1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
molecule tags Transcription regulation
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
2ALCA 3IN6A 3COQA 1AW6A 1WMKA 3O6QA 2HAPC 2ERGA 1FDOA 1F4SP 2P10A 1AJYA 1OMIA 1F5EP 2G8YA 3ALCA 1PYIA 1PYCA 1FDIA 3EWKA 1HWTC 1ZMEC 2EREA 1D66A 3H25A 2ER8A 1QP9A
chains in the Genus database with same CATH superfamily
3KYQA 2SPZA 4H0LD 3KHUA 2N1TA 1YIJP 1NU1G 3T97B 2ZYDA 4M3LA 1KFMA 4GIFA 3OW2O 1AQTA 3BCCJ 1NTKD 3TGUD 3CD6P 4C7NB 1S72P 1EQ7A 1J1DB 1FZEA 4IFMA 1MFZA 3L73E 1Y8AA 3TF5A 1SQVD 2N1TD 2XV5A 1ZMEC 1N7SA 1JTHA 1SQXG 2ZT9C 1KILE 1IFIA 5CHXA 1CW5A 1RE3C 1YITP 3GG2A 3M06A 3BRTB 1LTSC 3ZDMA 5L8RJ 2KB7P 2BEZF 3WU2H 2A45H 1FAVA 2BCCJ 2V4HA 3S1KA 3CCLP 4L76A 3GLMA 4OVNF 1N7SD 1E5WA 1DH3A 3JC22 1NU1J 5CCHA 1KORA 1S4XA 1L0NK 1YHQP 1SQBJ 4GOEA 1G1JA 1GW4A 1YI2P 5KLVG 1LNQA 3H1IG 1LGHB 2W6BA 3EQ2A 3A7OA 3Q5SA 1FU1A 4W7ZA 5AW2B 2FY8A 4OWFA 1M90Q 1FS0E 2LXCB 3HE5A 3RL0g 1P84E 3R2PA 5CCHD 1BCCG 3WUUA 1JCCA 4EDFA 3CCEP 5AVVB 1T2KC 3HUSC 2QM8A 1WRGA 1GU4A 2LKMA 2WSEH 4K35A 2JP3A 3L72J 3GMAA 3RL0D 1CI6A 3A0BE 1L4AB 3V2NA 3BCCE 1YTZI 1H88A 2JWAA 3H1KD 4KJMA 1TU3F 1RF1C 3G3ZA 2K9JA 2KXPB 5AW5B 4XFJA 2Y9ZA 2IDBA 2I1KA 3RGUA 3MTUE 3TNUB 2E76D 2M0BA 1ZLLA 1J1EC 4OGQD 5APVA 5BVZA 3M9BA 4D6TD 3AE8C 3CX5H 3E1RA 1FOSF 2BCCE 1RHZB 3O6QA 1PFIA 5DJUB 3AEEC 1QVGO 1BCCJ 1VQOP 3F5HA 1SQQK 2WITA 2MJZA 4PD4D 1NU1E 1JOCA 2YMKA 1NHLA 2WSCJ 3VMYA 4NPFX 1OXZA 1SQBE 2WT7B 1YJ9P 2IBZE 5APXA 1K04A 2KZIA 1HWTC 2ZFCA 5KLVD 5GTHE 3A3YB 3Q5PA 3H1ID 2Q7CA 2QG4A 2QRXA 1W2EA 4PJ0E 1QL2A 2PAJA 5AVQB 1SQXE 3H32A 1EXJA 1N73B 1L0NG 3PLNA 1N7SB 4JYCA 2XNDH 4H13C 3L72E 1X9VA 4IL6E 1K73Q 2JDIH 2OYOA 1L0LD 3BASA 1N73C 2XKMA 5B66H 1GZLA 1VQNP 1KB9E 1N7SC 1EZVI 2K1AA 3CWBG 4GOFA 4QMAA 1IZNB 2QEXP 1M1JA 1WMKA 2QIWA 1H89A 3L71G 2R3CA 2WPSA 2A06G 5KKZB 3IR9A 5BU5A 4W80A 2L91A 3P8CD 1U57A 