1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
1F4SP 1WMKA 1FDIA 2HAPC 2ERGA 2ER8A 1OMIA 1HWTC 3EWKA 3ALCA 3O6QA 1FDOA 1AW6A 1PYIA 1QP9A 1ZMEC 3H25A 2G8YA 1D66A 1AJYA 3COQA 2P10A 2ALCA 1F5EP 1PYCA 2EREA 3IN6A
chains in the Genus database with same CATH superfamily
1LTSC 1KTMA 1FOSE 3AEEC 3MD0A 1SQPG 4YPCA 4RJTA 4HYTB 3RL0C 2P67A 4H13B 3RL0B 3HD7A 4WY4D 2W90A 1CI6B 3HUSC 1BE3J 2L91A 2KS1A 5CHXA 2R44A 4EIJA 2FXMA 1VQNP 1SQVJ 2WMMA 4BRYA 3KPEA 5KJ7A 2WSCH 4C46A 4YXWH 5CCHD 4OGQD 1S9KE 1PGOA 2XKMA 1BE3E 1OXZA 1KC8Q 1Q2NA 2C0XA 1L0NK 1NU1J 2JEEA 1PL5A 3VMAA 2C0WA 2E74C 1RE3C 3TGUJ 1IFIA 2O1KA 1X0TA 2N1TC 1GW3A 2E74B 1SQVE 5AVUB 1EDKA 2YKOA 2IBZE 2V4HA 1M90Q 1HBWA 3HRNA 1M56D 1S3JA 2YKPA 3L74J 4KHXA 3A7OA 4JYCA 2Z4EA 1L2PA 2LXCB 4MN4C 3VP9A 1NTMD 2CPBA 1NU1E 3TK1A 1LJ2A 3TGUE 3HE4A 1K9MQ 4IL6X 2E5YA 1E79H 3NXSA 1JY2O 1LT9B 4WB4A 2ZYDA 2KB7P 3NMDA 3QH9A 3TF5A 1PP9J 3L74E 3WU2H 1G1JA 1G2CB 1RHZB 1URQB 4OVNF 1M1JC 4CPGA 5GTIH 3BRVB 2RKLA 1M1JB 3PJSK 2JDIH 2AEJA 2I1KA 3MP7B 2Q5UA 3P8MC 4WY4C 2O01N 2M8RA 2K1AA 2ZT9D 1KN7A 1AQTA 1SQQG 3BRTB 3OJAB 2QJYB 1PP9E 1QEXA 5CCGA 3V5BA 1FU1A 1LTJA 2P10A 2YIUC 5CCHC 4NPDA 3GMAA 2YIUB 4IFFA 3CC7P 3H1LG 1M1KQ 4H44D 3L71J 1BGYG 1JTHA 1OW7A 1IFMA 3C9IA 2FKWB 2Y9YA 2G8YA 1RE4C 1X8YA 2NZ2A 1WRGA 4JQ0D 1Q82Q 1K8AQ 3I56P 2O01H 2G3AA 3VMYA 2FYUG 4U3FG 3U59A 4EOTA 3WUUA 1NHLA 4NPEA 5APSA 1DD4A 3KYQA 2KLVA 3G71P 3L71E 1SQPJ 3RBZA 2B87A 4U3FD 2GUVA 1SFCB 2XU6A 3SSUA 2YO3A 4L73A 2N9YB 2M5AA 1FZGA 4HH2A 2PFXA 3A3YB 2W6JH 1Y47A 2K9JB 2J59M 2R3CA 1Y9BA 1USDA 4DZOA 1L0NJ 1SQPE 1SQBG 3V6IA 2C9LY 1T8ZA 1AJYA 4TLFA 4D6TG 3W67A 3Q5RA 2E76C 2D2CC 2WQYC 3PTZA 2E76B 2D2CB 1QLED 1ZR4A 1KYOH 4UB8E 3U1AA 1SQBD 3EWKA 2NPSD 3LIEA 4D6TD 3CCSP 3FXDA 1K73Q 5BVZA 1FAVA 1L4AC 1NOHA 1L0NE 5AW7B 1L4AB 3CWBJ 1OVUA 4ZNCA 3L4FA 1JCDA 1OWAA 3B5NA 3PHLA 1N7SC 1CZQA 1KQLA 3FWNA 2WT7B 3HTKB 4NPFX 1N7SB 3Q1MA 4IOIH 5AVWB 3MZWB 5AW2B 3EQ2A 3K5BA 2MJZA 4LGDE 1NTKK 2FBWC 2IFNA 5AVSB 2POHA 5APYA 3RL0g 1IK7A 3TNUB 1BE3G 2YXQB 1PIXA 1S2EA 3CWBE 4C7NA 3A0BE 3IFMA 1S9KD 1SQVG 1NTZJ 1AVOA 1EXIA 1Q86Q 2IBZG 3MGNA 3SWYA 1KILA 1N73B 2HYNA 1BE3D 1FDMA 2P58A 2WSEJ 4XFJA 5APWA 3O8ZA 3PH0A 3H1JJ 2AXCA 4DT0A 2YNYA 1PPJD 3D70A 2QM8A 3RK2C 2HAPC 1NU1G 3P7KA 5TISE 1LTTC 1H0TB 3KDPB 1FS0E 3V2RA 2QSIA 1NTZE 3F89A 3M0DA 2R5DA 5AVYB 3V2PA 3Q2YA 2P1JA 1HVVA 1RY3A 2JP3A 3P8CE 3TGUD 2ZYAA 3L74G 2CK3H 3H1JE 1MZ9A 4IL6H 3BCCJ 1KB9D 3TYYA 4H13D 1SQQE 2RMZA 3RL0D 4W7YA 1ZRTE 1RH5B 4XE5B 1KQFB 2FY8A 4L75A 1F5EP 3L74D 1IZNB 2J5UA 1BGYE 2H7HA 2HODB 1VQ5P 1RF1C 3MUDA 3L75J 4R4LA 3CCVP 1QVGO 2IPPA 3GHGC 1DEBA 1VQ9P 1R5LA 3BCCE 2QRXA 2WPQA 2HFED 4WBAA 1QL1A 1IFPA 3BASA 1PP9D 3FGAD 1DX7A 2FYNC 2E74D 3C1LA 2HPCA 1D7MA 1NAYA 1VF5B 1P84I 2K9YA 2W8ZA 4H0LB 3AE3C 3LIDA 2GM4A 3H32B 3L75E 2KS1B 3L73J 4HJGH 1HJ0A 2WSFJ 3CMEP 4AUWA 1SQXK 3CCMP 1JMBA 3L35A 4BRYB 3L71G 1BSNA 5CJ0A 2ZJSE 4KT0J 4LLHA 3JC22 2AEFA 4PV1C 4YXDC 1HWTC 2NPSA 1N86A 1NWQA 4I7ZB 4PV1B 3VOPA 1BDCA 5KLVK 3L71D 2R32A 2BCCJ 1NTKJ 2SPZA 1JY2N 3L73E 4I1LA 1U57A 2KNCB 2PRRA 1GTWA 1HJBA 3AEFC 