1HWTC

Structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
RIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*CP*TP*AP*TP*TP*AP*TP*CP*GP*CP*TP*AP*TP*T
publication title Structure of a HAP1-DNA complex reveals dramatically asymmetric DNA binding by a homodimeric protein.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation/dna
total genus 22
structure length 70
sequence length 70
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 1998-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hwtC02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1hwtC01
2Q5UA 5APQA 1NAFA 1HBWA 5APYA 5AW6B 2R3CA 1QP9A 2WPSA 1PYIA 1NWQA 5AW7B 1DH3A 2XU6A 4AUWA 4GKGA 1F4SP 1MUUA 3NTNA 3M0DA 4JYBA 3V5BA 5CMZA 1A02J 5AVTB 3B8EB 5APSA 3A3YB 3VMYA 2W6AA 3SWFA 1CSBA 3TK1A 1OWAA 3V4WA 1T2KD 3NFQA 5APTA 2P7JA 4C46A 4DZOA 2WPQA 2XZRA 4AYCA 3VMXA 3VMZA 3NMDA 4XE5B 1GD2E 3HE5B 2EREA 3TNUB 5AW0B 3M0AA 2QM7A 3P32A 3TNUA 1A02F 1G2CB 1JNMA 1PYCA 3L35A 5AW8B 2WT7B 4C7NB 2WT7A 4C7NA 3MD0A 1GU4A 4KHXA 2JJLA 2Q3IA 5AVWB 4EOTA 3M9HA 1HJBA 2YNYA 3KDPB 5AVRB 3HTKA 1GU5A 2ER8A 5AW4B 1CZQA 1SP4A 2QM8A 3ALCA 1D66A 3V4QA 1H8AA 1S9KE 4M3LA 1FAVA 5AW5B 4B86A 2P2UA 3OAKA 2HAPC 2R5DA 1H89A 3LIEA 3P7KA 2WTYA 2VRSA 3VN0A 3HE5A 2R32A 2Q7CA 3COQA 5AVVB 5APXA 1CI6B 2ZFCA 1YYCA 2E42A 1CI6A 4I2LC 5AW2B 1GK4A 3I5CA 5APWA 1FOSF 1KQLA 2ALCA 3HE4B 1H88A 5APUA 2BASA 2XV5A 1J2JB 4HYTB 2ZXEB 5AVZB 5APVA 3P8MC 1ZMEC 5AW3B 3M9BA 2H7HA 3VTPC 2IPPA 1SLQA 3L36A 1X8YA 3T97A 3UIAA 1GZLA 1AJYA 1GTWA 1IO4A 1S9KD 3LIDA 2P67A 1MV8A 3TYYA 1OXZA 3VYIA 1F5EP 1FOSE 2ERGA 1HWTC 3A2AA 3A7OA 5AW9B 2C9LY 1AW6A 3O8ZA 3M06A 5AVQB 5AW1B 1T2KC 5AVYB 2KP8A 2C9NY 4AQRD 1MFZA 2YO3A 1HUCA 4GT1A 2WPRA 5AVSB 5AVXB 3L37A 3NXSA 3HE4A 2Z5HA 4I6MC 2WWWA 1JUNA 2Z5IA 1GK6A 2W27A 2YO2A 2N9BA 3M91A 3A5TA 4JYCA 2E43A 2R5BA 3IR9A 4LC1A 4RESB 5AVUB 3MGNA 3KQGA
chains in the Genus database with same CATH superfamily
5APQA 4H0LC 1QLED 5CCGA 3AE4C 4DOJA 3H1KJ 1K9MQ 2WSFJ 1NTKG 1EZVE 1PPJE 3NFQA 1JY3O 3IFMA 4ZMDA 2WPQA 1NTKJ 4IL6H 4OVNF 3PH0A 2I8DA 3TNUB 1A02F 3R2PA 5H2FH 1DEBA 2WT7A 4NPDA 1L0LG 3TGUJ 2E74D 1T3JA 2YNYA 1AQ5A 3KDPB 1N2DC 4PJ0H 3H1KE 4EDFA 1RF1B 1L0LJ 2Q1KA 3CCLP 3KZIH 1KB9H 3H32A 2VRSA 3RGUA 3MUDA 3FGAD 2JP3A 1X9VA 5TISE 4IFDK 1OX3A 3TGUE 3M9BA 1P84I 2V7QJ 1EDKA 2K1AA 4O9BA 3OJAB 5AW9B 2N1TB 2O1JA 5L8RJ 3NXSA 2QJKB 2ZVOB 2M5AB 1HH0A 2OYHB 4EYYQ 2WQYC 1LTJB 1SQXG 2W6BA 2JEEA 4PD4I 3PLNA 2R3CA 3C8VA 2N9YB 1LJ2A 2NZ2A 1SQXJ 1NTZG 3S9OA 2ZJSE 5APSA 3CWBJ 4H0LD 4H13C 1URQB 3L72G 1YTZI 2I1KA 4AYCA 3VMXA 2H89C 1LGHB 1QL2A 3L72J 3P32A 1IC2A 1QVGO 5AW8B 2OTLP 3TSIA 2KI7B 1RH5B 3B4SA 1D66A 2HLOA 2QIWA 3CWBE 3P8CE 2ZYAA 4WY4A 3HE5A 2R32A 3H25A 1SQQG 2E42A 1FZBA 1KB9I 4JQ0D 2D2CC 1ZMEC 1URQD 1ZW0A 1SLQA 3PP5A 5B66H 1KQGB 3MZWB 1AVYA 2LXBA 4PV1C 2ZT9C 2C9NY 1RE4C 3L37A 5K5GB 5CCHA 1EDJA 3AEGC 1FBMA 2NPSA 1JY3P 1IK7A 5APYA 1J1DB 2HYNA 1NAFA 3MHVA 2FYUG 2AXTE 1UIXA 2B87B 3L75E 3V5BA 1S72P 2E75B 2DW3A 1A02J 1NKZB 3AEBC 1VF5C 3CLQA 2W6AA 3V4WA 2HFED 4N78E 1VQOP 3AECC 3MTUE 5TJHA 2OARA 4H13D 3BRTB 5BU8B 1OIPA 4C7NA 3KYQA 1AV1A 1EZVI 1VQLP 3L75D 1GMJA 3AE9C 1H0TB 2WPVB 1H8AA 1NHLA 4N78D 2YMYA 1W5CE 2HAPC 5BVZA 4OGQC 3S1KA 1CI6B 1YYCA 2HG5D 3GW6A 2O01H 1IFPA 2YKPA 3H1LG 4BXLA 1X8YA 1IK9A 4U7JA 2Q6QA 2XDJA 2KIKA 1LT9B 5GTHH 2BCCD 2YKOA 1RQVA 1OMIA 2K3RA 1HJ0A 1FZCB 2ZAEB 2Z5HA 1K05A 1BGYG 2CPBA 1SQPJ 2N9BA 3AEEC 3A0BE 1SFCC 3V2PA 1LTSC 3PHLA 3GHGB 2WPSA 1X0TA 1ZRTE 2C0XA 2GUSA 2Q3EA 1SS1A 1PV3A 4C7RA 3TF5A 1NAYA 1OWAA 2AXTH 3G4SP 1SQPE 1GL2D 1R8EA 1VQ7P 1M1JA 3EQ2A 3TNUA 1PP9G 4U3FG 1VQKP 1NYHA 2YXRB 4WY4C 3V6IA 2QE7H 1KILB 3KXDA 2QSIA 1EXIA 1PGOA 1S9KE 1RF1A 2H88C 4I7ZC 3P7KA 1BDCA 3CCRP 4L74A 4GDOA 1GK4A 2KSEA 2OYOA 3L70J 2IBZG 2BASA 1VQ6P 2ZXEB 3GF3A 2IPPA 1S9KD 1NTME 2KZJA 3L71J 1OXZA 4HB1A 1JMMA 1F5EP 1IJDB 3AE3C 1NVOA 3L4FA 2QEXP 2N1TA 1LT1A 1MFZA 3E1IA 1OW6A 2WPRA 3AE1C 2A06G 1SQPK 3HE4A 1VL2A 1VPCA 3L70E 2YIUB 1N7LA 1NTMD 4K3AA 2YO2A 2R5BA 3IR9A 1LTJA 1Y47A 3L71E 4PD4E 1NU1D 3A0BH 3M0DA 1VQNP 3H1IG 5KLVD 3CPWO 1SFCD 3ZDMA 1OVVA 2WITA 3RK2B 2ZYGA 1FZAA 3H1IJ 3M9QA 4RJTA 4PD4D 2C0WA 3HD7C 1IZNB 1FJPA 3H1HE 4TT3H 3AE8C 1EDLA 3T97B 5AW4B 1SP4A 1YJWP 3RBXA 1RHZB 5KAIE 