1MKMA 3L36A 1NTZD 2O01J 1SQPD 1BGYG 3COQA 4KT0J 2P2UA 3EFFK 3LIEA 3V4WA 2O3JA 3Q1MA 4RJTA 2W90A 4BXLA 1HF9A 1BCCE 1M8OB 2YO3A 5KKZC 1YQ3C 5E79E 1L0NJ 1M56D 2P1JA 1LTBC 1YJWP 2CPBA 2OARA 2QM7A 2E76B 3OJAB 4YPCA 1M57D 3L75J 4N3YB 1CI6B 4BWNA 3CWBJ 4ASVA 2FYUD 2OYIA 1SQQG 1Q81Q 1FC2C 5M1BA 2K9JB 2HAPC 3NMDA 3JCUH 3HRNA 2QJPC 1VQPP 1HJBA 2VRSA 3L70D 3F89A 1R5LA 3L73G 1BGYJ 5AW3B 2OGUA 2Y0EA 2ZVOB 4JPZB 1EZVG 3O6QB 2D2CD 5AW7B 3GHGA 3G9RA 1JY3N 1OW7A 3PRJA 4RESB 2IYPA 4I7ZC 3RBZA 5APWA 1OZHA 3L71D 1MZ9A 3AE3C 1N8RQ 3AE4C 3IF4A 2Q1KA 3I5CA 1AFOA 3RK3E 3VMZA 1NTMK 2N9YB 2R44A 4ZMDA 1VQ7P 1S5LX 3KQGA 2E74B 4WY4C 1S9KD 2FFDA 2O1KA 3VP9A 2J58A 1AW6A 1FZCB 3L74J 1PP9D 5TISE 3IAOA 1L0NE 2IBZI 3H32B 2NZ2A 3CL3D 4AUWA 1K05A 4JBZA 2L5GB 1YBKA 2E74C 2FXMA 2ITAA 3AE7C 1FZCC 2QE7H 3L75E 2ZXEB 1FDIA 3FWNA 2ZYGA 1KILA 2HLOA 3CWBE 3M9QA 4GKGA 1URQA 5AVYB 2WSEJ 2XU6A 5BU8B 1GK4A 3BCCG 1M1KQ 5CBNA 2FYZA 2A06E 2NPSC 1H8AA 1ZN5A 1M1JB 4Y28J 1K9MQ 3B5NA 2QVAA 1BGYE 2WVRA 1KILD 1VF5D 3NXSA 4YXDC 1GL2A 1URQD 2DW3A 1SS1A 4R4MA 1RE4A 4KHXA 2P67A 1JNMA 1JY2N 3WU2E 1PIXA 3A0HH 2JEEA 3B5ND 2M3EA 3O8ZA 1NO4A 4H44B 1NTKJ 3TGUJ 1LWUA 1GL2D 3MUDC 1GU5A 1EDIA 4Y99B 3D70A 1S2EA 2V7QJ 1DEEG 2JO1A 1KN7A 1SQVJ 4OH8B 1N86A 1OVVA 1JY2O 1SQBG 1SQQE 2IBZG 1R8EA 2WPRA 1Q90D 1JY2P 1HH0A 3L74E 3MHVA 4H44C 2IX7C 5KJ7A 2OYIB 2KIKA 4JF7A 2D2CB 3AE1C 1VQKP 1AJYA 3AE9C 1NTMG 4BRYA 2C0XA 1JB0J 5DJTB 1DX7A 1LT1A 1Y47A 1P84D 2Z5IA 3RK2D 1NYHA 4U3FG 1EZVE 2E5YA 2NRGA 2YO2A 2RMZA 1HGZA 5KJ7D 1J1DC 4O9BA 3L72G 3H1LG 3GHGB 3UIAA 3BCCD 1S5LH 3H1HG 1VQ8P 4MN4C 4W7YA 3FXDA 2KNCB 2FKWB 1H0TA 2M5AA 5TJHA 5KAIH 2YKOA 3H25A 1KYOI 3GHGC 3NTNA 3TK1A 1MV8A 5AVRB 2H89C 3FXEA 3M0DC 2BCCD 3CXHH 2H7HA 1RF0C 1VL2A 2AEJA 3CX5E 1NTMJ 2Y9YA 4EI2A 1JUNA 2JWDA 1T3JA 1NTKE 3TGUE 2YXRB 4U3FJ 1KFNA 1D7MA 3HTKA 2KLUA 1GD2E 1PPJG 4YTPC 1JM0A 1HJ0A 2XZRA 1NU1D 1FDOA 