1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
molecule tags Transcription regulation
molecule keywords PUT3
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
3H25A 1F4SP 2HAPC 1WMKA 3ALCA 1D66A 2G8YA 2ERGA 2ER8A 1AW6A 1QP9A 1OMIA 2ALCA 2P10A 1AJYA 1FDOA 1PYIA 2EREA 3IN6A 1FDIA 3COQA 3EWKA 1HWTC 1PYCA 1ZMEC 1F5EP 3O6QA
chains in the Genus database with same CATH superfamily
3B4SA 4IFFA 2Q7CA 2BEQD 2W90A 3H25A 4HKZH 1RY3A 3OW2O 2V7QJ 1MKMA 4NPEA 1LT9C 2QVAA 3U59A 1Q81Q 1FC2C 3CCEP 1NTKD 2PP6A 2OYIC 2OYHA 2QIWA 4ZMDA 2L91A 2KZJA 1CI6A 3C9IA 1NOHA 2QE7H 3PTZA 5KJ7C 4MN4C 1J1EC 1IC2A 2KK7A 3H1KE 4TLFA 1N7SD 4OVNF 3CPWO 1RHZB 1BCCE 1OMIA 4O9BA 2O3JA 4PJ0H 5AVYB 4OGQC 1Y8AA 1PIXA 3M0AA 1NU1G 3B8EB 1AJYA 3CL3D 1ZP0C 1JO5A 1EZVG 2AXTH 2Y0CA 1NTZJ 4UB8E 1L0LD 1MUUA 4K3AA 3TYYA 3L74D 5GTIH 2WPVB 1LP1B 3I56P 5DJUB 3CCQP 1QVFO 1IFIA 1ZV8A 3V4WA 2OYOA 1PP9E 4PV1B 1QEXA 3AECC 5E79E 1RF1A 4KT0J 4H44B 1NKNA 5KKZC 2SPZA 3ZDMA 4GIFA 2E5YA 2WPQA 3AE8C 1OVVA 5AVVB 1YJWP 3L74G 1EDKA 2WQYC 1SVFA 1S9KE 3CCJP 1YJNP 1YBKA 3D6ZA 1KFNA 1PZQA 4IOIH 2BCCJ 5BU8B 4BXLA 1EZVD 1U7MA 2I1JA 1VL2A 3SWYA 3FWLA 1UIIA 3PRJA 4KJMA 2FXPA 2W6BA 4EYYQ 3IR9A 1JMBA 1HJBA 2YO2A 2WMMA 1AVYA 3I5CA 1GU5A 5KKZB 3OAKA 4H44C 5CCHA 1FS0E 2QRXA 3GHGC 4EOTA 1FZCB 1NKZB 3LIEA 3CCVP 1SFCA 1XTGB 3VP9A 5AW5B 4LC1A 1PGPA 2BCCE 3PHLA 4EDFA 2C9LY 4PD4E 2OYHB 1NTMK 1HTLC 2YMKA 5KJ7A 2HPCB 1ZW0A 3KHUA 2NPSC 3P32A 5AVUB 3WUTA 1GD2E 3EFGA 3G3ZA 1D66A 1T3JA 2I1KA 1EDIA 3JSVC 1PGOA 2H89C 2P1JA 2H8PD 3BRTB 1SQXD 1X9VA 2Q1KA 4N3YB 3CXHH 5CMZA 1FE6A 5AW6B 2OYIB 1NU1E 1AW6A 1GTWA 1BGYD 2XZRA 4GT1A 1JUNA 3AEBC 1BCCG 2K3RA 2E74C 5AW2B 3VMYA 2Y9YA 3AEEC 4GOEA 2E5TA 1IFDA 1JM0A 3H1KG 1SS1A 4WVZA 2PGDA 5AVSB 1M1KQ 1KD1Q 5C39A 2FFDC 2O1JA 1ZRTE 1KMIZ 1LT9A 2D2CC 5KLVD 3RL0g 1FOSE 3TGUG 1X22A 3E1IA 2KB7P 1N7LA 3HUSC 2NRGA 2PFXA 4PD4D 4PJ0E 4EI2A 3A5TA 1OFCX 1RE3A 2PRRA 1HWTC 3N4XA 1F5EP 1URQD 2KYVA 1BE3G 1BE3E 3IFMA 1KN7A 1L0NE 1RE3C 3W68A 3CCMP 2HAPC 1LTAC 2KNCA 1CZQA 1RF0C 2DW3A 2JDIH 2R32A 2Y0DA 3H1HE 5APWA 1LT1A 1M1JA 1SQPE 2O01J 4W80A 4ASWA 5AW0B 3S1KA 4BRYB 3TGUE 4PD4H 5E79H 1NH4A 1MFZA 1KORA 2QJKB 1GL2B 3FXDA 1T6AA 1L4AD 1URQC 2AEMA 3BCCJ 3FXEA 5AW1B 3RGUA 3RBXA 2KLUA 3R4YA 4RJTA 1Q82Q 1K73Q 5M1BA 2A06G 3IF4A 2HYNA 2HODA 2FYUJ 5CCHD 2M3EA 3H1LE 5B5EE 1RF1B 1R5SA 1FBMA 3L73D 3VN0A 2HPCA 1KFMA 1VQLP 2KIKA 4I1LA 1LGHB 3TGUJ 3COQA 2E76B 1L2PA 1GW3A 2B87B 3BRVB 3L70D 2IBZE 1JNMA 1J2JB 4C7RA 3RBZA 1H0TB 4I2LC 2JJLA 3WMM0 1WMKA 2XKMA 3RK3C 2JWDA 3CD6P 2BASA 3JCUE 1LJ2A 3HTKB 4ZKUA 3H1KD 2RH0A 2YMYA 1YQ3C 3SFDC 3D71A 2WSSH 1JMMA 1SQQE 1SQBJ 2NPSD 2FFDA 1BCCD 3P8MC 1RH5B 3HD7A 3H1JG 4JYCA 1BGYG 1KYOI 1KILA 1U7JA 3BCCG 1SQVK 4L75A 4WBAA 1T2KD 3MTUE 1YI2P 1KQLA 3AE4C 3WU2H 4XE5B 1NWQA 1KILD 1FZFA 5AW7B 1N73C 1Y47A 1BSHA 1N8RQ 3M9HA 4I6MC 3P8CE 1P84E 3WU2E 2ZYDA 3RK2C 1G2CA 3L74E 5KAFE 3NMDA 4RO0A 5CBNA 5CHXA 3B5NB 2R3SA 3EWKA 3O8ZA 4GOFA 1WRGA 2ZT9D 1M57D 2HODB 2ZVOB 2QA4P 3CC4P 2O1KA 1PYCA 1PP9G 3CX5H 2P2UA 3GF3A 3OJAB 3RL0C 3TNUB 3VTPC 1D7MA 1NTKE 1HGVA 3LW5H 1KYOH 4L74A 1GL2A 4XA4A 