1URQD 2WZ7A 1Q81Q 2QJPC 1NH4A 5KTBA 1FOSF 4H13C 4W7ZA 2QJPB 1KORA 2A06E 5KLIC 1LWUA 5KLIB 3SFDC 2QJKB 2EREA 2OTKE 5APVA 1NTKE 1SQPD 2WTYA 2FXOA 3WUVA 1YBKA 2OYOA 2OYHA 3HE4B 4JBZA 1MFTA 2YMYA 5AW1B 1SVFA 1Y8AA 4M3LA 3RBXA 2XNDH 3GW6A 1L0NG 3L72J 4GOFA 5C39A 1PYCA 1RQUA 1FDIA 1S1CX 3CCEP 1VQ7P 3H1KJ 4IL6E 2KI7B 2MKVA 1ZR2A 2PAJA 5B5EE 1GDTA 3G4SP 1L0ND 1S5LX 1GL2A 1LTGC 1RQVA 2WWWA 2KK7A 5KAIE 3L72E 4DOJA 2FFDA 3V2QA 3CWBG 2JWDA 3A5TA 4AYCA 3S9OA 3KQGA 3FWLA 1SFCD 3H1KE 1LTJB 1F4SP 1FZBA 3AE4C 2LXBA 3M9BA 1GU4A 4OH8B 3O6QA 4UB8H 5GTHE 3CWBD 1AW6A 1LT9C 1OW6A 4BXLA 1NTMK 3N7NA 3HUSA 4PD4I 2W27A 1URQC 2O3JA 2ZXXA 1OVVA 1PGPA 4JPZB 2JWAA 2JJLA 4L76A 1NTZG 2Q1KA 1LTBC 1PV3A 1J1EC 4JYBA 4ASVA 2E76D 3CXHI 2D2CD 1AV1A 1J1EB 4ZKUA 3H1JG 1PFIA 3ALCA 1NTZD 3CX5I 2H43A 1PGJA 2QJYC 3S1KA 2M5AB 2K88A 3H25A 2LR2A 1D66A 1RE3A 2N1TA 2Y0DA 4XA4A 3P8CD 3SWFA 3A0BH 1L4AD 2JR8A 3H1JD 1YI2P 2B9BA 1GU5A 1E5WA 5KLVJ 1LNQA 5BU8B 1QGKB 1SQQD 1ZRTD 3L70J 1N7SD 1NGMB 1FJPA 3M91A 4R4MA 2JKVA 3CC4P 3CL3D 1IFDA 5AVZB 2GA1A 3WUTA 3BCCG 3H1LD 5KAFE 2FYZA 1BGYD 5TISH 1S72P 2M0BA 3RK3C 1N7LA 3FX0A 1ZN5A 1AFOA 3RK3B 4GOEA 1MKMA 1SFCC 5KLVE 2FYUD 5AW9B 4WVZA 1G2CA 1KYOD 2A45I 2WSEH 3L70E 3AEBC 3B8EB 2P7JA 1OW8A 3L75G 5E79E 2AXTH 1M1JA 3B5NB 1YQ4C 2YKQA 1NAFA 2WVRA 4EYYQ 3COQA 4WY4A 1FZCA 3A0HE 1J1DB 3L75D 2QIWA 3RK2D 1AA0A 1IFNA 4PD4E 1T3JA 1EZVI 3ITKA 4EI2A 3LW5J 2QVAA 1FJKA 3L73G 3H1HJ 1VQOP 5CCHA 1QL2A 4C7NB 2ALCA 3AE8C 1VQPP 3VMZA 2Q3EA 4RKUJ 1KILB 3AE2C 3CXHE 5AVVB 1RE4A 2A06G 3CX5E 4Z1MH 1A02J 2B88A 5AW5B 1SQBK 2BCCG 1NTKG 3PRJA 1K04A 5KKZB 2XZRA 1LGHB 2Q3IA 3H1HE 4K35A 3R4YA 4EDFA 2OYIA 1NTMJ 1T3UA 3RK3E 5K5GB 5L8RJ 4GKGA 2DW3A 3D71A 2IDBA 3KHUA 5AW8B 1RF0C 3OA7A 2KYVA 2C9NY 2K9JA 3P32A 3HE5A 1VF5D 3I55P 4H0LD 1M7LA 3L36A 1U7MA 1N73C 3E1RA 2WSFH 3F5HA 2OARA 1U7JA 2XDJA 1Q7YQ 3L72G 3MUDC 3CD6P 1VQLP 1FZFA 5KJ7D 1S5LH 2XV5A 1SQVD 3H1KG 2IBZD 1NVOA 3D6ZA 4BWNA 1T6AA 1LP1A 5BU5A 3L72D 4PV1D 1KILE 3UIAA 4IFMA 2ZVOB 1JY3O 3H1KD 1YTZI 1L4AA 4TT3H 1EZVE 1FZEA 2HPCB 1NU1D 2YXRB 5AW3B 4ASWA 3ABVC 2JO1A 2AXTE 2RN0A 3HTKA 1EDLA 1OX3A 3II6A 1DH3A 5B5EH 2PP6A 2J58A 1W5CE 2KSJA 2H89C 3AEDC 1VDFA 5KAIH 3TNUA 3AE1C 3TSIA 1EQ7A 3A2AA 1P84H 2BASA 2ZYGA 5APQA 3G3ZA 2WITA 3IF4A 3Q5PA 3TDKA 1ZP0C 1HUCA 1T2KD 3WMM0 1EXJA 3N4XA 2M3BA 5GTHH 4A7PA 5M1BA 1YIJP 1VF5C 3HD7C 4H0LC 3HD7B 3CCRP 1H0TA 1KFNA 1YJWP 3QWOC 1NO4A 3V2NA 5CBOA 1R5SA 3AE7C 2ZVNB 2HLOA 3W68A 4N78E 5KJ7C 2W6BA 5KLVG 3G9RA 2V7QH 1BCCJ 2Y0CA 3L70G 1KMIZ 1HTLC 4I7ZC 3C8VA 2Z5IA 1N8RQ 2IFMA 2WPSA 3Q3DA 1GL2C 3H1IJ 3L70D 2H8PD 4Y28J 1GL2B 2Y9ZA 3ZDMA 1KB9I 1JNMA 1L0LK 3NTNA 4WWIA 1IK9A 4Y99B 2R3SA 1RF1A 3E7KA 1BCCE 3IR9A 2KLUA 1X9VA 1S5LE 1GD2E 1BDDA 3GHGA 1VQMP 2QJKC 3BVHA 2QM7A 3PLNA 4B86A 2B89A 4O9BA 1GMJA 2QEXP 1WMKA 5KAFH 1JCCA 2BCCE 4PD4D 3VYIA 1JEKA 4N6JA 3RGUA 3H1IE 2R5BA 1FZAA 3OAKA 2XNXA 3AEGC 3G6EP 3O6QB 2L5GB 2ITAA 1JY3P 3H32A 1SQPK 4QMAA 1HGZA 3HUSB 2BEZF 4LC1A 3T97A 1JUNA 1T2KC 3CXHD 1OIPA 5E79H 4UB6H 3H1HG 4PJ0E 2Q9IA 1ZXGA 2WSSH 3CC2P 2Y0EA 2W83C 4K3AA 3CX5D 2E75C 4C7RA 1LT1A 