4I2LC 1XTGB 1VQ4P 2ALCA 3L73J 3H1HD 2KOGA 2H7HA 2HODB 1FC2C 1L4AA 2HPCB 2G3AA 4DJGA 3USSA 5AVYB 2KP8A 1LTAC 3PTZA 1FU1A 5AVXB 1N7SA 1Q86Q 2FXPA 3L73E 1K73Q 1JY2P 2JR8A 2W27A 3CI9A 3L74J 2ZYDA 1KFNA 3BASA 3N4XA 2M3EA 1M1JC 2E76C 3H1JD 1FDIA 1YJNP 2RMZA 1FS0E 4PD4H 3L73D 3VP9A 3BCCJ 3WMM0 3EFGA 2IX7C 4EIJA 5APTA 3W68A 3HUSC 4YXDC 1S1CX 2OYIA 4MN4C 3L74E 1RF1C 4L73A 2FYZA 2JO1A 2O1KA 2WZ7A 3O6QA 3I55P 4EOTA 3RK3B 1H0TA 1E5WA 1G1IA 3V4QA 3A0HE 5CBNA 3BCCE 1L2PA 1BE3G 1LWUB 1H89A 3COQA 1CI6A 5APWA 1KQLA 4LGDE 5APUA 1BE3J 3RK3E 2N1TC 1YBKA 3Q2YA 1N73B 5KAIH 1EZVD 3B5NC 1PPJD 4H44B 2G8YA 5KAFE 2RN0A 1EXJA 2QJKC 4HH2A 3W67A 2KK7A 3AEDC 4NPFX 1T2KC 1D7MA 1NTKE 1LTJC 1UIIA 2YO3A 4GT1A 3GF7A 5KKZB 3RK3D 1FZCA 3BATA 2WSEJ 2GUVA 3H1KD 4H0LB 2KS1A 3M91A 2E43A 3MGNA 2JWAA 1OZHA 5KJ7A 1L0LE 1BSNA 1NTKD 2A45G 3GHGA 1PYIA 1M90Q 2XU6A 4AUWA 4GKGA 1Q7YQ 1MUUA 3VMYA 4H44D 3TGUD 1CSBA 2KXPB 3IF4A 2IFNA 4GOFA 2LR2A 3II6A 1GD2E 1YQ4C 2EREA 3V2RA 3AE6C 1L0LD 1EDIA 3WU2E 1KILA 1AA0A 3RL0C 1KN7A 1NTKK 2QJPB 1JCCA 2R3SA 3OAKA 1NTZJ 4D6TG 3VN0A 2Z4EA 3A0HH 1Q81Q 1L4AC 2KSJA 2QRXA 1J1EB 4HYTB 4D6TJ 1SQXE 1L0LK 3UIAA 1VQMP 1N7SC 2P67A 1L0NG 2AEMA 2WSFH 4L75A 2SPZA 3K5BA 1L0NJ 5AVSB 3L72E 3R4YA 1ZR2A 4I6MC 3VMAA 1S2EA 1SQXD 4N3YB 1SQQJ 2BEZF 5TISH 1WT6A 3CWBD 3P8CD 4W7ZA 1HBWA 3CL3D 5AW6B 3C1LA 1S4XA 4H13B 2OYIC 1E79H 3L72D 3BVHA 4GODA 5CCGC 1JY2N 1S5LE 1BDDA 4NPEA 1SQQE 1NO4A 3CCVP 2Y0DA 3CMAP 1SQXK 2OGUA 2K88A 1JTHA 1KFMA 1SQBG 4ASVA 2HR3A 2V7QH 3HTKB 1HJBA 3WU2H 2FYUJ 4RO0A 3ALCA 1NTZK 2J58A 1FAVA 5DJUB 1W2BO 1SQBJ 2P2UA 3Q3DA 1QEXA 4R4MA 2XNDH 5APXA 3RL0D 2BCCG 5AVZB 3FXDA 3MUDC 1CW5A 1NOHA 5KLIC 1YI2P 3CCQP 1GTWA 2ZT9B 2FYUE 2KYVA 2FYNC 4DCKA 1YQ3C 2H8PD 1IFNA 5KJ7C 3B71A 3PJSK 1SQQK 2WWWA 4ZKPA 1AVOA 2OTJP 1HVVA 1DD3A 3D71A 5AVUB 2W83C 2D2CD 3D6ZA 1GL2B 3H1LJ 1IFJA 2K9JA 1VF5B 5AW7B 2FFDA 2W6JH 2B9BA 3E1RA 4PV1D 3TK1A 2KNCB 2P7JA 2ZT9D 3PRJA 5CHXA 3NMDA 3V2QA 1BGYJ 4N6JA 1S5LH 1PYCA 5CCGD 1IFIA 3H1LE 2FYUK 3TDKA 4YPCA 1BSHA 1R5SA 4OGQB 1KMIZ 1MFTA 2IYPA 1SVFA 1M56D 2Q7CA 1VF5D 1JO5A 1BGYE 2PFXA 3H1LD 1QVFO 1KQFB 1ZRTD 3P8MC 3C9IA 1N73A 4OH8B 1PP9J 4U3FJ 1QGKB 2WSCJ 2A45I 3L36A 1OW7A 1KQSO 3E7KA 3VYIA 1FE6A 1SQPD 1HWTC 4UB8E 2OTKE 1SQVG 1YHQP 1OW8A 1BGYD 1SQVJ 1NU1G 1SFCB 1XTCC 3LW5J 4OGQD 5KLVG 5CCHC 1PP9E 2QVAA 4U3FE 4C46A 1NH4A 2FXMA 2Q5UA 4BWNA 2NPSC 2OQQA 3RK2C 1RE3A 3B8EB 3A3YB 5CJ4A 2B89A 4YXWH 2M5AA 4WY4B 1DEEG 2OYHA 3HE5B 1VQ5P 2WMMA 4KJMA 3M0AA 2IBZE 1KZUB 3L35A 4KHXA 4HJGH 1GU5A 3AEAC 3FWLA 3L70D 3H1HG 1URQA 4WVZA 1IFDA 4W80A 1JCDA 1JY3N 1HGZA 3LIEA 1Z56A 2IBZD 3L71D 2NRGA 1KC8Q 2A06E 2MKVA 1N86A 3Q5PA 1MKMA 1FOSF 5M1BA 2XV5A 2RKLA 2IYOA 1W2EA 3JC22 1ZN5A 3TYYA 4WY4D 1DIPA 2ERGA 4A7PA 1OFCX 1BCCG 3M06A 3H1IE 1RQUA 2QJYC 4Y99C 2FKWB 3OW2O 2FFDC 1BCCJ 1JUNA 4QMAA 3H1JG 1Q90D 2AEJA 2CK3H 1VQ8P 5CBOA 2GM4A 3JSVC 2E74C 2JKVA 1G2CB 1PFIA 2WSSH 3H1ID 4YTPC 1NWQA 1DH3A 1M1KQ 5CCHD 1VQ9P 3CMEP 3CCMP 3SWFA 3SWKA 2E5YA 4XE5B 3HD7B 2LXCB 1Y9BA 3WUVA 1GW4A 1PZQA 1HGVA 2B87A 2Y0CA 3HTKA 1CZQA 2YKQA 2QM8A 1G1JA 1EZVG 3VOPA 1PPJG 1KYOI 3CCEP 2ZVNB 2L91A 3CXHE 3G3ZA 4HKZH 3SFEC 1QL1A 1FJKA 3Q5RA 3ITKA 1N8RQ 3FWNA 1KD1Q 4JF7A 2PP6A 3H1KG 3HD7D 1RE4A 4JBZA 1AW6A 5BU5A 3L74D 1ZOYC 3CXHD 1KORA 1HUCA 2CPSA 1PIXA 3H6PA 2KLUA 3IAOA 1WMKA 3U59A 1RE3C 1T8ZA 1DD4A 3TGUG 1Q82Q 1M1JB 1LTGC 2IFMA 4OWFA 3BCCD 1LT9A 1LTBC 4IL6X 2E76B 1GL2A 2OYHC 4JYBA 2WVRA 3HUSB 2J59M 1BE3E 3M0DC 1ZR4A 2Y9YA 2KNCA 1LP1B 1URQC 3SWYA 1M57D 3GG2A 1JNMA 2QJPC 1EC5A 2V4HA 3MD0A 5B66E 2P10A 3M9HA 5AVRB 1YITP 2PAJA 3KHUA 4BRYB 4Z1MH 1BE3D 1J1EC 3BRVB 4B86A 3Q5SA 2IBZI 1AFOA 2W90A 2E76D 2ZFCA 3B5NB 3HE4B 1JEKA 3MIWA 1M8OB 2M3BA 1TU3F 5AW3B 3CXHH 3VTPC 1FZEA 1K04A 4ZNCA 3GMAA 2O3JA 1PGQA 1FOSE 1KV4A 2KB7P 3CWBG 2B88A 2I1JA 4JPZB 2KZIA 4L76A 3CCSP 1SFCA 3I56P 2O01J 3A5TA 1JB0J 4LC1A 1OVUA 4DT0A 2N1TD 4ASWA 1Q2NA 1K8AQ 2PGDA 1QP9A 2M0BA 3B5ND 5KAFH 1NTZE 4LLHA 1F4SP 2IDBA 1J1DC 2PRRA 1T2KD 1FDMA 4D6TE 4DZOA 2E75C 4WBAA 1NGMB 3RBZA 1USEA 1NTZD 3RL0B 1GU4A 3S4RA 5KTBA 2JJLA 3CX5E 1L0NE 2ER8A 5GTHE 1T6AA 2UWJE 3L75G 4D6TD 1MZ9A 1YJ9P 1L4AB 2YXQB 1YTZT 4XFJA 3SFDC 3L75J 5AVVB 4Y28J 2WSEH 4I1LA 1N7SB 1T3UA 5GTIE 2H43A 1QX8A 1J2JB 3CX5D 3U1AA 1L0ND 1RF0A 