3GW6A 2AEFA 3P32A 1QGKB 3H1LJ 4L73A 1R5SA 1SQBD 2IBZD 1W5CE 1LP1A 2I1JA 4NPDA 1BE3G 1YQ4C 3D6ZA 3H1HJ 2FXOA 1URQB 3VYIA 3C8VA 2ALCA 3LW5H 3BVHA 2KLVA 2B87A 3S4RA 3M9HA 3IFMA 3A2AA 1SFCA 1NGMB 1PYIA 4B86A 1SQXD 1L4AC 3B5NB 3GF3A 2ZAEB 3AE5C 4H0LB 5KLIB 3Q2YA 2OYHB 1KMIZ 2M3BA 3L72D 1A02J 2JKVA 2XDJA 1F5EP 1IC2A 4EYYQ 1KQFB 5CCGA 2HYNA 1OVRA 1SFCD 4UB6E 5KAFE 2OTLP 1KB9D 4IOIH 1IFJA 1JCDA 4HH2A 5B66E 4H0LC 3VMAA 5KLIC 2HG5D 2OYHC 1P84H 1LWUB 1QX8A 4JYBA 2N1TB 2IFNA 2A45I 3MGNA 3EFGA 3RK2B 2GM4A 5CCGD 3USSA 3VP8A 1BE3J 1FZGA 1FE6A 1JMMA 3MIWA 1PGOA 3A0BH 1LTJA 5B5EH 3CCMP 1NTME 3PJSK 3D6YA 1EDLA 3VN0A 1L0LJ 2N1TC 1VDFA 1BCCD 5AVZB 5H2FH 4U3FE 4BRYB 1JTHB 3IN6A 1KQLA 1QVFO 1PGQA 1QLED 3H1LE 2KP8A 4N78D 2JR8A 1FDMA 3ALCA 3P8MC 2E75D 4PV1D 2BEQD 1YYCA 3H1HE 1KQSO 3L75G 1G1IA 2AXTE 1SQPJ 2OTKE 1HTLC 4HB1A 2Z4EA 3HD7A 1ZW0A 4GODA 1H0TB 1G2CA 1OIPA 2M5AB 2EREA 3QH9A 3JCUE 1KQGB 3AECC 1X8YA 3CC2P 1LTTC 3H1JJ 3CI9A 2G3AA 1NTKK 2O1JA 2Q6QA 5GTHH 4GDOA 2FYNB 3RL0B 3E1IA 1ZR2A 2P7JA 3HD7D 1RY3A 2H8PD 5CCHC 1SQVK 1ZP0C 1LT9A 3C1LA 1LJ2A 1PPJE 3Q5RA 3HE5B 4GT1A 4PJ0H 2A45G 3KZIE 4DCKA 4A7PA 3R4YA 3CX5I 3RL0C 2WPQA 4DZOA 1PL5A 3RK3D 2WQYC 1BE3E 2KS1A 1FZFA 3AE6C 1NOHA 4OGQB 1FZBA 1LP1B 1S1CX 2K88A 2H88C 2B87B 3KXDA 3L74G 5GTIH 1KB9H 2PRRA 1L0ND 2E76C 1RE3A 3V5BA 4PD4H 1IFDA 3V6IA 5EFWB 4OGQC 4U7JA 2HODA 1SVFA 2KUBA 3B8EB 2W27A 2N9BA 3P8CE 3L75D 1USDA 5APQA 1ZRTE 1SQPE 3B4SA 3GF7A 2ZT9D 1T8ZA 3CWBD 1KYOE 2WSFH 4ZKPA 1L2PA 5E79H 1NAYA 4L75A 2A06D 3TYYA 1E79H 1KD1Q 1PP9J 2KI7B 4EIJA 1BGYD 2JJLA 3H1JE 1CZQA 1AQ5A 1VQMP 1OX3A 4PV1B 2QA4P 3CMAP 1M7LA 3W68A 1OFCX 2YKQA 3KPEA 2I8DA 3HUSA 2PGDA 1RQVA 3L37A 5AVWB 4C46A 3VTPC 1NTKG 1PGPA 3TGUG 2Q3EA 2QJYB 3QWOC 1RF1A 1SQVG 1JEKA 1NKNA 3MP7B 3PHLA 1SLQA 1SQQD 1DD4A 1T2KD 2C9LY 1YTZT 2KK7A 2LXBA 2ERGA 5AW4B 5K5GB 2KZJA 1DD3A 2QSIA 4RKUJ 3SWFA 3EWKA 3L73D 3TDKA 