3A0HH 2E75B 3KZIE 3MHVA 1KQGB 3JCUE 3H1HD 2N9BA 2P2UA 2IYPA 4PD4H 3RK3D 1P84E 5CCGC 1YQ3C 2I1JA 4RO0A 2KNCA 1LTJC 1KV4A 2E5TA 2N1TB 1PPJE 1ZOYC 1NTMG 2V7QJ 2WPVB 3B5ND 1GK4A 1NYHA 2K37A 2A45G 3CXHH 1JTHB 2FXPA 1VL2A 1CI6A 1YTZT 3M9HA 1HGVA 3PP5A 5CJ4A 3CX5H 1VPCA 5EFWB 3U1CA 3LW5H 3MTUE 1OMIA 1G1IA 2GUSA 1PYIA 2RH0A 1KB9E 3CCUP 5AW0B 1OFCX 3B71A 2HR3A 4RESB 1EZVG 1TU3F 2B87B 3VMXA 1ZV8A 3AEAC 5B66E 1GW4A 2OGUA 1KILD 2KIKA 3CLQA 4YTPC 1SQXJ 2LKMA 5CBNA 1ZMEC 1JO5A 5CMZA 2KXPB 1YJ9P 1FZCC 1EZVD 4WY4B 1FZCB 1OVRA 2M3EA 2I8DA 1NTZK 1SS1A 5H2FE 1KD1Q 3OW2O 2A45H 1M57D 2KZJA 2ZFCA 1QX8A 1SQXE 2OTLP 3M9QA 4OGQC 1L0LJ 2WSCJ 3E1IA 4OGQB 1HF9A 1SQQK 2Q6QA 5APUA 1VQ6P 1LT9A 1VQ8P 1W2BO 1W2EA 3AE6C 1USEA 4GT1A 1N2DC 3BCCD 1Z56A 1ZW0A 1YITP 2QG4A 1URQA 2IZ0A 3B5NC 4UB6E 5AW4B 2OYIC 1CW5A 1L0LE 1JB0J 2FYUK 2OYIB 1AQ5A 1J1DC 2E43A 5APTA 1FC2C 1Q90D 3EFFK 4N78D 1IO4A 3JSVC 1JY3N 2IZ1A 2IYOA 2CPSA 3HE5B 2W6AA 3CCLP 1VQKP 3D6YA 1KILC 5AW6B 4KJMA 3AE9C 1QVFO 3NFQA 1K05A 2KOGA 1BCCG 2ZXEB 1CSBA 3L73D 2UWJE 2WPRA 1H88A 4OWFA 5KKZC 4DCKA 2ZT9C 4ZMDA 1FE6A 3H1IG 1BCCD 2KZIA 1LP1B 2ZT9B 1R8EA 1VQ4P 2QA4P 3FXEA 2A06D 2BEQD 3M0DC 2O1JA 1YHQP 1PGQA 1J2JB 1SFCA 1DEEG 1HH0A 1JY2P 1WT6A 1AVYA 1NTKD 2BCCD 4H44C 3WU2E 3GG2A 3H1ID 2NRGA 4H44B 5GTIE 4L74A 4N3YB 1KYOI 2QE7H 1A02F 5TJHA 1NJIQ 1M8OB 2AEMA 3HD7D 5APXA 1DIPA 1NTME 3MIWA 2O01J 2H88C 3M0AA 5AVXB 1DD3A 4W80A 3AE5C 4AQRD 1QP9A 1MFZA 1KQSO 3M06A 3SWKA 3VN0A 1PPJG 1H89A 3CMAP 4JF7A 1P84D 4HB1A 1FDOA 4I2LC 1JM0A 1SQVK 2PGDA 1EDIA 3V4QA 3I5CA 1GL2D 1SQQJ 1KZUB 1S4XA 1OZHA 3KXDA 2E42A 3GF7A 3TGUG 3RK2B 2WT7A 1LTAC 1N7SA 4PJ0H 3H1LJ 3V4WA 2HG5D 3BATA 1BGYJ 1NU1K 1H8AA 2YMKA 3B4SA 1GZLA 3IN6A 5AVTB 1FBMA 2KSEA 3KZIH 3SFEC 3JCUH 2NPSC 1PZQA 2KP8A 1RF0A 2FYUJ 4U3FJ 3GF3A 1NKNA 2NPSB 3CCJP 1X79B 3CI9A 1BSHA 2OTJP 4I6MC 1SLQA 3Q5SA 4GDOA 1N73A 3L37A 3H1LE 4U7JA 1JMMA 2ERGA 1X22A 3CCQP 5AVRB 1PP9G 5AVQB 3VP8A 1RF1B 1IC2A 2E75D 1SQXG 1LWUC 3GHGB 2FYUE 3EFGA 4U3FE 1KFMA 4GIFA 1KYOE 3AECC 1LWUB 1UIIA 2Z5HA 1YJNP 2OYHC 2VRSA 4GODA 2OQQA 2IBZI 2OYHB 1JOCA 1KB9H 1SQXD 1GK6A 5CCGD 2N1TD 1MUUA 2FYNB 1SQBJ 1MV8A 2YO2A 3IAOA 1XTCC 1EDJA 1XTGB 4D6TJ 3R2PA 2Q7CA 5B66H 3T97B 2ER8A 1UIXA 3CPWO 1LTIC 2KUBA 1L0LG 4ZKPA 1YYCA 3USSA 5KLVD 4IFDK 1EC5A 3H6PA 2ZAEB 5DJTB 1IFJA 1ZLLA 4Y99C 5H2FH 2HODA 4HKZH 2IX7C 1L0LD 1SQBE 2FFDC 4D6TE 2FFDB 1SP4A 4DJGA 5DJUB 3GLMA 3S4RA 1IJDB 1NKZB 3VTPC 2K3RA
chains in the Genus database with same CATH topology
2BEZF 4GDOA 1KTMA 4KT0J 3AEAC 4U7JA 3D6ZA 2ERGA 2O01J 1Q90D 2H88C 3AEEC 4PV1C 4YXDC 4YTPC 4RKUJ 1HWTC 4PV1D 3AE7C 1KILE 1DD3A 3AE2C 4I7ZB 4PV1B 4IL6X 3AE5C 1DD4A 4H13D 1QP9A 1NGMB 1ZMEC 3Q1MA 1ZRTE 4H13B 4R4MA 3S9OA 2E75C 3G9RA 1KQFB 2E75D 4TT3H 2FBWC 1U57A 4Z1MH 1F5EP 2E75B 2J5UA 3D6YA 1F4SP 1KMIZ 1KQGB 3AE4C 3AEFC 3AECC 3ABVC 2JO1A 2QJPC 4I7ZC 3RL0g 1IK7A 1K04A 3O6QA 3C8VA 3AE9C 1FDOA 4H13C 3R4YA 1AW6A 1PIXA 1K05A 2OQQA 1KORA 3RK3E 1YQ3C 1OW6A 4R4LA 1MKMA 5KLIC 3Q3DA 4OGQC 3IAOA 5L8RJ 4Y28J 3SFDC 2EREA 1ZOYC 4OGQD 1EXIA 1Y9BA 3AEBC 2H89C 2WSCJ 3AEDC 4OGQB 1HF9A 