2K9YA 3AE5C 3T97A 1GZLA 4KT0J 1AJYA 3F89A 2YMKA 3IN6A 3JCUE 3CXHI 1SQQD 2D2CB 4IFMA 1LT9C 2A45H 1VQPP 1GL2C 3VP8A 4R4LA 2HODA 2O01N 1L4AD 4PV1B 2OYIB 2BCCJ 1FZCC 4RESB 1ZLLA 2MJZA 3G71P 1U7JA 1G2CA 2HPCA 4CPGA 1L0NK 3U1CA 1SQBE 3EFFK 3O6QB 3NTNA 1N7SD 1ZP0C 1JOCA 3FXEA 3GHGC 4UB6E 1GDTA 2AEFA 3QWOC 2FXOA 3D70A 2FYUD 3G6EP 2J5UA 1M7LA 3HD7A 2JDIH 2BCCE 5AW0B 5B5EE 4WWIA 1SQBD 2WT7B 2E75D 4GOEA 1FZFA 2Q3IA 5AVWB 5CJ0A 1LTIC 3AEFC 5EFWB 1KILC 4K35A 1FZGA 5AW5B 3CX5H 3H32B 2R5DA 3EWKA 1EQ7A 1KYOE 5E79E 1SQPG 5KLIB 5AW2B 1H88A 3CD6P 4W7YA 5APVA 2FYNB 2KS1B 1SQBK 1MV8A 5GTIH 4IOIH 1KTMA 2KLVA 1LWUA 1S5LX 1KYOD 3N7NA 1FDOA 4AQRD 1YIJP 2LKMA 3JCUH 1LNQA 4ZKUA 1JY2O 2POHA 3Q1MA 4JYCA 3KQGA 2AXCA 2YIUC 1NTMG 3QH9A 1LTTC 1JM0A 1NTMJ 5AVTB 3HUSA 4TLFA 2XZRA 3L70G 5KJ7D 3VMZA 1LP1A 4UB6H 1NU1J 2IZ0A 3GLMA 1S3JA 5KLVJ 3CC2P 1PL5A 1KILE 3L71G 2FY8A 5B5EH 4BRYA 1SQVE 2L5GB 4M3LA 1P84E 1RF0C 1PP9D 4U3FD 3OA7A 1U7MA 2K37A 1NU1E 3CC4P 3B5NA 3AE2C 1KILD 2Y9ZA 3I5CA 1GW3A 2Q9IA 3CX5I 1JMBA 5KLVE 1OVRA 1KYOH 4I7ZB 2P58A 4IFFA 5E79H 2Y0EA 3ABVC 1SQVD 4RKUJ 2R44A 3LIDA 1P84D 1X79B 2KUBA 3A2AA 3O8ZA 3H1HJ 3WUTA 2XNXA 3RL0g 2QA4P 2NPSB 2Z5IA 1DX7A 1GK6A 2W8ZA 3V2NA 1HTLC 2ITAA 3CC7P 4WB4A 3HRNA 2A06D 2ZXXA 2E5TA 1X22A 1JTHB 1NTMK 1SQVK 2GA1A 2XKMA 4UB8H 4IL6E 5CMZA 3CCUP 1RY3A 2JWDA 3G9RA 1PGJA 1NKNA 3FX0A 5H2FE 1NU1K 3L73G 5KLVK 1R5LA 2BEQD 2QM7A 1WRGA 2IZ1A 3H1JJ 4PJ0E 5DJTB 4C7NB 2WSCH 3KZIE 3D6YA 1KB9E 2NPSD 3RK2D 3MP7B 1U57A 1ZXGA 1BCCE 1NJIQ 3RK3C 1PGPA 3CCJP 2WTYA 3WUUA 5C39A 1P84H 3L74G 3LW5H 1LWUC 3H1JE 1USDA 4GIFA 1KB9D 1Y8AA 3SSUA 1ZV8A 1IO4A 4EI2A 1BCCD 2QJYB 2P1JA 1N73C 4Y99B 3A7OA 2K9JB 2C9LY 4H44C 1AQTA 1VDFA 1HF9A 5AVQB 5AW1B 2FFDB 2FBWC 3F5HA 3AE7C 3BCCG 1IFMA 2E74B 2RH0A 2QG4A 5KKZC 3KPEA 2M8RA 4XA4A
chains in the Genus database with same CATH topology
5APQA 1GL2B 2N1TD 1IFJA 1QP9A 3B5ND 5AW7B 2FFDA 4LLHA 1F4SP 5CCGA 3M0DA 4DOJA 1J1DC 1SFCD 2WITA 3TK1A 1T2KD 3RK2B 3NFQA 1FDMA 2P7JA 4DZOA 1FZAA 1JY3O 3IFMA 2WPQA 3M9QA 5CHXA 3NMDA 4WBAA 3V2QA 3TNUB 4N6JA 1A02F 1PYCA 3R2PA 5CCGD 1DEBA 2WT7A 3RL0B 1GU4A 1IFIA 2C0WA 3HD7C 5KTBA 2JJLA 1FJPA 2FYUK 1T3JA 2YNYA 1AQ5A 3KDPB 1N2DC 5AW4B 2ER8A 1SP4A 1MZ9A 1RF1B 1L4AB 3H32A 1YTZT 1SVFA 2VRSA 2Q7CA 3MUDA 5AVVB 1JO5A 4I2LC 1XTGB 2ALCA 1X9VA 2WSEH 4I1LA 1N7SB 1T3UA 2H43A 1J2JB 4IFDK 2KOGA 3U1AA 3P8MC 3C9IA 4OH8B 1N73A 1RF0A 3M9BA 2HODB 2H7HA 2A45I 3L36A 3T97A 1GZLA 1AJYA 3VYIA 1L4AA 2HPCB 4O9BA 1HWTC 3OJAB 5AW9B 2N1TB 4IFMA 5AVYB 2KP8A 1LTAC 1LT9C 2A45H 2O1JA 1FU1A 1GL2C 5AVXB 3VP8A 3NXSA 1N7SA 1SFCB 1XTCC 1HH0A 1JY2P 2HODA 2W27A 1L4AD 3CI9A 2OYHB 5CCHC 2OYIB 1FZCC 1KFNA 1LTJB 1ZLLA 4RESB 2W6BA 1NH4A 4C46A 2MJZA 2JEEA 2FXMA 2Q5UA 3BASA 1G2CA 2HPCA 2NPSC 3RK2C 3N4XA 2R3CA 1L0NK 3U1CA 1M1JC 3NTNA 1N7SD 1RE3A 1JOCA 3GHGC 3B8EB 5APSA 3A3YB 1GDTA 1URQB 3VP9A 1YTZI 3WMM0 5CJ4A 3EFGA 2IX7C 4EIJA 5APTA 2I1KA 4AYCA 3HUSC 4WY4B 3VMXA 2OYHA 2OYIA 3HE5B 1M7LA 3HD7A 5AW0B 3M0AA 1LGHB 1QL2A 3P32A 1KZUB 1RF1C 1IC2A 3L35A 5AW8B 2WT7B 3TSIA 2FYZA 2O1KA 4KHXA 2WZ7A 1FZFA 2Q3IA 5AVWB 4EOTA 3RK3B 5CJ0A 1GU5A 1E5WA 1LTIC 1D66A 1G1IA 2HLOA 3V4QA 1URQA 1KILC 1IFDA 1FZGA 4W80A 5AW5B 3H32B 3P8CE 1JCDA 1JY3N 1HGZA 1LWUB 2R5DA 1H89A 4WY4A 3LIEA 1Z56A 3HE5A 2R32A 1EQ7A 3COQA 1N86A 2E42A 1CI6A 5AW2B 5APWA 1FOSF 1KQLA 4LGDE 1H88A 5APUA 1FZBA 2XV5A 2N1TC 4W7YA 5APVA 1ZMEC 1N73B 1W2EA 1URQD 3B5NC 1SLQA 1ZN5A 3PP5A 1SQBK 1MV8A 3TYYA 4WY4D 2ERGA 4HH2A 2KLVA 1LWUA 3M06A 3N7NA 1T2KC 1LTJC 2C9NY 4AQRD 1RE4C 2YO3A 2LKMA 4GT1A 4Y99C 2FKWB 3L37A 3RK3D 5CCHA 1FZCA 2FFDC 4ZKUA 1FBMA 1JY2O 2POHA 3BATA 1JUNA 2GUVA 2NPSA 2GM4A 3M91A 1JY3P 4JYCA 2E43A 3MGNA 1G2CB 3KQGA 5APYA 1J1DB 2HYNA 1NAFA 5KJ7A 1PFIA 1PYIA 2A45G 3GHGA 1NWQA 1LTTC 2XU6A 1DH3A 4AUWA 4GKGA 5CCHD 1MUUA 3V5BA 1A02J 5AVTB 1NKZB 3HUSA 3CLQA 3VMYA 2W6AA 3SWFA 1CSBA 3V4WA 2HFED 2IFNA 4N78E 2XZRA 3MTUE 5KJ7D 3VMZA 3II6A 4XE5B 1GD2E 3HD7B 2EREA 3V2RA 2OARA 1GW4A 3BRTB 5BU8B 4C7NA 3KYQA 1HGVA 1KILA 3HTKA 1CZQA 2YKQA 2QM8A 1G1JA 3RL0C 1NTKK 1H8AA 1NHLA 2L5GB 4M3LA 4N78D 3VOPA 2YMYA 1RF0C 1JCCA 3OAKA 2HAPC 3VN0A 3OA7A 2Z4EA 5BVZA 3G3ZA 1CI6B 1L4AC 2KSJA 1YYCA 3B5NA 1KILD 3I5CA 1GW3A 2Q9IA 2HG5D 2O01H 1QL1A 1J1EB 1FJKA 4HYTB 4IFFA 2YKPA 1L0LK 