 A;  2NPS B;  2OAR A;  1LGH B;  1Z56 A;  2P7J A;  2P67 A;  1JTH B;  3CLQ A;  5AVT B;  3BVH A;  3NFQ A;  2ALC A;  1QP9 A;  3MTU E;  2Q5U A;  1T3U A;  2Z5I A;  5KLV K;  3COQ A;  5APY A;  1LTJ B;  2N1T C;  1ZN5 A;  1KIL B;  1GU5 A;  2YKP A;  2WT7 B;  3VMX A;  3U59 A;  1J1D C;  1LWU C;  5APQ A;  5CCG C;  4OH8 B;  2N1T A;  1LTS C;  1ZLL A;  1AW6 A;  5AW1 B;  3HTK B;  3HD7 D;  1SFC B;  1N7S C;  5CJ0 A;  1KZU B;  1LWU A;  3EQ2 A;  5CCG A;  2CPB A;  3B5N D;  1KFM A;  1G2C A;  2XNX A;  2C0W A;  3TSI A;  1LT9 B;  1AQ5 A;  3KQG A;  2OYH C;  1HWT C;  2N1T D;  1YTZ I;  1L0L K;  3HRN A;  1YYC A;  1URQ C;  2E43 A;  3A5T A;  2HPC B;  5AVU B;  1IK9 A;  1IFN A;  1JY3 P;  3M9Q A;  3MUD A;  1SQB K;  1NKZ B;  2YO3 A;  1AFO A;  4GKG A;  1IFI A;  3C9I A;  3ALC A;  1URQ A;  1MUU A;  2HG5 D;  1N7S D;  1T8Z A;  1LTA C;  1S9K E;  4IFF A;  4WY4 D;  3L36 A;  5CHX A;  3UIA A;  5CMZ A;  2WSF H;  2YMY A;  3E1I A;  3G3Z A;  5AW4 B;  4W7Z A;  1ZME C;  1L4A D;  4LC1 A;  4O9B A;  1FAV A;  1JY3 N;  3KYQ A;  2N1T B;  5BU5 A;  3VMZ A;  1ZR2 A;  1NAF A;  1JY2 N;  2O1J A;  5AVV B;  1H88 A;  1IFD A;  1FZE A;  1FBM A;  1GW4 A;  1J1D B;  2WPQ A;  1PYI A;  1LWU B;  1JUN A;  1IFJ A;  5AW7 B;  1M7L A;  5CCH D;  3LID A;  2C0X A;  2Z5H A;  1G2C B;  3V4W A;  1NTK K;  4M3L A;  2A45 G;  1NTZ K;  2J59 M;  1LT9 A;  1MFZ A;  2JEE A;  1N7S B;  1HH0 A;  1RF0 C;  1LTB C;  3A7O A;  1J2J B;  2XV5 A;  1JCD A;  3VN0 A;  3TNU A;  2OYI C;  2OYH B;  4JYC A;  2HAP C;  3HD7 C;  4C7N A;  3M9B A;  1ZR4 A;  1FJK A;  1XTG B;  1URQ B;  3P8C E;  1L0N K;  4AYC A;  2WWW A;  2HLO A;  3MGN A;  4N78 E;  3B5N C;  1X9V A;  3OA7 A;  4IFD K;  1GL2 D;  2OYI A;  4C7R A;  1ZV8 A;  3I5C A;  4LGD E;  1KFN A;  3HD7 A;  3VP8 A;  2H43 A;  1F5E P;  2BAS A;  2R32 A;  3VTP C;  1YTZ T;  3II6 A;  1T3J A;  2N9B A;  1NU1 K;  3CL3 D;  2LKM A;  3B5N A;  1G1J A;  4JYB A;  2W6A A;  3V2Q A;  2L5G B;  3P7K A;  1MZ9 A;  2VRS A;  4ZKP A;  2W27 A;  1NKN A;  1M1J C;  1OWA A;  4LLH A;  4WY4 C;  5BVZ A;  3RK2 D;  5AW8 B;  2KYV A;  4I1L A;  5APS A;  4W80 A;  1FU1 A;  1JO5 A;  1JY3 O;  3TYY A;  4IFM A;  1CW5 A;  5BU8 B;  1HTL C;  1N7S A;  1M1J A;  1DX7 A;  1L4A C;  4WY4 A;  3A2A A;  3TNU B;  1NH4 A;  2WTY A;  3HUS C;  1AJY A;  3B8E B;  3MIW A;  5APT A;  2KOG A;  4C7N B;  1JY2 P;  2OYH A;  1EQ7 A;  5AVR B;  1KQL A;  1IC2 A;  2YO2 A;  5AVZ B;  2QM8 A;  5CCH C;  5AVW B;  1L4A A;  1VDF A;  1N7L A;  3RK3 D;  3RL0 D;  2OYI B;  3V2N A;  1VPC A;  3HUS A;  3SWY A;  2KSJ A;  3HD7 B;  3GHG C;  3V2P A;  3M0A A;  1GD2 E;  1GK4 A;  2IFM A;  5APX A;  2I1K A;  5AW0 B;  3TK1 A;  5CCH A;  1PFI A;  1JMM A;  3B5N B;  2FKW B;  2HYN A;  4EIJ A;  2KB7 P;  1SQV K;  2IFN A;  3VMY A;  2I1J A;  1DH3 A;  1WRG A;  3GHG A;  3N7N A;  3N4X A;  3M06 A;  1N86 A;  5APW A;  2WZ7 A;  5AVY B;  3P32 A;  2A45 H;  2WIT A;  3O8Z A;  1JNM A;  1HGV A;  2IPP A;  1PYC A;  3PP5 A;  1GL2 C;  1RY3 A;  2POH A;  1CI6 A;  2R5B A;  2M3B A;  2NPS D;  3U1C A;  2WPR A;  2P1J A;  3HE4 A;  1FZA A;  1SP4 A;  5AW6 B;  2ZFC A;  3M9H A;  2XDJ A;  4N6J A;  4AQR D;  4JF7 A;  1M1J B;  1SLQ A;  5KJ7 D;  4WY4 B;  2ERG A;  3NTN A;  1GK6 A;  2Z4E A;  1KIL D;  1GL2 A;  3U1A A;  3V5B A;  4I2L C;  2Q3I A;  4HYT B;  2ZXE B;  2M8R A;  2YKO A;  1E5W A;  2O01 H;  1GZL A;  1L4A B;  1RF0 A;  4Y99 C;  1NHL A;  3NXS A;  2HFE D;  3HUS B;  3RK2 C;  3V4Q A;  4KHX A;  1RF1 C;  5AVS B;  1SFC D;  5AW3 B;  2Q9I A;  4I6M C;  1LTI C;  1RE4 C;  2IX7 C;  2KLV A;  1XTC C;  2GM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...