1MFTA 2W83C 3U1AA 3PP5A 2YIUB 5KLVK 4WWIA 4R4LA 3BATA 3E7KA 2BASA 2O01H 4ZKUA 1EZVD 3SWKA 4Z1MH 3TNUA 1Q86Q 1EDKA 3RBXA 3RK3B 1M1JC 4WVZA 1DEBA 1ZV8A 5APYA 1D66A 5AW8B 3SFDC 2KOGA 5TISH 2YIUC 4DOJA 1PP9E 4UB8H 3CC4P 1S3JA 1Y9BA 1BDDA 5APSA 2W6JH 3HE4A 1L0LK 2R5DA 1FOSE 3LIDA 2AXCA 1NKZB 1DIPA 2WMMA 1GMJA 4ASWA 4NPEA 1T6AA 1U7JA 3WUTA 2FXPA 1VQ5P 2YKPA 2WT7A 4YXWH 2B89A 1EXIA 4HKZH 4Y99C 1T3UA 5AVTB 3CX5D 1IO4A 1FJPA 2ZT9B 1XTCC 2M8RA 4EOTA 4I1LA 3CXHE 1ZXGA 2GA1A 1ZR4A 3H1KG 3I56P 1NTZK 3FWLA 1SQPK 2HODB 4HYTB 5KTBA 2OYIC 1N73A 1X0TA 1KTMA 2D2CC 2K3RA 1PYCA 3S9OA 3II6A 3V2RA 2ER8A 3CCSP 2ZVNB 5AW6B 3SFEC 3VOPA 2IFMA 4H13D 1OW6A 1K8AQ 3FX0A 3PH0A 4D6TG 2Z5HA 1EC5A 2QJKB 3WUVA 1J2JB 2WPVB 3G71P 1W2BO 1VQ9P 4XA4A 2Q3IA 2FYUK 2FFDB 1AVYA 1HGVA 1OMIA 2Q5UA 3V4QA 2QJKC 3U59A 1EDJA 1LTAC 2J59M 3H1KJ 1KZUB 3K5BA 3HUSB 2OTJP 1UIIA 2FFDC 1BDCA 1SQVE 3JSVC 1BSNA 3CCUP 1SQXJ 2ZXXA 1X79B 1RF1B 1KILB 1QP9A 1VF5B 3FGAD 1PZQA 4D6TJ 1JMBA 3SSUA 3V2QA 1NTMD 2B9BA 1Q2NA 5B5EE 2W6AA 2R32A 1L0LG 2C9NY 1FBMA 1J1EB 4IL6X 3CCVP 4U3FD 5C39A 4WBAA 1CSBA 1KILC 1VF5C 5H2FE 4HJGH 1URQC 1NVOA 1GL2B 2K37A 5CBOA 3H1LD 3VMXA 5AW1B 3AEBC 1QEXA 4K3AA 3TSIA 3AEFC 2WSSH 3M91A 3H1HD 3B5NC 4DT0A 5KLVJ 1RQUA 1NTZG 1OW8A 1SQPG 1RH5B 4I2LC 3H1IJ 3MD0A 2ZJSE 1GL2C 3B71A 2PFXA 1AV1A 1RE4C 1NJIQ 2WSFJ 4WY4A 3P7KA 3HE4B 2V7QH 3CMEP 4L74A 1XTGB 2ZYAA 2RH0A 2E5TA 1JO5A 3AEDC 3H1JG 2POHA 1Q82Q 3H6PA 1OWAA 1VQLP 4LC1A 3C9IA 2KSEA 1LWUC 3ABVC 3H1KE 1AVOA 3RK2C 1UIXA 1PPJD 4H13B 2HFED 4WY4D 4TT3H 1FZCA 2R5BA 2IYOA 2FYUG 1N2DC 3MZWB 2R3SA 5KJ7C 1WT6A 2YMYA 3CXHI 1BE3D 2Y0DA 1OVUA 3L70G 3L35A 2NPSA 2E74D 4D6TE 1NTZJ 2CK3H 1IFPA 2GUVA 3I55P 1PV3A 3CC7P 4UB6H 2HR3A 4DJGA 5KAFH 2HPCA 4TLFA 5GTIE 1BSHA 1PGJA 1NAFA 3Q3DA 1FZAA 1GDTA 4WB4A 2Q9IA 4PD4E 3NFQA 2NPSD 3AEGC 4IFFA 2WWWA 3D71A 5KLVE 5APTA 4RO0A 2LR2A 1AA0A 1ZRTD 4AYCA 4LGDE 3H1IE 