2O01H 1T3UA 3MIWA 1S9KD 3M0DC 3CX5E 3JC22 1RF1C 4IFDK 2OTLP 2UWJE 2OARA 1LTJC 1EZVE 1KYOE 1WT6A 4H44D 1M56D 2JEEA 3L71D 4H13C 1KC8Q 2IFNA 2QM7A 3L74J 4GDOA 4N6JA 3M9QA 3WUVA 5KTBA 5B66E 1XTCC 3CWBG 4K35A 1M8OB 1NAFA 3CWBD 2IX7C 4NPFX 4I7ZB 4XFJA 1PPJG 5TISE 1U57A 2K88A 2W6AA 5TISH 3CWBJ 1JY3O 4HB1A 4D6TD 1JB0J 2LXCB 2OTKE 2BCCD 2Q9IA 3KDPB 1JY2N 3GMAA 1OVUA 3P7KA 4KHXA 2YIUC 1YHQP 1FZEA 1R5LA 2A45H 4N78E 3HUSB 4TT3H 3TK1A 3H1KJ 1SP4A 2FYNB 1URQA 3L4FA 1GDTA 1F4SP 3CX5D 4H0LC 2D2CB 3TSIA 2K1AA 4AQRD 2FFDB 3Q5RA 1J1DC 2YKPA 2KXPB 4LLHA 5KAFH 3MUDC 4HYTB 3CMEP 2WT7B 1OW6A 1LTBC 4JBZA 1NTME 1OX3A 1PL5A 2E74B 1N73A 1PV3A 3H1IE 2JP3A 1NTZD 1DEBA 2N9BA 1T8ZA 3N7NA 1QLED 5AVXB 3AE9C 3RK3E 5CCHC 2H88C 3AE5C 5AW9B 3NXSA 1J1DB 4BWNA 1IZNB 1SFCC 1EXJA 3L73J 1QL2A 2FYUK 2Q3IA 1JOCA 2WITA 4H0LB 3NFQA 2IYOA 3L70G 2QSIA 5CBOA 1DD3A 1IJDB 2ZVNB 4D6TE 1SQQK 3GLMA 3CMAP 2WVRA 1EDJA 2Q6QA 2WSEH 2JWAA 2P58A 1X79B 3CXHD 1KQFB 2NPSB 1A02F 2QJYC 3L73G 2LR2A 1H8AA 4AUWA 3AE2C 3PP5A 1VQNP 2IDBA 1T2KC 1NTKJ 2A06D 2JKVA 3LW5J 4IL6X 5K5GB 3H1HD 1K9MQ 3L75J 1FZCC 4I7ZC 4WY4C 3CC7P 1FZCA 3BATA 4JF7A 1SQXE 1RF0A 5TJHA 3L75E 1YJ9P 4M3LA 4H13B 4L73A 1W2BO 2W6JH 3E7KA 1IO4A 1JTHA 1LNQA 4UB6H 2YKOA 5B5EH 1SLQA 3V5BA 2R3CA 1QP9A 1YYCA 3ITKA 2Z5HA 1OXZA 3KZIH 2A45I 4U3FD 2FY8A 3RL0B 3VYIA 3L72J 2IZ1A 1KV4A 2FYUG 1LTSC 2FYUE 5B66H 3II6A 1IK7A 1OW7A 4DJGA 4ZKPA 4PV1C 1NTZG 4EIJA 1ZOYC 2KLVA 2WPRA 4QMAA 1HGZA 3TDKA 1BE3D 1AA0A 1SFCD 2KSEA 2WT7A 4RESB 4C7NA 1FDIA 2ZXEB 3JCUH 1N73B 3Q3DA 2ZFCA 3LIDA 3H1IJ 2POHA 1IFMA 2ER8A 5APYA 1NTMJ 2ITAA 2Z5IA 2C9NY 5KLVG 1GMJA 1GU4A 3KXDA 4W7ZA 1RQUA 2KS1B 2ZXXA 4OGQB 1L0LK 2L5GB 3BASA 1S2EA 3AEFC 2KSJA 2FKWB 1VQ5P 2HFED 1N7SA 4B86A 1J1EB 5KLVJ 1Q86Q 2CK3H 1E79H 2Q5UA 3CC2P 1FAVA 1P84H 3HD7C 4WB4A 2RKLA 3A2AA 3BVHA 2M0BA 3A0HE 1P84D 1QGKB 1GZLA 3L73E 1FZBA 1OWAA 5DJTB 1PPJD 5KAIE 4HH2A 3L72G 1E5WA 2P67A 2Y0EA 3A0HH 4UB6E 1JY2O 3QH9A 2WSEJ 2FYZA 1KB9D 1N86A 1NVOA 3L71G 3VMAA 2E74D 1LTGC 2IBZD 2J58A 2IYPA 3AE3C 3HE4A 3KZIE 1RE4A 2FXOA 1PFIA 1QL1A 1FU1A 1MZ9A 4L76A 1SQBG 2RN0A 1RE4C 2R5DA 3H1IG 1JY3N 3R2PA 1VQ4P 3D70A 1PP9J 2WSFH 1X0TA 1NTMG 2WPSA 2ERGA 2G8YA 1GL2C 2HG5D 2B87A 3B5ND 2M8RA 3S9OA 2KNCB 3CCSP 1M90Q 3Q5PA 3HE5A 1KQSO 1VQ8P 2WTYA 1K05A 2W27A 1DH3A 2P10A 4HJGH 3PLNA 2I8DA 3KPEA 2Y9ZA 1HVVA 2PAJA 1H89A 1GK4A 3L72E 1H88A 4WY4A 3CCLP 1YTZT 1SQVE 2M5AB 5APTA 5BU5A 3L35A 1GK6A 2QG4A 3I55P 3D6YA 1JCCA 5CCGC 3RL0D 1UIXA 1L0LG 1SQBE 2QJPC 4ASVA 3TF5A 4CPGA 1EC5A 3FGAD 1NTMD 1OVRA 3HD7B 1KYOD 1GL2D 3L71E 4Y28J 3RK3D 5APQA 2K9JB 4C7NB 2O01N 1L0LJ 1NHLA 2WWWA 1NTKG 1IFNA 2KOGA 4ZNCA 1NYHA 2GUVA 2XU6A 3GW6A 3FWNA 2R44A 5AW8B 3M91A 3VP8A 3CX5I 1FOSF 1OIPA 1KB9I 3V2QA 3W67A 2E43A 2ALCA 3L72D 4W7YA 2G3AA 1VQPP 3SFEC 3SSUA 1AVOA 2KZIA 5GTHH 1FZGA 2OYHC 1SQQJ 1PYIA 3TNUA 4NPDA 1BCCJ 3HE5B 1USEA 4OGQD 3MP7B 3GHGB 2WZ7A 2YO3A 4WY4D 5AVTB 5KAIH 3F5HA 4LGDE 3MGNA 1L0ND 2GM4A 3H1JE 1SQPK 2OGUA 1HUCA 3AEGC 1FZAA 2J5UA 2XNXA 3VMZA 1SQPD 1FJPA 3L37A 3B5NA 4Y99B 1SQPJ 3CXHI 1FJKA 1L0NK 1NTZE 3H1HJ 1IFPA 3L70J 2E76D 1BE3J 1RQVA 4AYCA 