3GF7A 5KKZC 2ZT9C 1OW8A 3T97B 3D71A 2IDBA 2V7QJ 2ER8A 2WPVB 2ZT9D 3AE1C 1UIXA 2WSEJ 4XFJA 1R8EA 2ZT9B 1NYHA 1YQ4C 2BEQD 2FXPA 3FGAD 1PL5A 1VL2A 1AJYA 2E74C 3AE6C 3COQA 2FYNC 2E74D 1VF5D 1PV3A 3Q5RA 2E76C 2QJKC 2D2CC 3Q5PA 2E74B 2P10A 2YIUC 1VF5B 2YMKA 4H0LD 2E76D 3D70A 2D2CD 1PYCA 2K9YA 1GMJA 2WQYC 1RQUA 3IN6A 2E76B 4H0LB 2D2CB 4H44C 2QIWA 1WMKA 1ZP0C 1FDIA 1S1CX 3AE3C 3GMAA 2HAPC 4H44D 3SFEC 1OMIA 1EXJA 4H44B 3EWKA 3ALCA 1OW7A 1HJ0A 2MKVA 2QJYC 2WSFJ 3GF3A 3AEGC 1PYIA 2QSIA 3LW5J 3H25A 2G8YA 1D66A 5M1BA 1JB0J 1DIPA 2NZ2A 1VF5C 3Q2YA 3B71A 1S5LX 2G3AA 4H0LC 3Q5SA 2ALCA 3GLMA 2JP3A 3AE8C 1RQVA 1TU3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4S P;  1WMK A;  1FDI A;  2HAP C;  2ERG A;  2ER8 A;  1OMI A;  1HWT C;  3EWK A;  3ALC A;  3O6Q A;  1FDO A;  1AW6 A;  1PYI A;  1QP9 A;  1ZME C;  3H25 A;  2G8Y A;  1D66 A;  1AJY A;  3COQ A;  2P10 A;  2ALC A;  1F5E P;  1PYC A;  2ERE A;  3IN6 A; 
#chains in the Genus database with same CATH topology
 1LTS C;  1KTM A;  1FOS E;  3AEE C;  3MD0 A;  1SQP G;  4YPC A;  4RJT A;  4HYT B;  3RL0 C;  2P67 A;  4H13 B;  3RL0 B;  3HD7 A;  4WY4 D;  2W90 A;  1CI6 B;  3HUS C;  1BE3 J;  2L91 A;  2KS1 A;  5CHX A;  2R44 A;  4EIJ A;  2FXM A;  1VQN P;  1SQV J;  2WMM A;  4BRY A;  3KPE A;  5KJ7 A;  2WSC H;  4C46 A;  4YXW H;  5CCH D;  4OGQ D;  1S9K E;  1PGO A;  2XKM A;  1BE3 E;  1OXZ A;  1KC8 Q;  1Q2N A;  2C0X A;  1L0N K;  1NU1 J;  2JEE A;  1PL5 A;  3VMA A;  2C0W A;  2E74 C;  1RE3 C;  3TGU J;  1IFI A;  2O1K A;  1X0T A;  2N1T C;  1GW3 A;  2E74 B;  1SQV E;  5AVU B;  1EDK A;  2YKO A;  2IBZ E;  2V4H A;  1M90 Q;  1HBW A;  3HRN A;  1M56 D;  1S3J A;  2YKP A;  3L74 J;  4KHX A;  3A7O A;  4JYC A;  2Z4E A;  1L2P A;  2LXC B;  4MN4 C;  3VP9 A;  1NTM D;  2CPB A;  1NU1 E;  3TK1 A;  1LJ2 A;  3TGU E;  3HE4 A;  1K9M Q;  4IL6 X;  2E5Y A;  1E79 H;  3NXS A;  1JY2 O;  1LT9 B;  4WB4 A;  2ZYD A;  2KB7 P;  3NMD A;  3QH9 A;  3TF5 A;  1PP9 J;  3L74 E;  3WU2 H;  1G1J A;  1G2C B;  1RHZ B;  1URQ B;  4OVN F;  1M1J C;  4CPG A;  5GTI H;  3BRV B;  2RKL A;  1M1J B;  3PJS K;  2JDI H;  2AEJ A;  2I1K A;  3MP7 B;  2Q5U A;  3P8M C;  4WY4 C;  2O01 N;  2M8R A;  2K1A A;  2ZT9 D;  1KN7 A;  1AQT A;  1SQQ G;  3BRT B;  3OJA B;  2QJY B;  1PP9 E;  1QEX A;  5CCG A;  3V5B A;  1FU1 A;  1LTJ A;  2P10 A;  2YIU C;  5CCH C;  4NPD A;  3GMA A;  2YIU B;  4IFF A;  3CC7 P;  3H1L G;  1M1K Q;  4H44 D;  3L71 J;  1BGY G;  1JTH A;  1OW7 A;  1IFM A;  3C9I A;  2FKW B;  2Y9Y A;  2G8Y A;  1RE4 C;  1X8Y A;  2NZ2 A;  1WRG A;  4JQ0 D;  1Q82 Q;  1K8A Q;  3I56 P;  2O01 H;  2G3A A;  3VMY A;  2FYU G;  4U3F G;  3U59 A;  4EOT A;  3WUU A;  1NHL A;  4NPE A;  5APS A;  1DD4 A;  3KYQ A;  2KLV A;  3G71 P;  3L71 E;  1SQP J;  3RBZ A;  2B87 A;  4U3F D;  2GUV A;  1SFC B;  2XU6 A;  3SSU A;  2YO3 A;  4L73 A;  2N9Y B;  2M5A A;  1FZG A;  4HH2 A;  2PFX A;  3A3Y B;  2W6J H;  1Y47 A;  2K9J B;  2J59 M;  2R3C A;  1Y9B A;  1USD A;  4DZO A;  1L0N J;  1SQP E;  1SQB G;  3V6I A;  2C9L Y;  1T8Z A;  1AJY A;  4TLF A;  4D6T G;  3W67 A;  3Q5R A;  2E76 C;  2D2C C;  2WQY C;  3PTZ A;  2E76 B;  2D2C