3UIAA 1X8YA 1IK9A 2XDJA 1N7SC 2P67A 3LIDA 1X79B 1LT9B 2PP6A 4JF7A 3HD7D 1RE4A 3A2AA 1AW6A 3O8ZA 5BU5A 2WSFH 2XNXA 2YKOA 1HUCA 5AVSB 2CPSA 1FZCB 3H6PA 1ZR2A 2Z5HA 4I6MC 3U59A 2CPBA 1RE3C 2NPSB 2Z5IA 1DX7A 4N3YB 1GK6A 1T8ZA 3V2NA 1HTLC 2N9BA 1WT6A 1M1JB 1LTGC 2IFMA 1LT9A 1LTBC 3P8CD 1SFCC 4W7ZA 3V2PA 4WB4A 1LTSC 3CL3D 1HBWA 5AW6B 1GL2A 3GHGB 2WPSA 3HRNA 2OYHC 2OYIC 1JTHB 1NTMK 1SQVK 4JYBA 2XKMA 3BVHA 2C0XA 2GUSA 3HUSB 5CMZA 2J59M 1RY3A 4C7RA 5CCGC 1JY2N 1OWAA 3M0DC 1NKNA 1ZR4A 1NU1K 1GL2D 5KLVK 1M1JA 1URQC 1NO4A 3EQ2A 2QM7A 3SWYA 3TNUA 1WRGA 1JNMA 4C7NB 1SQXK 4WY4C 3MD0A 2WSCH 1KILB 1JTHA 1KFMA 3M9HA 3HTKB 1HJBA 5AVRB 2PAJA 2NPSD 3RK2D 3ALCA 1J1EC 1NTZK 2J58A 1S9KE 1FAVA 1RF1A 3BRVB 4B86A 3RK3C 2P2UA 1AFOA 2WTYA 3P7KA 5APXA 3RL0D 2ZFCA 3B5NB 1GK4A 3LW5H 3HE4B 1LWUC 2BASA 3MIWA 4GIFA 2ZXEB 5AVZB 2M3BA 1CW5A 1NOHA 5AW3B 3VTPC 2IPPA 1FZEA 1ZV8A 1GTWA 1IO4A 1S9KD 1OXZA 1JMMA 1F5EP 1FOSE 2P1JA 1IJDB 1N73C 2KYVA 4Y99B 3A7OA 2KB7P 2C9LY 1VDFA 5AVQB 5AW1B 2FFDB 2H8PD 3L4FA 2N1TA 2I1JA 1IFNA 1MFZA 3E1IA 5KJ7C 1IFMA 2WPRA 1SQPK 3HE4A 1SQQK 2WWWA 4ZKPA 1VPCA 1N7LA 1SFCA 1HVVA 2YO2A 3KPEA 3A5TA 2M8RA 4XA4A 3IR9A 2R5BA 4LC1A 5AVUB 1LTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q5U A;  5APQ A;  1NAF A;  1HBW A;  5APY A;  5AW6 B;  2R3C A;  1QP9 A;  2WPS A;  1PYI A;  1NWQ A;  5AW7 B;  1DH3 A;  2XU6 A;  4AUW A;  4GKG A;  1F4S P;  1MUU A;  3NTN A;  3M0D A;  4JYB A;  3V5B A;  5CMZ A;  1A02 J;  5AVT B;  3B8E B;  5APS A;  3A3Y B;  3VMY A;  2W6A A;  3SWF A;  1CSB A;  3TK1 A;  1OWA A;  3V4W A;  1T2K D;  3NFQ A;  5APT A;  2P7J A;  4C46 A;  4DZO A;  2WPQ A;  2XZR A;  4AYC A;  3VMX A;  3VMZ A;  3NMD A;  4XE5 B;  1GD2 E;  3HE5 B;  2ERE A;  3TNU B;  5AW0 B;  3M0A A;  2QM7 A;  3P32 A;  3TNU A;  1A02 F;  1G2C B;  1JNM A;  1PYC A;  3L35 A;  5AW8 B;  2WT7 B;  4C7N B;  2WT7 A;  4C7N A;  3MD0 A;  1GU4 A;  4KHX A;  2JJL A;  2Q3I A;  5AVW B;  4EOT A;  3M9H A;  1HJB A;  2YNY A;  3KDP B;  5AVR B;  3HTK A;  1GU5 A;  2ER8 A;  5AW4 B;  1CZQ A;  1SP4 A;  2QM8 A;  3ALC A;  1D66 A;  3V4Q A;  1H8A A;  1S9K E;  4M3L A;  1FAV A;  5AW5 B;  4B86 A;  2P2U A;  3OAK A;  2HAP C;  2R5D A;  1H89 A;  3LIE A;  3P7K A;  2WTY A;  2VRS A;  3VN0 A;  3HE5 A;  2R32 A;  2Q7C A;  3COQ A;  5AVV B;  5APX A;  1CI6 B;  2ZFC A;  1YYC A;  2E42 A;  1CI6 A;  4I2L C;  5AW2 B;  1GK4 A;  3I5C A;  5APW A;  1FOS F;  1KQL A;  2ALC A;  3HE4 B;  1H88 A;  5APU A;  2BAS A;  2XV5 A;  1J2J B;  4HYT B;  2ZXE B;  5AVZ B;  5APV A;  3P8M C;  1ZME C;  5AW3 B;  3M9B A;  2H7H A;  3VTP C;  2IPP A;  1SLQ A;  3L36 A;  1X8Y A;  3T97 A;  3UIA A;  1GZL A;  1AJY A;  1GTW A;  1IO4 A;  1S9K D;  3LID A;  2P67 A;  1MV8 A;  3TYY A;  1OXZ A;  3VYI A;  1F5E P;  1FOS E;  2ERG A;  1HWT C;  3A2A A;  3A7O A;  5AW9 B;  2C9L Y;  1AW6 A;  3O8Z A;  3M06 A;  5AVQ B;  5AW1 B;  1T2K C;  5AVY B;  2KP8 A;  2C9N Y;  4AQR D;  1MFZ A;  2YO3 A;  1HUC A;  4GT1 A;  2WPR A;  5AVS B;  5AVX B;  3L37 A;  3NXS A;  3HE4 A;  2Z5H A;  4I6M C;  2WWW A;  1JUN A;  2Z5I A;  1GK6 A;  2W27 A;  2YO2 A;  2N9B A;  3M91 A;  3A5T A;  4JYC A;  2E43 A;  2R5B A;  3IR9 A;  4LC1 A;  4RES B;  5AVU B;  3MGN A;  3KQG A; 
#chains in the Genus database with same CATH topology
 5APQ A;  4H0L C;  1QLE D;  5CCG A;  3AE4 C;  4DOJ A;  3H1K J;  1K9M Q;  2WSF J;  1NTK G;  1EZV E;  1PPJ E;  3NFQ A;  1JY3 O;  3IFM A;  4ZMD A;  2WPQ A;  1NTK J;  4IL6 H;  4OVN F;  3PH0 A;  2I8D A;  3TNU B;  1A02 F;  3R2P A;  5H2F H;  1DEB A;  2WT7 A;  4NPD A;  1L0L G;  3TGU J;  2E74 D;  1T3J A;  2YNY A;  1AQ5 A;  3KDP B;  1N2D C;  4PJ0 H;  3H1K E;  4EDF A;  1RF1 B;  1L0L J;  2Q1K A;  3CCL P;  3KZI H;  1KB9 H;  3H32 A;  2VRS A;  3RGU A;  3MUD A;  3FGA D;  2JP3 A;  1X9V A;  5TIS E;  4IFD K;  1OX3 A;  3TGU E;  3M9B A;  1P84 I;  2V7Q J;  1EDK A;  2K1A A;  4O9B A;  3OJA B;  5AW9 B;  2N1T B;  2O1J A;  5L8R J;  3NXS A;  2QJK B;  2ZVO B;  2M5A B;  1HH0 A;  2OYH B;  4EYY Q;  2WQY C;  1LTJ B;  1SQX G;  2W6B A;  2JEE A;  4PD4 I;  3PLN A;  2R3C A;  3C8V A;  2N9Y B;  1LJ2 A;  2NZ2 A;  1SQX J;  1NTZ G;  3S9O A;  2ZJS E;  5APS A;  3CWB J;  4H0L D;  4H13 C;  1URQ B;  3L72 G;  1YTZ I;  2I1K A;  4AYC A;  3VMX A;  2H89 C;  1LGH B;  1QL2 A;  3L72 J;  3P32 A;  1IC2 A;  