1YTZI 1L0NJ 2YNYA 2YXRB 1KB9H 4R4LA 5APXA 3T97A 3H1JJ 2XV5A 1G2CB 2B89A 2YKQA 3UIAA 1L4AA 2KUBA 4WY4B 2QM8A 3Q5SA 1VQOP 2N1TC 2N1TD 2OQQA 3H1LJ 3G71P 1LTTC 3S4RA 2M5AA 1IFJA 2GA1A 4PV1D 1L4AC 2AEFA 2YXQB 4U3FJ 5BVZA 1LWUB 1N2DC 2C0XA 3V4QA 5AW3B 5KLIB 2ZT9B 1G1IA 3IN6A 1DD4A 1G1JA 1VQ7P 2IZ0A 1BSNA 3H1LG 3MUDA 3V2NA 3L70E 1SQXG 2IPPA 2VRSA 2A06E 1FDMA 4YXDC 4A7PA 3AE1C 3USSA 1NTKK 3CI9A 1NTZK 1HJ0A 2K9JA 1L0LE 2RMZA 2QJYB 1BDCA 1PGQA 4OH8B 3Q1MA 2KI7B 1JY3P 1MV8A 1SFCB 3L75D 2OYIA 2XDJA 1SQPG 2ZYGA 4PD4I 5CJ4A 1SQVG 3VMXA 3M0DA 4YXWH 2D2CD 2A45G 1NAYA 2CPBA 1KZUB 2IFMA 2HR3A 2LXBA 1X8YA 2NZ2A 3HRNA 2ZJSE 1LTIC 2CPSA 3C1LA 5APVA 3V2RA 4D6TG 4Z1MH 5CCGD 1KILE 1SQQD 1VF5D 1LT9B 2N9YB 1KQGB 1ZXGA 3A0BH 4DOJA 5CCGA 5KLVK 1HH0A 3U1AA 1ZR2A 2B9BA 3L36A 3CCUP 1BGYJ 1KB9E 2J59M 3A0BE 1NU1J 1PGJA 3G6EP 2FYNC 2XNDH 1SQXJ 3C8VA 2AXCA 2HLOA 1ZN5A 2YIUB 1EZVI 1VPCA 3L71J 3V2PA 4BRYA 3K5BA 4YTPC 4C46A 1LWUA 4R4MA 3H32A 1P84I 1GW4A 1NO4A 5L8RJ 1TU3F 3VOPA 3G4SP 1S5LX 2ZT9C 3GHGA 1PP9D 3ABVC 5GTIE 1LWUC 5KLIC 1A02J 1DIPA 1YQ4C 1L4AB 2W8ZA 2WSFJ 3A3YB 3RK2D 3SWFA 1W5CE 2N1TB 2M3BA 1VDFA 5APUA 4H0LD 2H7HA 4GODA 1S72P 1LTJB 2FXMA 1AFOA 2NPSA 4D6TJ 3F89A 2BCCG 1DEEG 1M1JB 2E75B 1PPJE 3B71A 3M9BA 3EQ2A 1NU1D 3MZWB 1EXIA 2R5BA 2AEJA 3CWBE 2QEXP 4JYBA 3T97B 3CLQA 1FDOA 2ZAEB 1CI6B 4Y99C 1VF5B 2P7JA 1USDA 3B5NC 3H6PA 3NTNA 3U1CA 1AQ5A 1KILB 3AEAC 1HF9A 2V4HA 1JY2P 2BEZF 1ZRTD 2WSCH 3G9RA 3RK2B 3WUUA 5KLVE 1JCDA 1SQBD 1MFTA 4GKGA 2K37A 4DT0A 1ZMEC 1K04A 1N7SC 3BCCE 3HTKA 1BDDA 3AE6C 1JTHB 5KJ7D 1IK9A 4IL6E 1SQQG 1S4XA 2Q3EA 2KP8A 4H13D 2MJZA 4N78D 5CJ0A 1QX8A 3GG2A 1S5LE 1OW8A 4DCKA 3H1ID 1SQBK 2IBZI 2V7QH 4IL6H 4OWFA 1R8EA 1KTMA 3HE4B 3O6QB 1LP1A 1Q7YQ 1S5LH 1YITP 2ZYAA 1ZLLA 1AV1A 3EFFK 3H32B 4U7JA 2IBZG 5AVWB 3RK3B 1NJIQ 1JEKA 2JO1A 3KQGA 5GTHE 1VQKP 2KS1A 2AXTE 3MD0A 2LKMA 3HD7D 5AVZB 1M7LA 1NU1K 3CXHE 1BGYE 1DX7A 1N7SB 2N1TA 1SQVD 2Z4EA 3PJSK 2EREA 4IFMA 2E42A 3H1LD 2QJPB 2E76C 3A7OA 3KYQA 1Y9BA 3L75G 1CSBA 3MHVA 1KILC 3E1RA 3BCCD 1K8AQ 1QVGO 3H1JD 3IAOA 3SWKA 3Q2YA 1VF5C 3OA7A 1VQ6P 1EDLA 1S3JA 2OTJP 4YPCA 2JR8A 4JQ0D 3AEDC 2K9YA 1Q90D 5H2FE 5APSA 1YIJP 2H43A 1H0TA 1M1JC 1S1CX 2E75C 3FX0A 3QWOC 1VQ9P 3CCRP 3ALCA 1VQMP 5H2FH 2QJKC 2E75D 2MKVA 1W2EA 1ZR4A 3AE7C 2FBWC 3TGUD 1URQB 5EFWB 1Q2NA 4UB8H 1Z56A 2FYUD 3M06A 1SQVJ 1LTJA 3GF7A 4DZOA 3HUSA 4U3FE 4U3FG 5AVRB 1HBWA 4WWIA 5AVQB 2C0WA 2WSCJ 1AQTA 2W83C 3V6IA 1OZHA 3P8CD 3H1HG 1EQ7A 4JPZB 3PH0A 1CW5A 4RKUJ 5AW4B 2GUSA 1NGMB 2B88A 1L0NG 1SQXK 3O6QA
chains in the Genus database with same CATH topology
2BEQD 3H25A 3Q3DA 3Q1MA 2V7QJ 1MKMA 1WMKA 1GMJA 1RQUA 4OGQB 2QIWA 1YQ3C 2D2CD 3AEFC 3SFDC 3D71A 2NZ2A 4Z1MH 1KILE 1VF5D 3O6QA 3AE4C 1KQGB 1OMIA 4OGQC 1PIXA 1AJYA 1ZP0C 2FYNC 2WSEJ 3C8VA 2E74D 3AE3C 3EWKA 2ZT9D 2WPVB 1PYCA 4YTPC 4PV1B 4R4MA 5L8RJ 3AECC 3GF3A 1TU3F 4H44B 4KT0J 5KKZC 1S5LX 2ZT9C 3D70A 3ABVC 5KLIC 1DIPA 1YQ4C 2G8YA 3AE8C 2ERGA 2WSFJ 2WQYC 4H44D 4H13C 3D6ZA 3S9OA 4H0LD 4GDOA 1VL2A 3Q5PA 4XFJA 2FXPA 2E75B 3B71A 4I7ZB 1EXIA 1K05A 1U57A 3T97B 2P10A 1FDOA 1VF5B 4H44C 1JB0J 3AEAC 1HF9A 