B;  1QLE D;  1ZR4 A;  1KYO H;  4UB8 E;  3U1A A;  1SQB D;  3EWK A;  2NPS D;  3LIE A;  4D6T D;  3CCS P;  3FXD A;  1K73 Q;  5BVZ A;  1FAV A;  1L4A C;  1NOH A;  1L0N E;  5AW7 B;  1L4A B;  3CWB J;  1OVU A;  4ZNC A;  3L4F A;  1JCD A;  1OWA A;  3B5N A;  3PHL A;  1N7S C;  1CZQ A;  1KQL A;  3FWN A;  2WT7 B;  3HTK B;  4NPF X;  1N7S B;  3Q1M A;  4IOI H;  5AVW B;  3MZW B;  5AW2 B;  3EQ2 A;  3K5B A;  2MJZ A;  4LGD E;  1NTK K;  2FBW C;  2IFN A;  5AVS B;  2POH A;  5APY A;  3RL0 g;  1IK7 A;  3TNU B;  1BE3 G;  2YXQ B;  1PIX A;  1S2E A;  3CWB E;  4C7N A;  3A0B E;  3IFM A;  1S9K D;  1SQV G;  1NTZ J;  1AVO A;  1EXI A;  1Q86 Q;  2IBZ G;  3MGN A;  3SWY A;  1KIL A;  1N73 B;  2HYN A;  1BE3 D;  1FDM A;  2P58 A;  2WSE J;  4XFJ A;  5APW A;  3O8Z A;  3PH0 A;  3H1J J;  2AXC A;  4DT0 A;  2YNY A;  1PPJ D;  3D70 A;  2QM8 A;  3RK2 C;  2HAP C;  1NU1 G;  3P7K A;  5TIS E;  1LTT C;  1H0T B;  3KDP B;  1FS0 E;  3V2R A;  2QSI A;  1NTZ E;  3F89 A;  3M0D A;  2R5D A;  5AVY B;  3V2P A;  3Q2Y A;  2P1J A;  1HVV A;  1RY3 A;  2JP3 A;  3P8C E;  3TGU D;  2ZYA A;  3L74 G;  2CK3 H;  3H1J E;  1MZ9 A;  4IL6 H;  3BCC J;  1KB9 D;  3TYY A;  4H13 D;  1SQQ E;  2RMZ A;  3RL0 D;  4W7Y A;  1ZRT E;  1RH5 B;  4XE5 B;  1KQF B;  2FY8 A;  4L75 A;  1F5E P;  3L74 D;  1IZN B;  2J5U A;  1BGY E;  2H7H A;  2HOD B;  1VQ5 P;  1RF1 C;  3MUD A;  3L75 J;  4R4L A;  3CCV P;  1QVG O;  2IPP A;  3GHG C;  1DEB A;  1VQ9 P;  1R5L A;  3BCC E;  2QRX A;  2WPQ A;  2HFE D;  4WBA A;  1QL1 A;  1IFP A;  3BAS A;  1PP9 D;  3FGA D;  1DX7 A;  2FYN C;  2E74 D;  3C1L A;  2HPC A;  1D7M A;  1NAY A;  1VF5 B;  1P84 I;  2K9Y A;  2W8Z A;  4H0L B;  3AE3 C;  3LID A;  2GM4 A;  3H32 B;  3L75 E;  2KS1 B;  3L73 J;  4HJG H;  1HJ0 A;  2WSF J;  3CME P;  4AUW A;  1SQX K;  3CCM P;  1JMB A;  3L35 A;  4BRY B;  3L71 G;  1BSN A;  5CJ0 A;  2ZJS E;  4KT0 J;  4LLH A;  3JC2 2;  2AEF A;  4PV1 C;  4YXD C;  1HWT C;  2NPS A;  1N86 A;  1NWQ A;  4I7Z B;  4PV1 B;  3VOP A;  1BDC A;  5KLV K;  3L71 D;  2R32 A;  2BCC J;  1NTK J;  2SPZ A;  1JY2 N;  3L73 E;  4I1L A;  1U57 A;  2KNC B;  2PRR A;  1GTW A;  1HJB A;  3AEF C;  1URQ D;  2WZ7 A;  1Q81 Q;  2QJP C;  1NH4 A;  5KTB A;  1FOS F;  4H13 C;  4W7Z A;  2QJP B;  1KOR A;  2A06 E;  5KLI C;  1LWU A;  5KLI B;  3SFD C;  2QJK B;  2ERE A;  2OTK E;  5APV A;  1NTK E;  1SQP D;  2WTY A;  2FXO A;  3WUV A;  1YBK A;  2OYO A;  2OYH A;  3HE4 B;  4JBZ A;  1MFT A;  2YMY A;  5AW1 B;  1SVF A;  1Y8A A;  4M3L A;  3RBX A;  2XND H;  3GW6 A;  1L0N G;  3L72 J;  4GOF A;  5C39 A;  1PYC A;  1RQU A;  1FDI A;  1S1C X;  3CCE P;  1VQ7 P;  3H1K J;  4IL6 E;  2KI7 B;  2MKV A;  1ZR2 A;  2PAJ A;  5B5E E;  1GDT A;  3G4S P;  1L0N D;  1S5L X;  1GL2 A;  1LTG C;  1RQV A;  2WWW A;  2KK7 A;  5KAI E;  3L72 E;  4DOJ A;  2FFD A;  3V2Q A;  3CWB G;  2JWD A;  3A5T A;  4AYC A;  3S9O A;  3KQG A;  3FWL A;  1SFC D;  3H1K E;  1LTJ B;  1F4S P;  1FZB A;  3AE4 C;  2LXB A;  3M9B A;  1GU4 A;  4OH8 B;  3O6Q A;  4UB8 H;  5GTH E;  3CWB D;  1AW6 A;  1LT9 C;  1OW6 A;  4BXL A;  1NTM K;  3N7N A;  3HUS A;  4PD4 I;  2W27 A;  1URQ C;  2O3J A;  2ZXX A;  1OVV