1QVG O;  5AW8 B;  2OTL P;  3TSI A;  2KI7 B;  1RH5 B;  3B4S A;  1D66 A;  2HLO A;  2QIW A;  3CWB E;  3P8C E;  2ZYA A;  4WY4 A;  3HE5 A;  2R32 A;  3H25 A;  1SQQ G;  2E42 A;  1FZB A;  1KB9 I;  4JQ0 D;  2D2C C;  1ZME C;  1URQ D;  1ZW0 A;  1SLQ A;  3PP5 A;  5B66 H;  1KQG B;  3MZW B;  1AVY A;  2LXB A;  4PV1 C;  2ZT9 C;  2C9N Y;  1RE4 C;  3L37 A;  5K5G B;  5CCH A;  1EDJ A;  3AEG C;  1FBM A;  2NPS A;  1JY3 P;  1IK7 A;  5APY A;  1J1D B;  2HYN A;  1NAF A;  3MHV A;  2FYU G;  2AXT E;  1UIX A;  2B87 B;  3L75 E;  3V5B A;  1S72 P;  2E75 B;  2DW3 A;  1A02 J;  1NKZ B;  3AEB C;  1VF5 C;  3CLQ A;  2W6A A;  3V4W A;  2HFE D;  4N78 E;  1VQO P;  3AEC C;  3MTU E;  5TJH A;  2OAR A;  4H13 D;  3BRT B;  5BU8 B;  1OIP A;  4C7N A;  3KYQ A;  1AV1 A;  1EZV I;  1VQL P;  3L75 D;  1GMJ A;  3AE9 C;  1H0T B;  2WPV B;  1H8A A;  1NHL A;  4N78 D;  2YMY A;  1W5C E;  2HAP C;  5BVZ A;  4OGQ C;  3S1K A;  1CI6 B;  1YYC A;  2HG5 D;  3GW6 A;  2O01 H;  1IFP A;  2YKP A;  3H1L G;  4BXL A;  1X8Y A;  1IK9 A;  4U7J A;  2Q6Q A;  2XDJ A;  2KIK A;  1LT9 B;  5GTH H;  2BCC D;  2YKO A;  1RQV A;  1OMI A;  2K3R A;  1HJ0 A;  1FZC B;  2ZAE B;  2Z5H A;  1K05 A;  1BGY G;  2CPB A;  1SQP J;  2N9B A;  3AEE C;  3A0B E;  1SFC C;  3V2P A;  1LTS C;  3PHL A;  3GHG B;  2WPS A;  1X0T A;  1ZRT E;  2C0X A;  2GUS A;  2Q3E A;  1SS1 A;  1PV3 A;  4C7R A;  3TF5 A;  1NAY A;  1OWA A;  2AXT H;  3G4S P;  1SQP E;  1GL2 D;  1R8E A;  1VQ7 P;  1M1J A;  3EQ2 A;  3TNU A;  1PP9 G;  4U3F G;  1VQK P;  1NYH A;  2YXR B;  4WY4 C;  3V6I A;  2QE7 H;  1KIL B;  3KXD A;  2QSI A;  1EXI A;  1PGO A;  1S9K E;  1RF1 A;  2H88 C;  4I7Z C;  3P7K A;  1BDC A;  3CCR P;  4L74 A;  4GDO A;  1GK4 A;  2KSE A;  2OYO A;  3L70 J;  2IBZ G;  2BAS A;  1VQ6 P;  2ZXE B;  3GF3 A;  2IPP A;  1S9K D;  1NTM E;  2KZJ A;  3L71 J;  1OXZ A;  4HB1 A;  1JMM A;  1F5E P;  1IJD B;  3AE3 C;  1NVO A;  3L4F A;  2QEX P;  2N1T A;  1LT1 A;  1MFZ A;  3E1I A;  1OW6 A;  2WPR A;  3AE1 C;  2A06 G;  1SQP K;  3HE4 A;  1VL2 A;  1VPC A;  3L70 E;  2YIU B;  1N7L A;  1NTM D;  4K3A A;  2YO2 A;  2R5B A;  3IR9 A;  1LTJ A;  1Y47 A;  3L71 E;  4PD4 E;  1NU1 D;  3A0B H;  3M0D A;  1VQN P;  3H1I G;  5KLV D;  3CPW O;  1SFC D;  3ZDM A;  1OVV A;  2WIT A;  3RK2 B;  2ZYG A;  1FZA A;  3H1I J;  3M9Q A;  4RJT A;  4PD4 D;  2C0W A;  3HD7 C;  1IZN B;  1FJP A;  3H1H E;  4TT3 H;  3AE8 C;  1EDL A;  3T97 B;  5AW4 B;  1SP4 A;  1YJW P;  3RBX A;  1RHZ B;  5KAI E;  4I2L C;  1XTG B;  1VQ4 P;  2ALC A;  3L73 J;  3H1H D;  2KOG A;  2H7H A;  2HOD B;  1FC2 C;  1L4A A;  2HPC B;  2G3A A;  4DJG A;  3USS A;  5AVY B;  2KP8 A;  1LTA C;  3PTZ A;  1FU1 A;  5AVX B;  1N7S A;  1Q86 Q;  2FXP A;  3L73 E;  1K73 Q;  1JY2 P;  2JR8 A;  2W27 A;  3CI9 A;  3L74 J;  2ZYD A;  1KFN A;  3BAS A;  3N4X A;  2M3E A;  1M1J C;  2E76 C;  3H1J D;  1FDI A;  1YJN P;  2RMZ A;  1FS0 E;  4PD4 H;  3L73 D;  3VP9 A;  3BCC J;  3WMM 0;  3EFG A;  2IX7 C;  4EIJ A;  5APT A;  3W68 A;  3HUS C;  4YXD C;  1S1C X;  2OYI A;  4MN4 C;  3L74 E;  1RF1 C;  4L73 A;  2FYZ A;  2JO1 A;  2O1K A;  2WZ7 A;  3O6Q A;  3I55 P;  4EOT A;  3RK3 B;  1H0T A;  1E5W A;  1G1I A;  3V4Q A;  3A0H E;  5CBN A;  3BCC E;  1L2P A;  1BE3 G;  1LWU B;  1H89 A;  3COQ A;  1CI6 A;  5APW A;  1KQL A;  4LGD E;  5APU A;  1BE3 J;  3RK3 E;  2N1T C;  1YBK A;  3Q2Y A;  1N73 B;  5KAI H;  1EZV D;  3B5N C;  1PPJ D;  4H44 B;  2G8Y A;  5KAF E;  2RN0 A;  1EXJ A;  2QJK C;  4HH2 A;  3W67 A;  2KK7 A;  3AED C;  4NPF X;  1T2K C;  1D7M A;  1NTK E;  1LTJ C;  1UII A;  2YO3 A;  4GT1 A;  3GF7 A;  5KKZ B;  3RK3 D;  1FZC A;  3BAT A;  2WSE J;  2GUV A;  3H1K D;  4H0L B;  2KS1 A;  3M91 A;  2E43 A;  3MGN A;  2JWA A;  1OZH A;  5KJ7 A;  1L0L E;  1BSN A;  1NTK D;  2A45 G;  3GHG A;  1PYI A;  1M90 Q;  2XU6 A;  4AUW A;  4GKG A;  1Q7Y Q;  1MUU A;  3VMY A;  4H44 D;  3TGU D;  1CSB A;  2KXP B;  3IF4 A;  2IFN A;  4GOF A;  2LR2 A;  3II6 A;  1GD2 E;  1YQ4 C;  2ERE A;  3V2R A;  3AE6 C;  1L0L D;  1EDI A;  3WU2 E;  1KIL A;  1AA0 A;  3RL0 C;  1KN7 A;  1NTK K;  2QJP B;  1JCC A;  2R3S A;  3OAK A;  1NTZ J;  4D6T G;  3VN0 A;  2Z4E A;  3A0H H;  1Q81 Q;  1L4A C;  2KSJ A;  2QRX A;  1J1E B;  4HYT B;  4D6T J;  1SQX E;  1L0L K;  3UIA A;  1VQM P;  1N7S C;  2P67 A;  1L0N G;  2AEM A;  2WSF H;  4L75 A;  2SPZ A;  3K5B