2BEZF 3G9RA 3GMAA 2YIUC 3D6YA 1ZMEC 4TT3H 1K04A 1UIXA 2YMKA 3AE6C 2QJPC 4H0LC 1F4SP 2D2CB 4H13D 3FGAD 3Q5RA 1OW8A 1D66A 4Y28J 1OW6A 1KTMA 1R8EA 1PL5A 2E74B 2H89C 1PV3A 2JP3A 3RK3E 4U7JA 1NYHA 3AE9C 2H88C 1AW6A 3AE5C 2JO1A 3AEBC 1EXJA 2E74C 4H0LB 3AEEC 2ALCA 2QSIA 1DD3A 2G3AA 3SFEC 3GLMA 1PYIA 2EREA 1ZRTE 1KMIZ 2D2CC 1KQFB 2E76C 3RL0g 1Y9BA 2QJYC 4OGQD 3IAOA 3AE2C 3Q2YA 1HWTC 1VF5C 2IDBA 1F5EP 3LW5J 4IL6X 3AEGC 2J5UA 3AEDC 2K9YA 1Q90D 2HAPC 4I7ZC 1S1CX 2E75C 3ALCA 2O01J 2QJKC 2E76D 1RQVA 2E75D 2MKVA 4H13B 3AE7C 2FBWC 4R4LA 1KORA 2ER8A 3Q5SA 3R4YA 1QP9A 2OQQA 5M1BA 4PV1D 3GF7A 2ZT9B 3IN6A 1DD4A 2WSCJ 1OW7A 1IK7A 4PV1C 1ZOYC 3COQA 2E76B 4YXDC 3AE1C 4RKUJ 1NGMB 1HJ0A 1FDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H25 A;  1F4S P;  2HAP C;  1WMK A;  3ALC A;  1D66 A;  2G8Y A;  2ERG A;  2ER8 A;  1AW6 A;  1QP9 A;  1OMI A;  2ALC A;  2P10 A;  1AJY A;  1FDO A;  1PYI A;  2ERE A;  3IN6 A;  1FDI A;  3COQ A;  3EWK A;  1HWT C;  1PYC A;  1ZME C;  1F5E P;  3O6Q A; 
#chains in the Genus database with same CATH topology
 3B4S A;  4IFF A;  2Q7C A;  2BEQ D;  2W90 A;  3H25 A;  4HKZ H;  1RY3 A;  3OW2 O;  2V7Q J;  1MKM A;  4NPE A;  1LT9 C;  2QVA A;  3U59 A;  1Q81 Q;  1FC2 C;  3CCE P;  1NTK D;  2PP6 A;  2OYI C;  2OYH A;  2QIW A;  4ZMD A;  2L91 A;  2KZJ A;  1CI6 A;  3C9I A;  1NOH A;  2QE7 H;  3PTZ A;  5KJ7 C;  4MN4 C;  1J1E C;  1IC2 A;  2KK7 A;  3H1K E;  4TLF A;  1N7S D;  4OVN F;  3CPW O;  1RHZ B;  1BCC E;  1OMI A;  4O9B A;  2O3J A;  4PJ0 H;  5AVY B;  4OGQ C;  1Y8A A;  1PIX A;  3M0A A;  1NU1 G;  3B8E B;  1AJY A;  3CL3 D;  1ZP0 C;  1JO5 A;  1EZV G;  2AXT H;  2Y0C A;  1NTZ J;  4UB8 E;  1L0L D;  1MUU A;  4K3A A;  3TYY A;  3L74 D;  5GTI H;  2WPV B;  1LP1 B;  3I56 P;  5DJU B;  3CCQ P;  1QVF O;  1IFI A;  1ZV8 A;  3V4W A;  2OYO A;  1PP9 E;  4PV1 B;  1QEX A;  3AEC C;  5E79 E;  1RF1 A;  4KT0 J;  4H44 B;  1NKN A;  5KKZ C;  2SPZ A;  3ZDM A;  4GIF A;  2E5Y A;  2WPQ A;  3AE8 C;  1OVV A;  5AVV B;  1YJW P;  3L74 G;  1EDK A;  2WQY C;  1SVF A;  1S9K E;  3CCJ P;  1YJN P;  1YBK A;  3D6Z A;  1KFN A;  1PZQ A;  4IOI H;  2BCC J;  5BU8 B;  4BXL A;  1EZV D;  1U7M A;  2I1J A;  1VL2 A;  3SWY A;  3FWL A;  1UII A;  3PRJ A;  4KJM A;  2FXP A;  2W6B A;  4EYY Q;  3IR9 A;  1JMB A;  1HJB A;  2YO2 A;  2WMM A;  1AVY A;  3I5C A;  1GU5 A;  5KKZ B;  3OAK A;  4H44 C;  5CCH A;  1FS0 E;  2QRX A;  3GHG C;  4EOT A;  1FZC B;  1NKZ B;  3LIE A;  3CCV P;  1SFC A;  1XTG B;  3VP9 A;  5AW5 B;  4LC1 A;  1PGP A;  2BCC E;  3PHL A;  4EDF A;  2C9L Y;  4PD4 E;  2OYH B;  1NTM K;  1HTL C;  2YMK A;  5KJ7 A;  2HPC B;  1ZW0 A;  3KHU A;  2NPS C;  3P32 A;  5AVU B;  3WUT A;  1GD2 E;  3EFG A;  3G3Z A;  1D66 A;  1T3J A;  2I1K A;  1EDI A;  3JSV C;  1PGO A;  2H89 C;  2P1J A;  2H8P D;  3BRT B;  1SQX D;  1X9V A;  2Q1K A;  4N3Y B;  3CXH H;  5CMZ A;  1FE6 A;  5AW6 B;  2OYI B;  1NU1 E;  1AW6 A;  1GTW A;  1BGY D;  2XZR A;  4GT1 A;  1JUN A;  3AEB C;  1BCC G;  2K3R A;  2E74 C;  5AW2 B;  3VMY A;  2Y9Y A;  3AEE C;  4GOE A;  2E5T A;  1IFD A;  1JM0 A;  3H1K G;  1SS1 A;  4WVZ A;  2PGD A;  5AVS B;  1M1K Q;  1KD1 Q;  