A;  1PGP A;  4JPZ B;  2JWA A;  2JJL A;  4L76 A;  1NTZ G;  2Q1K A;  1LTB C;  1PV3 A;  1J1E C;  4JYB A;  4ASV A;  2E76 D;  3CXH I;  2D2C D;  1AV1 A;  1J1E B;  4ZKU A;  3H1J G;  1PFI A;  3ALC A;  1NTZ D;  3CX5 I;  2H43 A;  1PGJ A;  2QJY C;  3S1K A;  2M5A B;  2K88 A;  3H25 A;  2LR2 A;  1D66 A;  1RE3 A;  2N1T A;  2Y0D A;  4XA4 A;  3P8C D;  3SWF A;  3A0B H;  1L4A D;  2JR8 A;  3H1J D;  1YI2 P;  2B9B A;  1GU5 A;  1E5W A;  5KLV J;  1LNQ A;  5BU8 B;  1QGK B;  1SQQ D;  1ZRT D;  3L70 J;  1N7S D;  1NGM B;  1FJP A;  3M91 A;  4R4M A;  2JKV A;  3CC4 P;  3CL3 D;  1IFD A;  5AVZ B;  2GA1 A;  3WUT A;  3BCC G;  3H1L D;  5KAF E;  2FYZ A;  1BGY D;  5TIS H;  1S72 P;  2M0B A;  3RK3 C;  1N7L A;  3FX0 A;  1ZN5 A;  1AFO A;  3RK3 B;  4GOE A;  1MKM A;  1SFC C;  5KLV E;  2FYU D;  5AW9 B;  4WVZ A;  1G2C A;  1KYO D;  2A45 I;  2WSE H;  3L70 E;  3AEB C;  3B8E B;  2P7J A;  1OW8 A;  3L75 G;  5E79 E;  2AXT H;  1M1J A;  3B5N B;  1YQ4 C;  2YKQ A;  1NAF A;  2WVR A;  4EYY Q;  3COQ A;  4WY4 A;  1FZC A;  3A0H E;  1J1D B;  3L75 D;  2QIW A;  3RK2 D;  1AA0 A;  1IFN A;  4PD4 E;  1T3J A;  1EZV I;  3ITK A;  4EI2 A;  3LW5 J;  2QVA A;  1FJK A;  3L73 G;  3H1H J;  1VQO P;  5CCH A;  1QL2 A;  4C7N B;  2ALC A;  3AE8 C;  1VQP P;  3VMZ A;  2Q3E A;  4RKU J;  1KIL B;  3AE2 C;  3CXH E;  5AVV B;  1RE4 A;  2A06 G;  3CX5 E;  4Z1M H;  1A02 J;  2B88 A;  5AW5 B;  1SQB K;  2BCC G;  1NTK G;  3PRJ A;  1K04 A;  5KKZ B;  2XZR A;  1LGH B;  2Q3I A;  3H1H E;  4K35 A;  3R4Y A;  4EDF A;  2OYI A;  1NTM J;  1T3U A;  3RK3 E;  5K5G B;  5L8R J;  4GKG A;  2DW3 A;  3D71 A;  2IDB A;  3KHU A;  5AW8 B;  1RF0 C;  3OA7 A;  2KYV A;  2C9N Y;  2K9J A;  3P32 A;  3HE5 A;  1VF5 D;  3I55 P;  4H0L D;  1M7L A;  3L36 A;  1U7M A;  1N73 C;  3E1R A;  2WSF H;  3F5H A;  2OAR A;  1U7J A;  2XDJ A;  1Q7Y Q;  3L72 G;  3MUD C;  3CD6 P;  1VQL P;  1FZF A;  5KJ7 D;  1S5L H;  2XV5 A;  1SQV D;  3H1K G;  2IBZ D;  1NVO A;  3D6Z A;  4BWN A;  1T6A A;  1LP1 A;  5BU5 A;  3L72 D;  4PV1 D;  1KIL E;  3UIA A;  4IFM A;  2ZVO B;  1JY3 O;  3H1K D;  1YTZ I;  1L4A A;  4TT3 H;  1EZV E;  1FZE A;  2HPC B;  1NU1 D;  2YXR B;  5AW3 B;  4ASW A;  3ABV C;  2JO1 A;  2AXT E;  2RN0 A;  3HTK A;  1EDL A;  1OX3 A;  3II6 A;  1DH3 A;  5B5E H;  2PP6 A;  2J58 A;  1W5C E;  2KSJ A;  2H89 C;  3AED C;  1VDF A;  5KAI H;  3TNU A;  3AE1 C;  3TSI A;  1EQ7 A;  3A2A A;  1P84 H;  2BAS A;  2ZYG A;  5APQ A;  3G3Z A;  2WIT A;  3IF4 A;  3Q5P A;  3TDK A;  1ZP0 C;  1HUC A;  1T2K D;  3WMM 0;  1EXJ A;  3N4X A;  2M3B A;  5GTH H;  4A7P A;  5M1B A;  1YIJ P;  1VF5 C;  3HD7 C;  4H0L C;  3HD7 B;  3CCR P;  1H0T A;  1KFN A;  1YJW P;  3QWO C;  1NO4 A;  3V2N A;  5CBO A;  1R5S A;  3AE7 C;  2ZVN B;  2HLO A;  3W68 A;  4N78 E;  5KJ7 C;  2W6B A;  5KLV G;  3G9R A;  2V7Q H;  1BCC J;  2Y0C A;  3L70 G;  1KMI Z;  1HTL C;  4I7Z C;  3C8V A;  2Z5I A;  1N8R Q;  2IFM A;  2WPS A;  3Q3D A;  1GL2 C;  3H1I J;  3L70 D;  2H8P D;  4Y28 J;  1GL2 B;  2Y9Z A;  3ZDM A;  1KB9 I;  1JNM A;  1L0L K;  3NTN A;  4WWI A;  1IK9 A;  4Y99 B;  2R3S A;  1RF1 A;  3E7K A;  1BCC E;  3IR9 A;  2KLU A;  1X9V A;  1S5L