A;  1L0N J;  5AVS B;  3L72 E;  3R4Y A;  1ZR2 A;  4I6M C;  3VMA A;  1S2E A;  1SQX D;  4N3Y B;  1SQQ J;  2BEZ F;  5TIS H;  1WT6 A;  3CWB D;  3P8C D;  4W7Z A;  1HBW A;  3CL3 D;  5AW6 B;  3C1L A;  1S4X A;  4H13 B;  2OYI C;  1E79 H;  3L72 D;  3BVH A;  4GOD A;  5CCG C;  1JY2 N;  1S5L E;  1BDD A;  4NPE A;  1SQQ E;  1NO4 A;  3CCV P;  2Y0D A;  3CMA P;  1SQX K;  2OGU A;  2K88 A;  1JTH A;  1KFM A;  1SQB G;  4ASV A;  2HR3 A;  2V7Q H;  3HTK B;  1HJB A;  3WU2 H;  2FYU J;  4RO0 A;  3ALC A;  1NTZ K;  2J58 A;  1FAV A;  5DJU B;  1W2B O;  1SQB J;  2P2U A;  3Q3D A;  1QEX A;  4R4M A;  2XND H;  5APX A;  3RL0 D;  2BCC G;  5AVZ B;  3FXD A;  3MUD C;  1CW5 A;  1NOH A;  5KLI C;  1YI2 P;  3CCQ P;  1GTW A;  2ZT9 B;  2FYU E;  2KYV A;  2FYN C;  4DCK A;  1YQ3 C;  2H8P D;  1IFN A;  5KJ7 C;  3B71 A;  3PJS K;  1SQQ K;  2WWW A;  4ZKP A;  1AVO A;  2OTJ P;  1HVV A;  1DD3 A;  3D71 A;  5AVU B;  2W83 C;  2D2C D;  3D6Z A;  1GL2 B;  3H1L J;  1IFJ A;  2K9J A;  1VF5 B;  5AW7 B;  2FFD A;  2W6J H;  2B9B A;  3E1R A;  4PV1 D;  3TK1 A;  2KNC B;  2P7J A;  2ZT9 D;  3PRJ A;  5CHX A;  3NMD A;  3V2Q A;  1BGY J;  4N6J A;  1S5L H;  1PYC A;  5CCG D;  1IFI A;  3H1L E;  2FYU K;  3TDK A;  4YPC A;  1BSH A;  1R5S A;  4OGQ B;  1KMI Z;  1MFT A;  2IYP A;  1SVF A;  1M56 D;  2Q7C A;  1VF5 D;  1JO5 A;  1BGY E;  2PFX A;  3H1L D;  1QVF O;  1KQF B;  1ZRT D;  3P8M C;  3C9I A;  1N73 A;  4OH8 B;  1PP9 J;  4U3F J;  1QGK B;  2WSC J;  2A45 I;  3L36 A;  1OW7 A;  1KQS O;  3E7K A;  3VYI A;  1FE6 A;  1SQP D;  1HWT C;  4UB8 E;  2OTK E;  1SQV G;  1YHQ P;  1OW8 A;  1BGY D;  1SQV J;  1NU1 G;  1SFC B;  1XTC C;  3LW5 J;  4OGQ D;  5KLV G;  5CCH C;  1PP9 E;  2QVA A;  4U3F E;  4C46 A;  1NH4 A;  2FXM A;  2Q5U A;  4BWN A;  2NPS C;  2OQQ A;  3RK2 C;  1RE3 A;  3B8E B;  3A3Y B;  5CJ4 A;  2B89 A;  4YXW H;  2M5A A;  4WY4 B;  1DEE G;  2OYH A;  3HE5 B;  1VQ5 P;  2WMM A;  4KJM A;  3M0A A;  2IBZ E;  1KZU B;  3L35 A;  4KHX A;  4HJG H;  1GU5 A;  3AEA C;  3FWL A;  3L70 D;  3H1H G;  1URQ A;  4WVZ A;  1IFD A;  4W80 A;  1JCD A;  1JY3 N;  1HGZ A;  3LIE A;  1Z56 A;  2IBZ D;  3L71 D;  2NRG A;  1KC8 Q;  2A06 E;  2MKV A;  1N86 A;  3Q5P A;  1MKM A;  1FOS F;  5M1B A;  2XV5 A;  2RKL A;  2IYO A;  1W2E A;  3JC2 2;  1ZN5 A;  3TYY A;  4WY4 D;  1DIP A;  2ERG A;  4A7P A;  1OFC X;  1BCC G;  3M06 A;  3H1I E;  1RQU A;  2QJY C;  4Y99 C;  2FKW B;  3OW2 O;  2FFD C;  1BCC J;  1JUN A;  4QMA A;  3H1J G;  1Q90 D;  2AEJ A;  2CK3 H;  1VQ8 P;  5CBO A;  2GM4 A;  3JSV C;  2E74 C;  2JKV A;  1G2C B;  1PFI A;  2WSS H;  3H1I D;  4YTP C;  1NWQ A;  1DH3 A;  1M1K Q;  5CCH D;  1VQ9 P;  3CME P;  3CCM P;  3SWF A;  3SWK A;  2E5Y A;  4XE5 B;  3HD7 B;  2LXC B;  1Y9B A;  3WUV A;  1GW4 A;  1PZQ A;  1HGV A;  2B87 A;  2Y0C A;  3HTK A;  1CZQ A;  2YKQ A;  2QM8 A;  1G1J A;  1EZV G;  3VOP A;  1PPJ G;  1KYO I;  3CCE P;  2ZVN B;  2L91 A;  3CXH E;  3G3Z A;  4HKZ H;  3SFE C;  1QL1 A;  1FJK A;  3Q5R A;  3ITK A;  1N8R Q;  3FWN A;  1KD1 Q;  4JF7 A;  2PP6 A;  3H1K G;  3HD7 D;  1RE4 A;  4JBZ A;  1AW6 A;  5BU5 A;  3L74 D;  1ZOY C;  3CXH D;  1KOR A;  1HUC A;  2CPS A;  1PIX A;  3H6P A;  2KLU A;  3IAO A;  1WMK A;  3U59 A;  1RE3 C;  1T8Z A;  1DD4 A;  3TGU G;  1Q82 Q;  1M1J B;  1LTG C;  2IFM A;  4OWF A;  3BCC D;  1LT9 A;  1LTB C;  4IL6 X;  2E76 B;  1GL2 A;  2OYH C;  4JYB A;  2WVR A;  3HUS B;  2J59 M;  1BE3 E;  3M0D C;  1ZR4 A;  2Y9Y A;  2KNC A;  1LP1 B;  1URQ C;  3SWY A;  1M57 D;  3GG2 A;  1JNM A;  2QJP C;  1EC5 A;  2V4H A;  3MD0 A;  5B66 E;  2P10 A;  3M9H A;  5AVR B;  1YIT P;  2PAJ A;  3KHU A;  4BRY B;  4Z1M H;  1BE3 D;  1J1E C;  3BRV B;  4B86 A;  3Q5S A;  2IBZ I;  1AFO A;  2W90 A;  2E76 D;  2ZFC A;  3B5N B;  3HE4 B;  1JEK A;  3MIW A;  1M8O B;  2M3B A;  1TU3 F;  5AW3 B;  3CXH H;  3VTP C;  1FZE A;  1K04 A;  4ZNC A;  3GMA A;  2O3J A;  1PGQ A;  1FOS E;  1KV4 A;  2KB7 P;  3CWB G;  2B88 A;  2I1J A;  4JPZ B;  2KZI A;  4L76 A;  3CCS P;  1SFC A;  3I56 P;  2O01 J;  3A5T A;  1JB0 J;  4LC1 A;  1OVU A;  4DT0 A;  2N1T D;  4ASW A;  1Q2N A;  1K8A Q;  2PGD A;  1QP9 A;  2M0B A;  3B5N D;  5KAF H;  1NTZ E;  4LLH A;  1F4S P;  2IDB A;  1J1D C;  2PRR A;  1T2K D;  1FDM A;  4D6T E;  4DZO A;  2E75 C;  4WBA A;  1NGM B;  3RBZ A;  1USE A;  1NTZ D;  3RL0 B;  1GU4 A;  3S4R A;  