5C39 A;  2FFD C;  2O1J A;  1ZRT E;  1KMI Z;  1LT9 A;  2D2C C;  5KLV D;  3RL0 g;  1FOS E;  3TGU G;  1X22 A;  3E1I A;  2KB7 P;  1N7L A;  3HUS C;  2NRG A;  2PFX A;  4PD4 D;  4PJ0 E;  4EI2 A;  3A5T A;  1OFC X;  1RE3 A;  2PRR A;  1HWT C;  3N4X A;  1F5E P;  1URQ D;  2KYV A;  1BE3 G;  1BE3 E;  3IFM A;  1KN7 A;  1L0N E;  1RE3 C;  3W68 A;  3CCM P;  2HAP C;  1LTA C;  2KNC A;  1CZQ A;  1RF0 C;  2DW3 A;  2JDI H;  2R32 A;  2Y0D A;  3H1H E;  5APW A;  1LT1 A;  1M1J A;  1SQP E;  2O01 J;  4W80 A;  4ASW A;  5AW0 B;  3S1K A;  4BRY B;  3TGU E;  4PD4 H;  5E79 H;  1NH4 A;  1MFZ A;  1KOR A;  2QJK B;  1GL2 B;  3FXD A;  1T6A A;  1L4A D;  1URQ C;  2AEM A;  3BCC J;  3FXE A;  5AW1 B;  3RGU A;  3RBX A;  2KLU A;  3R4Y A;  4RJT A;  1Q82 Q;  1K73 Q;  5M1B A;  2A06 G;  3IF4 A;  2HYN A;  2HOD A;  2FYU J;  5CCH D;  2M3E A;  3H1L E;  5B5E E;  1RF1 B;  1R5S A;  1FBM A;  3L73 D;  3VN0 A;  2HPC A;  1KFM A;  1VQL P;  2KIK A;  4I1L A;  1LGH B;  3TGU J;  3COQ A;  2E76 B;  1L2P A;  1GW3 A;  2B87 B;  3BRV B;  3L70 D;  2IBZ E;  1JNM A;  1J2J B;  4C7R A;  3RBZ A;  1H0T B;  4I2L C;  2JJL A;  3WMM 0;  1WMK A;  2XKM A;  3RK3 C;  2JWD A;  3CD6 P;  2BAS A;  3JCU E;  1LJ2 A;  3HTK B;  4ZKU A;  3H1K D;  2RH0 A;  2YMY A;  1YQ3 C;  3SFD C;  3D71 A;  2WSS H;  1JMM A;  1SQQ E;  1SQB J;  2NPS D;  2FFD A;  1BCC D;  3P8M C;  1RH5 B;  3HD7 A;  3H1J G;  4JYC A;  1BGY G;  1KYO I;  1KIL A;  1U7J A;  3BCC G;  1SQV K;  4L75 A;  4WBA A;  1T2K D;  3MTU E;  1YI2 P;  1KQL A;  3AE4 C;  3WU2 H;  4XE5 B;  1NWQ A;  1KIL D;  1FZF A;  5AW7 B;  1N73 C;  1Y47 A;  1BSH A;  1N8R Q;  3M9H A;  4I6M C;  3P8C E;  1P84 E;  3WU2 E;  2ZYD A;  3RK2 C;  1G2C A;  3L74 E;  5KAF E;  3NMD A;  4RO0 A;  5CBN A;  5CHX A;  3B5N B;  2R3S A;  3EWK A;  3O8Z A;  4GOF A;  1WRG A;  2ZT9 D;  1M57 D;  2HOD B;  2ZVO B;  2QA4 P;  3CC4 P;  2O1K A;  1PYC A;  1PP9 G;  3CX5 H;  2P2U A;  3GF3 A;  3OJA B;  3RL0 C;  3TNU B;  3VTP C;  1D7M A;  1NTK E;  1HGV A;  3LW5 H;  1KYO H;  4L74 A;  1GL2 A;  4XA4 A;  2O01 H;  1T3U A;  3MIW A;  1S9K D;  3M0D C;  3CX5 E;  3JC2 2;  1RF1 C;  4IFD K;  2OTL P;  2UWJ E;  2OAR A;  1LTJ C;  1EZV E;  1KYO E;  1WT6 A;  4H44 D;  1M56 D;  2JEE A;  3L71 D;  4H13 C;  1KC8 Q;  2IFN A;  2QM7 A;  3L74 J;  4GDO A;  4N6J A;  3M9Q A;  3WUV A;  5KTB A;  5B66 E;  1XTC C;  3CWB G;  4K35 A;  1M8O B;  1NAF A;  3CWB D;  2IX7 C;  4NPF X;  4I7Z B;  4XFJ A;  1PPJ G;  5TIS E;  1U57 A;  2K88 A;  2W6A A;  5TIS H;  3CWB J;  1JY3 O;  4HB1 A;  4D6T D;  1JB0 J;  2LXC B;  2OTK E;  2BCC D;  2Q9I A;  3KDP B;  1JY2 N;  3GMA A;  1OVU A;  3P7K A;  4KHX A;  2YIU C;  1YHQ P;  1FZE A;  1R5L A;  2A45 H;  4N78 E;  3HUS B;  4TT3 H;  3TK1 A;  3H1K J;  1SP4 A;  2FYN B;  1URQ A;  3L4F A;  1GDT A;  1F4S P;  3CX5 D;  4H0L C;  2D2C B;  3TSI A;  2K1A A;  4AQR D;  2FFD B;  3Q5R A;  1J1D C;  2YKP A;  2KXP B;  4LLH A;  5KAF H;  3MUD C;  4HYT B;  3CME P;  2WT7 B;  1OW6 A;  1LTB C;  4JBZ A;  1NTM E;  1OX3 A;  1PL5 A;  2E74 B;  1N73 A;  1PV3 A;  3H1I E;  2JP3 A;  1NTZ D;  1DEB A;  2N9B A;  1T8Z A;  3N7N A;  1QLE D;  5AVX B;  3AE9 C;  3RK3 E;  5CCH