3MUDA 1KYOD 2K9YA 1LTGC 3CLQA 2FYUJ 3HTKB 2W8ZA 3ITKA 1PP9G 2FYNC 3L70J 4IL6H 1VPCA 1HUCA 3H1JD 2H43A 4N78E 1IFNA 2Y0CA 1MUUA 5AW9B 2WTYA 3T97A 2GUSA 1L0LE 2QJPB 1Q7YQ 2XNXA 2AXTH 1YJNP 3N4XA 1P84I 3CCJP 3PTZA 1SFCB 1FJKA 1IK7A 4LLHA 2PP6A 1USEA 4I6MC 4C7NA 2UWJE 1Z56A 4H44D 2E42A 3L71J 4CPGA 1F4SP 1KC8Q 1U7MA 5CMZA 2IZ0A 4I7ZB 1NTZE 1SFCC 2J5UA 3WMM0 1IJDB 3AE2C 1HVVA 3CPWO 2P58A 2MKVA 5APUA 2RN0A 3M0AA 1NU1K 5AVUB 3KZIH 5AVXB 1VQ4P 5CCGC 1SQBK 2WSCH 4WY4B 2O01N 2IPPA 3M0DA 3BRVB 3G6EP 2KNCA 3N7NA 1RF0A 4JQ0D 3W67A 1LTJB 1X22A 5AW0B 4AQRD 2E75B 1GK6A 3L4FA 3OA7A 1SQXK 2KYVA 1JY3O 2FYUE 1HBWA 1SP4A 1SQQJ 1JY3P 3A0HE 1N7LA 2IZ1A 3G4SP 1LTJC 2B88A 2P10A 2G8YA 3OAKA 2E43A 2RKLA 3L70E 2E75C 4PV1C 4UB8E 4N6JA 3L73J 5CJ0A 1NWQA 2KSJA 3CCQP 2NPSB 3L74D 1IFMA 2OQQA 4XE5B 3V2PA 2YXQB 1L4AA 1A02F 3CCRP 3HD7B 1KYOH 1VQ6P 2CPSA 2QJYC 2HPCB 3SWYA 3LW5J 1G2CB 3CXHD 3U1CA 3L71E 2FBWC 4C7RA 1LTIC 3KDPB 3HD7C 1L4AD 1KB9I 2AEMA 1S9KE 1KV4A 1LT9B 4PD4I 1NH4A 2OYHA 2YNYA 1GTWA 1QL1A 1IK9A 1ZOYC 4ZNCA 2C0WA 1S5LE 5AVSB 2WZ7A 1GW3A 2BCCG 3RK3C 4IFDK 3A5TA 2KS1B 3AEAC 5CJ4A 5KAIE 1LT9C
chains in the Genus database with same CATH topology
4H0LB 4H0LD 4KT0J 3COQA 3FGAD 3Q2YA 3AE3C 4R4MA 3AE4C 1KMIZ 2ERGA 2YMKA 2P10A 2WSCJ 1F5EP 3RK3E 2G8YA 3Q5SA 3Q1MA 1KQFB 1KTMA 2D2CC 3T97B 1HF9A 2E75C 4PV1C 1PYCA 1DD3A 2QSIA 5KKZC 4RKUJ 1K04A 1YQ3C 3EWKA 1ZRTE 1PIXA 3S9OA 1HWTC 2EREA 3RL0g 3H25A 3GF7A 1IK7A 4IL6X 2ZT9D 2ER8A 1S5LX 2E74B 3Q5PA 1KQGB 2E74D 1VF5C 3AECC 4R4LA 3SFEC 4H44B 4H13D 4H44D 1OW6A 4H0LC 1AW6A 2G3AA 5KLIC 2OQQA 2H89C 4Z1MH 1PV3A 4GDOA 3D70A 1F4SP 2JP3A 3IAOA 1VL2A 2E76B 3AEBC 3GMAA 2V7QJ 2JO1A 1EXJA 2QJYC 3AEFC 4I7ZB 1ZMEC 2NZ2A 1D66A 1ZP0C 1K05A 2ZT9C 3LW5J 2WPVB 1KILE 2J5UA 3SFDC 3Q5RA 1TU3F 3AE2C 3Q3DA 1R8EA 1Q90D 2E74C 1RQUA 2YIUC 1OW8A 4H13C 4H44C 4YTPC 4XFJA 3AE7C 5M1BA 1HJ0A 2IDBA 3AEGC 2FBWC 