5KTB A;  2JJL A;  3CX5 E;  1L0N E;  2ER8 A;  5GTH E;  1T6A A;  2UWJ E;  3L75 G;  4D6T D;  1MZ9 A;  1YJ9 P;  1L4A B;  2YXQ B;  1YTZ T;  4XFJ A;  3SFD C;  3L75 J;  5AVV B;  4Y28 J;  2WSE H;  4I1L A;  1N7S B;  1T3U A;  5GTI E;  2H43 A;  1QX8 A;  1J2J B;  3CX5 D;  3U1A A;  1L0N D;  1RF0 A;  2K9Y A;  3AE5 C;  3T97 A;  1GZL A;  4KT0 J;  1AJY A;  3F89 A;  2YMK A;  3IN6 A;  3JCU E;  3CXH I;  1SQQ D;  2D2C B;  4IFM A;  1LT9 C;  2A45 H;  1VQP P;  1GL2 C;  3VP8 A;  4R4L A;  2HOD A;  2O01 N;  1L4A D;  4PV1 B;  2OYI B;  2BCC J;  1FZC C;  4RES B;  1ZLL A;  2MJZ A;  3G71 P;  1U7J A;  1G2C A;  2HPC A;  4CPG A;  1L0N K;  3U1C A;  1SQB E;  3EFF K;  3O6Q B;  3NTN A;  1N7S D;  1ZP0 C;  1JOC A;  3FXE A;  3GHG C;  4UB6 E;  1GDT A;  2AEF A;  3QWO C;  2FXO A;  3D70 A;  2FYU D;  3G6E P;  2J5U A;  1M7L A;  3HD7 A;  2JDI H;  2BCC E;  5AW0 B;  5B5E E;  4WWI A;  1SQB D;  2WT7 B;  2E75 D;  4GOE A;  1FZF A;  2Q3I A;  5AVW B;  5CJ0 A;  1LTI C;  3AEF C;  5EFW B;  1KIL C;  4K35 A;  1FZG A;  5AW5 B;  3CX5 H;  3H32 B;  2R5D A;  3EWK A;  1EQ7 A;  1KYO E;  5E79 E;  1SQP G;  5KLI B;  5AW2 B;  1H88 A;  3CD6 P;  4W7Y A;  5APV A;  2FYN B;  2KS1 B;  1SQB K;  1MV8 A;  5GTI H;  4IOI H;  1KTM A;  2KLV A;  1LWU A;  1S5L X;  1KYO D;  3N7N A;  1FDO A;  4AQR D;  1YIJ P;  2LKM A;  3JCU H;  1LNQ A;  4ZKU A;  1JY2 O;  2POH A;  3Q1M A;  4JYC A;  3KQG A;  2AXC A;  2YIU C;  1NTM G;  3QH9 A;  1LTT C;  1JM0 A;  1NTM J;  5AVT B;  3HUS A;  4TLF A;  2XZR A;  3L70 G;  5KJ7 D;  3VMZ A;  1LP1 A;  4UB6 H;  1NU1 J;  2IZ0 A;  3GLM A;  1S3J A;  5KLV J;  3CC2 P;  1PL5 A;  1KIL E;  3L71 G;  2FY8 A;  5B5E H;  4BRY A;  1SQV E;  2L5G B;  4M3L A;  1P84 E;  1RF0 C;  1PP9 D;  4U3F D;  3OA7 A;  1U7M A;  2K37 A;  1NU1 E;  3CC4 P;  3B5N A;  3AE2 C;  1KIL D;  2Y9Z A;  3I5C A;  1GW3 A;  2Q9I A;  3CX5 I;  1JMB A;  5KLV E;  1OVR A;  1KYO H;  4I7Z B;  2P58 A;  4IFF A;  5E79 H;  2Y0E A;  3ABV C;  1SQV D;  4RKU J;  2R44 A;  3LID A;  1P84 D;  1X79 B;  2KUB A;  3A2A A;  3O8Z A;  3H1H J;  3WUT A;  2XNX A;  3RL0 g;  2QA4 P;  2NPS B;  2Z5I A;  1DX7 A;  1GK6 A;  2W8Z A;  3V2N A;  1HTL C;  2ITA A;  3CC7 P;  4WB4 A;  3HRN A;  2A06 D;  2ZXX A;  2E5T A;  1X22 A;  1JTH B;  1NTM K;  1SQV K;  2GA1 A;  2XKM A;  4UB8 H;  4IL6 E;  5CMZ A;  3CCU P;  1RY3 A;  2JWD A;  3G9R A;  1PGJ A;  1NKN A;  3FX0 A;  5H2F E;  1NU1 K;  3L73 G;  5KLV K;  1R5L A;  2BEQ D;  2QM7 A;  1WRG A;  2IZ1 A;  3H1J J;  4PJ0 E;  5DJT B;  4C7N B;  2WSC H;  3KZI E;  3D6Y A;  1KB9 E;  2NPS D;  3RK2 D;  3MP7 B;  1U57 A;  1ZXG A;  1BCC E;  1NJI Q;  3RK3 C;  1PGP A;  3CCJ P;  2WTY A;  3WUU A;  5C39 A;  1P84 H;  3L74 G;  3LW5 H;  1LWU C;  3H1J E;  1USD A;  4GIF A;  1KB9 D;  1Y8A A;  3SSU A;  1ZV8 A;  1IO4 A;  4EI2 A;  1BCC D;  2QJY B;  2P1J A;  1N73 C;  4Y99 B;  3A7O A;  2K9J B;  2C9L Y;  4H44 C;  1AQT A;  1VDF A;  1HF9 A;  5AVQ B;  5AW1 B;  2FFD B;  2FBW C;  3F5H A;  3AE7 C;  3BCC G;  1IFM A;  2E74 B;  2RH0 A;  2QG4 A;  5KKZ C;  3KPE A;  2M8R A;  4XA4 A; 
#chains in the Genus database with same CATH homology
 5APQ A;  1GL2 B;  2N1T D;  1IFJ A;  1QP9 A;  3B5N D;  5AW7 B;  2FFD A;  4LLH A;  1F4S P;  5CCG A;  3M0D A;  4DOJ A;  1J1D C;  1SFC D;  2WIT A;  3TK1 A;  1T2K D;  3RK2 B;  3NFQ A;  1FDM A;  2P7J A;  4DZO A;  1FZA A;  1JY3 O;  3IFM A;  2WPQ A;  3M9Q A;  5CHX A;  3NMD A;  4WBA A;  3V2Q A;  3TNU B;  4N6J A;  1A02 F;  1PYC A;  3R2P A;  5CCG D;  1DEB A;  2WT7 A;  3RL0 B;  1GU4 A;  1IFI A;  2C0W A;  3HD7 C;  5KTB A;  2JJL A;  1FJP A;  2FYU K;  1T3J A;  2YNY A;  1AQ5 A;  3KDP B;  1N2D C;  5AW4 B;  2ER8 A;  1SP4 A;  1MZ9 A;  1RF1 B;  1L4A B;  3H32 A;  1YTZ T;  1SVF A;  2VRS A;  2Q7C A;  3MUD A;  5AVV B;  1JO5 A;  4I2L C;  1XTG B;  2ALC A;  1X9V A;  2WSE H;  4I1L A;  1N7S B;  1T3U A;  2H43 A;  1J2J B;  4IFD K;  2KOG A;  3U1A A;  3P8M C;  3C9I A;  4OH8 B;  1N73 A;  1RF0 A;  3M9B A;  2HOD B;  2H7H A;  2A45 I;  3L36 A;  3T97 A;  1GZL A;  1AJY A;  3VYI A;  1L4A A;  2HPC B;  4O9B A;  1HWT C;  3OJA B;  5AW9 B;  2N1T B;  4IFM A;  5AVY B;  2KP8 A;  1LTA C;  1LT9 C;  2A45 H;  2O1J A;  1FU1 A;  1GL2 C;  5AVX B;  3VP8 A;  3NXS A;  1N7S A;  1SFC B;  1XTC C;  1HH0 A;  1JY2 P;  2HOD A;  2W27 A;  1L4A D;  3CI9 A;  2OYH B;  5CCH C;  