C;  2H88 C;  3AE5 C;  5AW9 B;  3NXS A;  1J1D B;  4BWN A;  1IZN B;  1SFC C;  1EXJ A;  3L73 J;  1QL2 A;  2FYU K;  2Q3I A;  1JOC A;  2WIT A;  4H0L B;  3NFQ A;  2IYO A;  3L70 G;  2QSI A;  5CBO A;  1DD3 A;  1IJD B;  2ZVN B;  4D6T E;  1SQQ K;  3GLM A;  3CMA P;  2WVR A;  1EDJ A;  2Q6Q A;  2WSE H;  2JWA A;  2P58 A;  1X79 B;  3CXH D;  1KQF B;  2NPS B;  1A02 F;  2QJY C;  3L73 G;  2LR2 A;  1H8A A;  4AUW A;  3AE2 C;  3PP5 A;  1VQN P;  2IDB A;  1T2K C;  1NTK J;  2A06 D;  2JKV A;  3LW5 J;  4IL6 X;  5K5G B;  3H1H D;  1K9M Q;  3L75 J;  1FZC C;  4I7Z C;  4WY4 C;  3CC7 P;  1FZC A;  3BAT A;  4JF7 A;  1SQX E;  1RF0 A;  5TJH A;  3L75 E;  1YJ9 P;  4M3L A;  4H13 B;  4L73 A;  1W2B O;  2W6J H;  3E7K A;  1IO4 A;  1JTH A;  1LNQ A;  4UB6 H;  2YKO A;  5B5E H;  1SLQ A;  3V5B A;  2R3C A;  1QP9 A;  1YYC A;  3ITK A;  2Z5H A;  1OXZ A;  3KZI H;  2A45 I;  4U3F D;  2FY8 A;  3RL0 B;  3VYI A;  3L72 J;  2IZ1 A;  1KV4 A;  2FYU G;  1LTS C;  2FYU E;  5B66 H;  3II6 A;  1IK7 A;  1OW7 A;  4DJG A;  4ZKP A;  4PV1 C;  1NTZ G;  4EIJ A;  1ZOY C;  2KLV A;  2WPR A;  4QMA A;  1HGZ A;  3TDK A;  1BE3 D;  1AA0 A;  1SFC D;  2KSE A;  2WT7 A;  4RES B;  4C7N A;  1FDI A;  2ZXE B;  3JCU H;  1N73 B;  3Q3D A;  2ZFC A;  3LID A;  3H1I J;  2POH A;  1IFM A;  2ER8 A;  5APY A;  1NTM J;  2ITA A;  2Z5I A;  2C9N Y;  5KLV G;  1GMJ A;  1GU4 A;  3KXD A;  4W7Z A;  1RQU A;  2KS1 B;  2ZXX A;  4OGQ B;  1L0L K;  2L5G B;  3BAS A;  1S2E A;  3AEF C;  2KSJ A;  2FKW B;  1VQ5 P;  2HFE D;  1N7S A;  4B86 A;  1J1E B;  5KLV J;  1Q86 Q;  2CK3 H;  1E79 H;  2Q5U A;  3CC2 P;  1FAV A;  1P84 H;  3HD7 C;  4WB4 A;  2RKL A;  3A2A A;  3BVH A;  2M0B A;  3A0H E;  1P84 D;  1QGK B;  1GZL A;  3L73 E;  1FZB A;  1OWA A;  5DJT B;  1PPJ D;  5KAI E;  4HH2 A;  3L72 G;  1E5W A;  2P67 A;  2Y0E A;  3A0H H;  4UB6 E;  1JY2 O;  3QH9 A;  2WSE J;  2FYZ A;  1KB9 D;  1N86 A;  1NVO A;  3L71 G;  3VMA A;  2E74 D;  1LTG C;  2IBZ D;  2J58 A;  2IYP A;  3AE3 C;  3HE4 A;  3KZI E;  1RE4 A;  2FXO A;  1PFI A;  1QL1 A;  1FU1 A;  1MZ9 A;  4L76 A;  1SQB G;  2RN0 A;  1RE4 C;  2R5D A;  3H1I G;  1JY3 N;  3R2P A;  1VQ4 P;  3D70 A;  1PP9 J;  2WSF H;  1X0T A;  1NTM G;  2WPS A;  2ERG A;  2G8Y A;  1GL2 C;  2HG5 D;  2B87 A;  3B5N D;  2M8R A;  3S9O A;  2KNC B;  3CCS P;  1M90 Q;  3Q5P A;  3HE5 A;  1KQS O;  1VQ8 P;  2WTY A;  1K05 A;  2W27 A;  1DH3 A;  2P10 A;  4HJG H;  3PLN A;  2I8D A;  3KPE A;  2Y9Z A;  1HVV A;  2PAJ A;  1H89 A;  1GK4 A;  3L72 E;  1H88 A;  4WY4 A;  3CCL P;  1YTZ T;  1SQV E;  2M5A B;  5APT A;  5BU5 A;  3L35 A;  1GK6 A;  2QG4 A;  3I55 P;  3D6Y A;  1JCC A;  5CCG C;  3RL0 D;  1UIX A;  1L0L G;  1SQB E;  2QJP C;  4ASV A;  3TF5 A;  4CPG A;  1EC5 A;  3FGA D;  1NTM D;  1OVR A;  3HD7 B;  1KYO D;  1GL2 D;  3L71 E;  4Y28 J;  3RK3 D;  5APQ A;  2K9J B;  4C7N B;  2O01 N;  1L0L J;  1NHL A;  2WWW A;  1NTK G;  1IFN A;  2KOG A;  4ZNC A;  1NYH A;  2GUV A;  2XU6 A;  3GW6 A;  3FWN A;  2R44 A;  5AW8 B;  3M91 A;  3VP8 A;  3CX5 I;  1FOS F;  1OIP A;  1KB9 I;  3V2Q A;  3W67 A;  2E43 A;  2ALC A;  3L72 D;  4W7Y A;  2G3A A;  1VQP P;  3SFE C;  3SSU A;  1AVO A;  2KZI A;  