2MKVA 3R4YA 2BEZF 5L8RJ 2HAPC 1Y9BA 2D2CB 3D6YA 1FDOA 3AE1C 3B71A 1AJYA 1OMIA 4PV1B 3AE9C 3D71A 1PL5A 2QJPC 2E76D 2WQYC 1FDIA 2QJKC 2WSFJ 1JB0J 3AE6C 4OGQB 1YQ4C 4OGQD 1NYHA 3D6ZA 1DIPA 3GLMA 2WSEJ 3C8VA 1S1CX 2ALCA 1GMJA 3IN6A 3AE8C 1RQVA 2K9YA 3AEDC 2FXPA 1ZOYC 1WMKA 3O6QA 2H88C 2QIWA 1EXIA 2E75B 3ALCA 2D2CD 1NGMB 2FYNC 4Y28J 2E75D 1PYIA 1KORA 2E76C 4PV1D 3ABVC 2BEQD 1U57A 2ZT9B 3AEEC 3G9RA 1MKMA 3GF3A 1OW7A 4I7ZC 3AE5C 2O01J 1QP9A 4OGQC 1UIXA 1VF5B 3AEAC 4H13B 4U7JA 1VF5D 4TT3H 4YXDC 1DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ALC A;  3IN6 A;  3COQ A;  1AW6 A;  1WMK A;  3O6Q A;  2HAP C;  2ERG A;  1FDO A;  1F4S P;  2P10 A;  1AJY A;  1OMI A;  1F5E P;  2G8Y A;  3ALC A;  1PYI A;  1PYC A;  1FDI A;  3EWK A;  1HWT C;  1ZME C;  2ERE A;  1D66 A;  3H25 A;  2ER8 A;  1QP9 A; 
#chains in the Genus database with same CATH topology
 3KYQ A;  2SPZ A;  4H0L D;  3KHU A;  2N1T A;  1YIJ P;  1NU1 G;  3T97 B;  2ZYD A;  4M3L A;  1KFM A;  4GIF A;  3OW2 O;  1AQT A;  3BCC J;  1NTK D;  3TGU D;  3CD6 P;  4C7N B;  1S72 P;  1EQ7 A;  1J1D B;  1FZE A;  4IFM A;  1MFZ A;  3L73 E;  1Y8A A;  3TF5 A;  1SQV D;  2N1T D;  2XV5 A;  1ZME C;  1N7S A;  1JTH A;  1SQX G;  2ZT9 C;  1KIL E;  1IFI A;  5CHX A;  1CW5 A;  1RE3 C;  1YIT P;  3GG2 A;  3M06 A;  3BRT B;  1LTS C;  3ZDM A;  5L8R J;  2KB7 P;  2BEZ F;  3WU2 H;  2A45 H;  1FAV A;  2BCC J;  2V4H A;  3S1K A;  3CCL P;  4L76 A;  3GLM A;  4OVN F;  1N7S D;  1E5W A;  1DH3 A;  3JC2 2;  1NU1 J;  5CCH A;  1KOR A;  1S4X A;  1L0N K;  1YHQ P;  1SQB J;  4GOE A;  1G1J A;  1GW4 A;  1YI2 P;  5KLV G;  1LNQ A;  3H1I G;  1LGH B;  2W6B A;  3EQ2 A;  3A7O A;  3Q5S A;  1FU1 A;  4W7Z A;  5AW2 B;  2FY8 A;  4OWF A;  1M90 Q;  1FS0 E;  2LXC B;  3HE5 A;  3RL0 g;  1P84 E;  3R2P A;  5CCH D;  1BCC G;  3WUU A;  1JCC A;  4EDF A;  3CCE P;  5AVV B;  1T2K C;  3HUS C;  2QM8 A;  1WRG A;  1GU4 A;  2LKM A;  