2OYI B;  1FZC C;  1KFN A;  1LTJ B;  1ZLL A;  4RES B;  2W6B A;  1NH4 A;  4C46 A;  2MJZ A;  2JEE A;  2FXM A;  2Q5U A;  3BAS A;  1G2C A;  2HPC A;  2NPS C;  3RK2 C;  3N4X A;  2R3C A;  1L0N K;  3U1C A;  1M1J C;  3NTN A;  1N7S D;  1RE3 A;  1JOC A;  3GHG C;  3B8E B;  5APS A;  3A3Y B;  1GDT A;  1URQ B;  3VP9 A;  1YTZ I;  3WMM 0;  5CJ4 A;  3EFG A;  2IX7 C;  4EIJ A;  5APT A;  2I1K A;  4AYC A;  3HUS C;  4WY4 B;  3VMX A;  2OYH A;  2OYI A;  3HE5 B;  1M7L A;  3HD7 A;  5AW0 B;  3M0A A;  1LGH B;  1QL2 A;  3P32 A;  1KZU B;  1RF1 C;  1IC2 A;  3L35 A;  5AW8 B;  2WT7 B;  3TSI A;  2FYZ A;  2O1K A;  4KHX A;  2WZ7 A;  1FZF A;  2Q3I A;  5AVW B;  4EOT A;  3RK3 B;  5CJ0 A;  1GU5 A;  1E5W A;  1LTI C;  1D66 A;  1G1I A;  2HLO A;  3V4Q A;  1URQ A;  1KIL C;  1IFD A;  1FZG A;  4W80 A;  5AW5 B;  3H32 B;  3P8C E;  1JCD A;  1JY3 N;  1HGZ A;  1LWU B;  2R5D A;  1H89 A;  4WY4 A;  3LIE A;  1Z56 A;  3HE5 A;  2R32 A;  1EQ7 A;  3COQ A;  1N86 A;  2E42 A;  1CI6 A;  5AW2 B;  5APW A;  1FOS F;  1KQL A;  4LGD E;  1H88 A;  5APU A;  1FZB A;  2XV5 A;  2N1T C;  4W7Y A;  5APV A;  1ZME C;  1N73 B;  1W2E A;  1URQ D;  3B5N C;  1SLQ A;  1ZN5 A;  3PP5 A;  1SQB K;  1MV8 A;  3TYY A;  4WY4 D;  2ERG A;  4HH2 A;  2KLV A;  1LWU A;  3M06 A;  3N7N A;  1T2K C;  1LTJ C;  2C9N Y;  4AQR D;  1RE4 C;  2YO3 A;  2LKM A;  4GT1 A;  4Y99 C;  2FKW B;  3L37 A;  3RK3 D;  5CCH A;  1FZC A;  2FFD C;  4ZKU A;  1FBM A;  1JY2 O;  2POH A;  3BAT A;  1JUN A;  2GUV A;  2NPS A;  2GM4 A;  3M91 A;  1JY3 P;  4JYC A;  2E43 A;  3MGN A;  1G2C B;  3KQG A;  5APY A;  1J1D B;  2HYN A;  1NAF A;  5KJ7 A;  1PFI A;  1PYI A;  2A45 G;  3GHG A;  1NWQ A;  1LTT C;  2XU6 A;  1DH3 A;  4AUW A;  4GKG A;  5CCH D;  1MUU A;  3V5B A;  1A02 J;  5AVT B;  1NKZ B;  3HUS A;  3CLQ A;  3VMY A;  2W6A A;  3SWF A;  1CSB A;  3V4W A;  2HFE D;  2IFN A;  4N78 E;  2XZR A;  3MTU E;  5KJ7 D;  3VMZ A;  3II6 A;  4XE5 B;  1GD2 E;  3HD7 B;  2ERE A;  3V2R A;  2OAR A;  1GW4 A;  3BRT B;  5BU8 B;  4C7N A;  3KYQ A;  1HGV A;  1KIL A;  3HTK A;  1CZQ A;  2YKQ A;  2QM8 A;  1G1J A;  3RL0 C;  1NTK K;  1H8A A;  1NHL A;  2L5G B;  4M3L A;  4N78 D;  3VOP A;  2YMY A;  1RF0 C;  1JCC A;  3OAK A;  2HAP C;  3VN0 A;  3OA7 A;  2Z4E A;  5BVZ A;  3G3Z A;  1CI6 B;  1L4A C;  2KSJ A;  1YYC A;  3B5N A;  1KIL D;  3I5C A;  1GW3 A;  2Q9I A;  2HG5 D;  2O01 H;  1QL1 A;  1J1E B;  1FJK A;  4HYT B;  4IFF A;  2YKP A;  1L0L K;  3UIA A;  1X8Y A;  1IK9 A;  2XDJ A;  1N7S C;  2P67 A;  3LID A;  1X79 B;  1LT9 B;  2PP6 A;  4JF7 A;  3HD7 D;  1RE4 A;  3A2A A;  1AW6 A;  3O8Z A;  5BU5 A;  2WSF H;  2XNX A;  2YKO A;  1HUC A;  5AVS B;  2CPS A;  1FZC B;  3H6P A;  1ZR2 A;  2Z5H A;  4I6M C;  3U59 A;  2CPB A;  1RE3 C;  2NPS B;  2Z5I A;  1DX7 A;  4N3Y B;  1GK6 A;  1T8Z A;  3V2N A;  1HTL C;  2N9B A;  1WT6 A;  1M1J B;  1LTG C;  2IFM A;  1LT9 A;  1LTB C;  3P8C D;  1SFC C;  4W7Z A;  3V2P A;  4WB4 A;  1LTS C;  3CL3 D;  1HBW A;  5AW6 B;  1GL2 A;  3GHG B;  2WPS A;  3HRN A;  2OYH C;  2OYI C;  1JTH B;  1NTM K;  1SQV K;  4JYB A;  2XKM A;  3BVH A;  2C0X A;  2GUS A;  3HUS B;  5CMZ A;  2J59 M;  1RY3 A;  4C7R A;  5CCG C;  1JY2 N;  1OWA A;  3M0D C;  1NKN A;  1ZR4 A;  1NU1 K;  1GL2 D;  5KLV K;  1M1J A;  1URQ C;  1NO4 A;  3EQ2 A;  2QM7 A;  3SWY A;  3TNU A;  1WRG A;  1JNM A;  4C7N B;  1SQX K;  4WY4 C;  3MD0 A;  2WSC H;  1KIL B;  1JTH A;  1KFM A;  3M9H A;  3HTK B;  1HJB A;  5AVR B;  2PAJ A;  2NPS D;  3RK2 D;  3ALC A;  1J1E C;  1NTZ K;  2J58 A;  1S9K E;  1FAV A;  1RF1 A;  3BRV B;  4B86 A;  3RK3 C;  2P2U A;  1AFO A;  2WTY A;  3P7K A;  5APX A;  3RL0 D;  2ZFC A;  3B5N B;  1GK4 A;  3LW5 H;  3HE4 B;  1LWU C;  2BAS A;  3MIW A;  4GIF A;  2ZXE B;  5AVZ B;  2M3B A;  1CW5 A;  1NOH A;  5AW3 B;  3VTP C;  2IPP A;  1FZE A;  1ZV8 A;  1GTW A;  1IO4 A;  1S9K D;  1OXZ A;  1JMM A;  1F5E P;  1FOS E;  2P1J A;  1IJD B;  1N73 C;  2KYV A;  4Y99 B;  3A7O A;  2KB7 P;  2C9L Y;  1VDF A;  5AVQ B;  5AW1 B;  2FFD B;  2H8P D;  3L4F A;  2N1T A;  2I1J A;  1IFN A;  1MFZ A;  3E1I A;  5KJ7 C;  1IFM A;  2WPR A;  1SQP K;  3HE4 A;  1SQQ K;  2WWW A;  4ZKP A;  1VPC A;  1N7L A;  1SFC A;  1HVV A;  2YO2 A;  3KPE A;  3A5T A;  2M8R A;  4XA4 A;  3IR9 A;  2R5B A;  4LC1 A;  5AVU B;  1LTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...