5GTH H;  1FZG A;  2OYH C;  1SQQ J;  1PYI A;  3TNU A;  4NPD A;  1BCC J;  3HE5 B;  1USE A;  4OGQ D;  3MP7 B;  3GHG B;  2WZ7 A;  2YO3 A;  4WY4 D;  5AVT B;  5KAI H;  3F5H A;  4LGD E;  3MGN A;  1L0N D;  2GM4 A;  3H1J E;  1SQP K;  2OGU A;  1HUC A;  3AEG C;  1FZA A;  2J5U A;  2XNX A;  3VMZ A;  1SQP D;  1FJP A;  3L37 A;  3B5N A;  4Y99 B;  1SQP J;  3CXH I;  1FJK A;  1L0N K;  1NTZ E;  3H1H J;  1IFP A;  3L70 J;  2E76 D;  1BE3 J;  1RQV A;  4AYC A;  1YTZ I;  1L0N J;  2YNY A;  2YXR B;  1KB9 H;  4R4L A;  5APX A;  3T97 A;  3H1J J;  2XV5 A;  1G2C B;  2B89 A;  2YKQ A;  3UIA A;  1L4A A;  2KUB A;  4WY4 B;  2QM8 A;  3Q5S A;  1VQO P;  2N1T C;  2N1T D;  2OQQ A;  3H1L J;  3G71 P;  1LTT C;  3S4R A;  2M5A A;  1IFJ A;  2GA1 A;  4PV1 D;  1L4A C;  2AEF A;  2YXQ B;  4U3F J;  5BVZ A;  1LWU B;  1N2D C;  2C0X A;  3V4Q A;  5AW3 B;  5KLI B;  2ZT9 B;  1G1I A;  3IN6 A;  1DD4 A;  1G1J A;  1VQ7 P;  2IZ0 A;  1BSN A;  3H1L G;  3MUD A;  3V2N A;  3L70 E;  1SQX G;  2IPP A;  2VRS A;  2A06 E;  1FDM A;  4YXD C;  4A7P A;  3AE1 C;  3USS A;  1NTK K;  3CI9 A;  1NTZ K;  1HJ0 A;  2K9J A;  1L0L E;  2RMZ A;  2QJY B;  1BDC A;  1PGQ A;  4OH8 B;  3Q1M A;  2KI7 B;  1JY3 P;  1MV8 A;  1SFC B;  3L75 D;  2OYI A;  2XDJ A;  1SQP G;  2ZYG A;  4PD4 I;  5CJ4 A;  1SQV G;  3VMX A;  3M0D A;  4YXW H;  2D2C D;  2A45 G;  1NAY A;  2CPB A;  1KZU B;  2IFM A;  2HR3 A;  2LXB A;  1X8Y A;  2NZ2 A;  3HRN A;  2ZJS E;  1LTI C;  2CPS A;  3C1L A;  5APV A;  3V2R A;  4D6T G;  4Z1M H;  5CCG D;  1KIL E;  1SQQ D;  1VF5 D;  1LT9 B;  2N9Y B;  1KQG B;  1ZXG A;  3A0B H;  4DOJ A;  5CCG A;  5KLV K;  1HH0 A;  3U1A A;  1ZR2 A;  2B9B A;  3L36 A;  3CCU P;  1BGY J;  1KB9 E;  2J59 M;  3A0B E;  1NU1 J;  1PGJ A;  3G6E P;  2FYN C;  2XND H;  1SQX J;  3C8V A;  2AXC A;  2HLO A;  1ZN5 A;  2YIU B;  1EZV I;  1VPC A;  3L71 J;  3V2P A;  4BRY A;  3K5B A;  4YTP C;  4C46 A;  1LWU A;  4R4M A;  3H32 A;  1P84 I;  1GW4 A;  1NO4 A;  5L8R J;  1TU3 F;  3VOP A;  3G4S P;  1S5L X;  2ZT9 C;  3GHG A;  1PP9 D;  3ABV C;  5GTI E;  1LWU C;  5KLI C;  1A02 J;  1DIP A;  1YQ4 C;  1L4A B;  2W8Z A;  2WSF J;  3A3Y B;  3RK2 D;  3SWF A;  1W5C E;  2N1T B;  2M3B A;  1VDF A;  5APU A;  4H0L D;  2H7H A;  4GOD A;  1S72 P;  1LTJ B;  2FXM A;  1AFO A;  2NPS A;  4D6T J;  3F89 A;  2BCC G;  1DEE G;  1M1J B;  2E75 B;  1PPJ E;  3B71 A;  3M9B A;  3EQ2 A;  1NU1 D;  3MZW B;  1EXI A;  2R5B A;  2AEJ A;  3CWB E;  2QEX P;  4JYB A;  3T97 B;  3CLQ A;  1FDO A;  2ZAE B;  1CI6 B;  4Y99 C;  1VF5 B;  2P7J A;  1USD A;  3B5N C;  3H6P A;  3NTN A;  3U1C A;  1AQ5 A;  1KIL B;  3AEA C;  1HF9 A;  2V4H A;  1JY2 P;  2BEZ F;  1ZRT D;  2WSC H;  3G9R A;  3RK2 B;  3WUU A;  5KLV E;  1JCD A;  1SQB D;  1MFT A;  4GKG A;  2K37 A;  4DT0 A;  1ZME C;  1K04 A;  1N7S C;  3BCC E;  3HTK A;  1BDD A;  3AE6 C;  1JTH B;  5KJ7 D;  1IK9 A;  4IL6 E;  1SQQ G;  1S4X A;  2Q3E A;  2KP8 A;  4H13 D;  2MJZ A;  4N78 D;  5CJ0 A;  1QX8 A;  3GG2 A;  1S5L E;  1OW8 A;  4DCK A;  3H1I D;  1SQB K;  2IBZ I;  2V7Q H;  4IL6 H;  4OWF A;  1R8E A;  1KTM A;  3HE4 B;  3O6Q B;  1LP1 A;  1Q7Y Q;  1S5L H;  1YIT P;  2ZYA A;  1ZLL A;  1AV1 A;  