E;  1GD2 E;  1BDD A;  3GHG A;  1VQM P;  2QJK C;  3BVH A;  2QM7 A;  3PLN A;  4B86 A;  2B89 A;  4O9B A;  1GMJ A;  2QEX P;  1WMK A;  5KAF H;  1JCC A;  2BCC E;  4PD4 D;  3VYI A;  1JEK A;  4N6J A;  3RGU A;  3H1I E;  2R5B A;  1FZA A;  3OAK A;  2XNX A;  3AEG C;  3G6E P;  3O6Q B;  2L5G B;  2ITA A;  1JY3 P;  3H32 A;  1SQP K;  4QMA A;  1HGZ A;  3HUS B;  2BEZ F;  4LC1 A;  3T97 A;  1JUN A;  1T2K C;  3CXH D;  1OIP A;  5E79 H;  4UB6 H;  3H1H G;  4PJ0 E;  2Q9I A;  1ZXG A;  2WSS H;  3CC2 P;  2Y0E A;  2W83 C;  4K3A A;  3CX5 D;  2E75 C;  4C7R A;  1LT1 A;  3A0H H;  2E75 B;  3KZI E;  3MHV A;  1KQG B;  3JCU E;  3H1H D;  2N9B A;  2P2U A;  2IYP A;  4PD4 H;  3RK3 D;  1P84 E;  5CCG C;  1YQ3 C;  2I1J A;  4RO0 A;  2KNC A;  1LTJ C;  1KV4 A;  2E5T A;  2N1T B;  1PPJ E;  1ZOY C;  1NTM G;  2V7Q J;  2WPV B;  3B5N D;  1GK4 A;  1NYH A;  2K37 A;  2A45 G;  3CXH H;  1JTH B;  2FXP A;  1VL2 A;  1CI6 A;  1YTZ T;  3M9H A;  1HGV A;  3PP5 A;  5CJ4 A;  3CX5 H;  1VPC A;  5EFW B;  3U1C A;  3LW5 H;  3MTU E;  1OMI A;  1G1I A;  2GUS A;  1PYI A;  2RH0 A;  1KB9 E;  3CCU P;  5AW0 B;  1OFC X;  3B71 A;  2HR3 A;  4RES B;  1EZV G;  1TU3 F;  2B87 B;  3VMX A;  1ZV8 A;  3AEA C;  5B66 E;  1GW4 A;  2OGU A;  1KIL D;  2KIK A;  3CLQ A;  4YTP C;  1SQX J;  2LKM A;  5CBN A;  1ZME C;  1JO5 A;  5CMZ A;  2KXP B;  1YJ9 P;  1FZC C;  1EZV D;  4WY4 B;  1FZC B;  1OVR A;  2M3E A;  2I8D A;  1NTZ K;  1SS1 A;  5H2F E;  1KD1 Q;  3OW2 O;  2A45 H;  1M57 D;  2KZJ A;  2ZFC A;  1QX8 A;  1SQX E;  2OTL P;  3M9Q A;  4OGQ C;  1L0L J;  2WSC J;  3E1I A;  4OGQ B;  1HF9 A;  1SQQ K;  2Q6Q A;  5APU A;  1VQ6 P;  1LT9 A;  1VQ8 P;  1W2B O;  1W2E A;  3AE6 C;  1USE A;  4GT1 A;  1N2D C;  3BCC D;  1Z56 A;  1ZW0 A;  1YIT P;  2QG4 A;  1URQ A;  2IZ0 A;  3B5N C;  4UB6 E;  5AW4 B;  2OYI C;  1CW5 A;  1L0L E;  1JB0 J;  2FYU K;  2OYI B;  1AQ5 A;  1J1D C;  2E43 A;  5APT A;  1FC2 C;  1Q90 D;  3EFF K;  4N78 D;  1IO4 A;  3JSV C;  1JY3 N;  2IZ1 A;  2IYO A;  2CPS A;  3HE5 B;  2W6A A;  3CCL P;  1VQK P;  3D6Y A;  1KIL C;  5AW6 B;  4KJM A;  3AE9 C;  1QVF O;  3NFQ A;  1K05 A;  2KOG A;  1BCC G;  2ZXE B;  1CSB A;  3L73 D;  2UWJ E;  2WPR A;  1H88 A;  4OWF A;  5KKZ C;  4DCK A;  2ZT9 C;  4ZMD A;  1FE6 A;  3H1I G;  1BCC D;  2KZI A;  1LP1 B;  2ZT9 B;  1R8E A;  1VQ4 P;  2QA4 P;  3FXE A;  2A06 D;  2BEQ D;  3M0D C;  2O1J A;  1YHQ P;  1PGQ A;  1J2J B;  1SFC A;  1DEE G;  1HH0 A;  1JY2 P;  1WT6 A;  1AVY A;  1NTK D;  2BCC D;  4H44 C;  3WU2 E;  3GG2 A;  3H1I D;  2NRG A;  4H44 B;  5GTI E;  4L74 A;  4N3Y B;  1KYO I;  2QE7 H;  1A02 F;  5TJH A;  1NJI Q;  1M8O B;  2AEM A;  3HD7 D;  5APX A;  1DIP A;  1NTM E;  3MIW A;  2O01 J;  2H88 C;  3M0A A;  5AVX B;  1DD3 A;  4W80 A;  3AE5 C;  4AQR D;  1QP9 A;  1MFZ A;  1KQS O;  3M06 A;  3SWK A;  3VN0 A;  1PPJ G;  1H89 A;  3CMA P;  4JF7 A;  1P84 D;  4HB1 A;  1FDO A;  4I2L C;  1JM0 A;  1SQV K;  2PGD A;  1EDI A;  3V4Q A;  3I5C A;  1GL2 D;  1SQQ J;  1KZU B;  1S4X A;  1OZH A;  3KXD A;  2E42 A;  3GF7 A;  3TGU G;  3RK2 B;  2WT7 A;  1LTA C;  1N7S A;  4PJ0 H;  3H1L J;  3V4W A;  2HG5 D;  3BAT A;  1BGY J;  1NU1 