3EFF K;  3H32 B;  4U7J A;  2IBZ G;  5AVW B;  3RK3 B;  1NJI Q;  1JEK A;  2JO1 A;  3KQG A;  5GTH E;  1VQK P;  2KS1 A;  2AXT E;  3MD0 A;  2LKM A;  3HD7 D;  5AVZ B;  1M7L A;  1NU1 K;  3CXH E;  1BGY E;  1DX7 A;  1N7S B;  2N1T A;  1SQV D;  2Z4E A;  3PJS K;  2ERE A;  4IFM A;  2E42 A;  3H1L D;  2QJP B;  2E76 C;  3A7O A;  3KYQ A;  1Y9B A;  3L75 G;  1CSB A;  3MHV A;  1KIL C;  3E1R A;  3BCC D;  1K8A Q;  1QVG O;  3H1J D;  3IAO A;  3SWK A;  3Q2Y A;  1VF5 C;  3OA7 A;  1VQ6 P;  1EDL A;  1S3J A;  2OTJ P;  4YPC A;  2JR8 A;  4JQ0 D;  3AED C;  2K9Y A;  1Q90 D;  5H2F E;  5APS A;  1YIJ P;  2H43 A;  1H0T A;  1M1J C;  1S1C X;  2E75 C;  3FX0 A;  3QWO C;  1VQ9 P;  3CCR P;  3ALC A;  1VQM P;  5H2F H;  2QJK C;  2E75 D;  2MKV A;  1W2E A;  1ZR4 A;  3AE7 C;  2FBW C;  3TGU D;  1URQ B;  5EFW B;  1Q2N A;  4UB8 H;  1Z56 A;  2FYU D;  3M06 A;  1SQV J;  1LTJ A;  3GF7 A;  4DZO A;  3HUS A;  4U3F E;  4U3F G;  5AVR B;  1HBW A;  4WWI A;  5AVQ B;  2C0W A;  2WSC J;  1AQT A;  2W83 C;  3V6I A;  1OZH A;  3P8C D;  3H1H G;  1EQ7 A;  4JPZ B;  3PH0 A;  1CW5 A;  4RKU J;  5AW4 B;  2GUS A;  1NGM B;  2B88 A;  1L0N G;  1SQX K;  3O6Q A; 
#chains in the Genus database with same CATH homology
 2BEQ D;  3H25 A;  3Q3D A;  3Q1M A;  2V7Q J;  1MKM A;  1WMK A;  1GMJ A;  1RQU A;  4OGQ B;  2QIW A;  1YQ3 C;  2D2C D;  3AEF C;  3SFD C;  3D71 A;  2NZ2 A;  4Z1M H;  1KIL E;  1VF5 D;  3O6Q A;  3AE4 C;  1KQG B;  1OMI A;  4OGQ C;  1PIX A;  1AJY A;  1ZP0 C;  2FYN C;  2WSE J;  3C8V A;  2E74 D;  3AE3 C;  3EWK A;  2ZT9 D;  2WPV B;  1PYC A;  4YTP C;  4PV1 B;  4R4M A;  5L8R J;  3AEC C;  3GF3 A;  1TU3 F;  4H44 B;  4KT0 J;  5KKZ C;  1S5L X;  2ZT9 C;  3D70 A;  3ABV C;  5KLI C;  1DIP A;  1YQ4 C;  2G8Y A;  3AE8 C;  2ERG A;  2WSF J;  2WQY C;  4H44 D;  4H13 C;  3D6Z A;  3S9O A;  4H0L D;  4GDO A;  1VL2 A;  3Q5P A;  4XFJ A;  2FXP A;  2E75 B;  3B71 A;  4I7Z B;  1EXI A;  1K05 A;  1U57 A;  3T97 B;  2P10 A;  1FDO A;  1VF5 B;  4H44 C;  1JB0 J;  3AEA C;  1HF9 A;  2BEZ F;  3G9R A;  3GMA A;  2YIU C;  3D6Y A;  1ZME C;  4TT3 H;  1K04 A;  1UIX A;  2YMK A;  3AE6 C;  2QJP C;  4H0L C;  1F4S P;  2D2C B;  4H13 D;  3FGA D;  3Q5R A;  1OW8 A;  1D66 A;  4Y28 J;  1OW6 A;  1KTM A;  1R8E A;  1PL5 A;  2E74 B;  2H89 C;  1PV3 A;  2JP3 A;  3RK3 E;  4U7J A;  1NYH A;  3AE9 C;  2H88 C;  1AW6 A;  3AE5 C;  2JO1 A;  3AEB C;  1EXJ A;  2E74 C;  4H0L B;  3AEE C;  2ALC A;  2QSI A;  1DD3 A;  2G3A A;  3SFE C;  3GLM A;  1PYI A;  2ERE A;  1ZRT E;  1KMI Z;  2D2C C;  1KQF B;  2E76 C;  3RL0 g;  1Y9B A;  2QJY C;  4OGQ D;  3IAO A;  3AE2 C;  3Q2Y A;  1HWT C;  1VF5 C;  2IDB A;  1F5E P;  3LW5 J;  4IL6 X;  3AEG C;  2J5U A;  3AED C;  2K9Y A;  1Q90 D;  2HAP C;  4I7Z C;  1S1C X;  2E75 C;  3ALC A;  2O01 J;  2QJK C;  2E76 D;  1RQV A;  2E75 D;  2MKV A;  4H13 B;  3AE7 C;  2FBW C;  4R4L A;  1KOR A;  2ER8 A;  3Q5S A;  3R4Y A;  1QP9 A;  2OQQ A;  5M1B A;  4PV1 D;  3GF7 A;  2ZT9 B;  3IN6 A;  1DD4 A;  2WSC J;  1OW7 A;  1IK7 A;  4PV1 C;  1ZOY C;  3COQ A;  2E76 B;  4YXD C;  3AE1 C;  4RKU J;  1NGM B;  1HJ0 A;  1FDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...