K;  1H8A A;  2YMK A;  3B4S A;  1GZL A;  3IN6 A;  5AVT B;  1FBM A;  2KSE A;  3KZI H;  3SFE C;  3JCU H;  2NPS C;  1PZQ A;  2KP8 A;  1RF0 A;  2FYU J;  4U3F J;  3GF3 A;  1NKN A;  2NPS B;  3CCJ P;  1X79 B;  3CI9 A;  1BSH A;  2OTJ P;  4I6M C;  1SLQ A;  3Q5S A;  4GDO A;  1N73 A;  3L37 A;  3H1L E;  4U7J A;  1JMM A;  2ERG A;  1X22 A;  3CCQ P;  5AVR B;  1PP9 G;  5AVQ B;  3VP8 A;  1RF1 B;  1IC2 A;  2E75 D;  1SQX G;  1LWU C;  3GHG B;  2FYU E;  3EFG A;  4U3F E;  1KFM A;  4GIF A;  1KYO E;  3AEC C;  1LWU B;  1UII A;  2Z5H A;  1YJN P;  2OYH C;  2VRS A;  4GOD A;  2OQQ A;  2IBZ I;  2OYH B;  1JOC A;  1KB9 H;  1SQX D;  1GK6 A;  5CCG D;  2N1T D;  1MUU A;  2FYN B;  1SQB J;  1MV8 A;  2YO2 A;  3IAO A;  1XTC C;  1EDJ A;  1XTG B;  4D6T J;  3R2P A;  2Q7C A;  5B66 H;  3T97 B;  2ER8 A;  1UIX A;  3CPW O;  1LTI C;  2KUB A;  1L0L G;  4ZKP A;  1YYC A;  3USS A;  5KLV D;  4IFD K;  1EC5 A;  3H6P A;  2ZAE B;  5DJT B;  1IFJ A;  1ZLL A;  4Y99 C;  5H2F H;  2HOD A;  4HKZ H;  2IX7 C;  1L0L D;  1SQB E;  2FFD C;  4D6T E;  2FFD B;  1SP4 A;  4DJG A;  5DJU B;  3GLM A;  3S4R A;  1IJD B;  1NKZ B;  3VTP C;  2K3R A; 
#chains in the Genus database with same CATH homology
 2BEZ F;  4GDO A;  1KTM A;  4KT0 J;  3AEA C;  4U7J A;  3D6Z A;  2ERG A;  2O01 J;  1Q90 D;  2H88 C;  3AEE C;  4PV1 C;  4YXD C;  4YTP C;  4RKU J;  1HWT C;  4PV1 D;  3AE7 C;  1KIL E;  1DD3 A;  3AE2 C;  4I7Z B;  4PV1 B;  4IL6 X;  3AE5 C;  1DD4 A;  4H13 D;  1QP9 A;  1NGM B;  1ZME C;  3Q1M A;  1ZRT E;  4H13 B;  4R4M A;  3S9O A;  2E75 C;  3G9R A;  1KQF B;  2E75 D;  4TT3 H;  2FBW C;  1U57 A;  4Z1M H;  1F5E P;  2E75 B;  2J5U A;  3D6Y A;  1F4S P;  1KMI Z;  1KQG B;  3AE4 C;  3AEF C;  3AEC C;  3ABV C;  2JO1 A;  2QJP C;  4I7Z C;  3RL0 g;  1IK7 A;  1K04 A;  3O6Q A;  3C8V A;  3AE9 C;  1FDO A;  4H13 C;  3R4Y A;  1AW6 A;  1PIX A;  1K05 A;  2OQQ A;  1KOR A;  3RK3 E;  1YQ3 C;  1OW6 A;  4R4L A;  1MKM A;  5KLI C;  3Q3D A;  4OGQ C;  3IAO A;  5L8R J;  4Y28 J;  3SFD C;  2ERE A;  1ZOY C;  4OGQ D;  1EXI A;  1Y9B A;  3AEB C;  2H89 C;  2WSC J;  3AED C;  4OGQ B;  1HF9 A;  3GF7 A;  5KKZ C;  2ZT9 C;  1OW8 A;  3T97 B;  3D71 A;  2IDB A;  2V7Q J;  2ER8 A;  2WPV B;  2ZT9 D;  3AE1 C;  1UIX A;  2WSE J;  4XFJ A;  1R8E A;  2ZT9 B;  1NYH A;  1YQ4 C;  2BEQ D;  2FXP A;  3FGA D;  1PL5 A;  1VL2 A;  1AJY A;  2E74 C;  3AE6 C;  3COQ A;  2FYN C;  2E74 D;  1VF5 D;  1PV3 A;  3Q5R A;  2E76 C;  2QJK C;  2D2C C;  3Q5P A;  2E74 B;  2P10 A;  2YIU C;  1VF5 B;  2YMK A;  4H0L D;  2E76 D;  3D70 A;  2D2C D;  1PYC A;  2K9Y A;  1GMJ A;  2WQY C;  1RQU A;  3IN6 A;  2E76 B;  4H0L B;  2D2C B;  4H44 C;  2QIW A;  1WMK A;  1ZP0 C;  1FDI A;  1S1C X;  3AE3 C;  3GMA A;  2HAP C;  4H44 D;  3SFE C;  1OMI A;  1EXJ A;  4H44 B;  3EWK A;  3ALC A;  1OW7 A;  1HJ0 A;  2MKV A;  2QJY C;  2WSF J;  3GF3 A;  3AEG C;  1PYI A;  2QSI A;  3LW5 J;  3H25 A;  2G8Y A;  1D66 A;  5M1B A;  1JB0 J;  1DIP A;  2NZ2 A;  1VF5 C;  3Q2Y A;  3B71 A;  1S5L X;  2G3A A;  4H0L C;  3Q5S A;  2ALC A;  3GLM A;  2JP3 A;  3AE8 C;  1RQV A;  1TU3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...