2WSE H;  4K35 A;  2JP3 A;  3L72 J;  3GMA A;  3RL0 D;  1CI6 A;  3A0B E;  1L4A B;  3V2N A;  3BCC E;  1YTZ I;  1H88 A;  2JWA A;  3H1K D;  4KJM A;  1TU3 F;  1RF1 C;  3G3Z A;  2K9J A;  2KXP B;  5AW5 B;  4XFJ A;  2Y9Z A;  2IDB A;  2I1K A;  3RGU A;  3MTU E;  3TNU B;  2E76 D;  2M0B A;  1ZLL A;  1J1E C;  4OGQ D;  5APV A;  5BVZ A;  3M9B A;  4D6T D;  3AE8 C;  3CX5 H;  3E1R A;  1FOS F;  2BCC E;  1RHZ B;  3O6Q A;  1PFI A;  5DJU B;  3AEE C;  1QVG O;  1BCC J;  1VQO P;  3F5H A;  1SQQ K;  2WIT A;  2MJZ A;  4PD4 D;  1NU1 E;  1JOC A;  2YMK A;  1NHL A;  2WSC J;  3VMY A;  4NPF X;  1OXZ A;  1SQB E;  2WT7 B;  1YJ9 P;  2IBZ E;  5APX A;  1K04 A;  2KZI A;  1HWT C;  2ZFC A;  5KLV D;  5GTH E;  3A3Y B;  3Q5P A;  3H1I D;  2Q7C A;  2QG4 A;  2QRX A;  1W2E A;  4PJ0 E;  1QL2 A;  2PAJ A;  5AVQ B;  1SQX E;  3H32 A;  1EXJ A;  1N73 B;  1L0N G;  3PLN A;  1N7S B;  4JYC A;  2XND H;  4H13 C;  3L72 E;  1X9V A;  4IL6 E;  1K73 Q;  2JDI H;  2OYO A;  1L0L D;  3BAS A;  1N73 C;  2XKM A;  5B66 H;  1GZL A;  1VQN P;  1KB9 E;  1N7S C;  1EZV I;  2K1A A;  3CWB G;  4GOF A;  4QMA A;  1IZN B;  2QEX P;  1M1J A;  1WMK A;  2QIW A;  1H89 A;  3L71 G;  2R3C A;  2WPS A;  2A06 G;  5KKZ B;  3IR9 A;  5BU5 A;  4W80 A;  2L91 A;  3P8C D;  1U57 A;  1MKM A;  3L36 A;  1NTZ D;  2O01 J;  1SQP D;  1BGY G;  3COQ A;  4KT0 J;  2P2U A;  3EFF K;  3LIE A;  3V4W A;  2O3J A;  3Q1M A;  4RJT A;  2W90 A;  4BXL A;  1HF9 A;  1BCC E;  1M8O B;  2YO3 A;  5KKZ C;  1YQ3 C;  5E79 E;  1L0N J;  1M56 D;  2P1J A;  1LTB C;  1YJW P;  2CPB A;  2OAR A;  2QM7 A;  2E76 B;  3OJA B;  4YPC A;  1M57 D;  3L75 J;  4N3Y B;  1CI6 B;  4BWN A;  3CWB J;  4ASV A;  2FYU D;  2OYI A;  1SQQ G;  1Q81 Q;  1FC2 C;  5M1B A;  2K9J B;  2HAP C;  3NMD A;  3JCU H;  3HRN A;  2QJP C;  1VQP P;  1HJB A;  2VRS A;  3L70 D;  3F89 A;  1R5L A;  3L73 G;  1BGY J;  5AW3 B;  2OGU A;  2Y0E A;  2ZVO B;  4JPZ B;  1EZV G;  3O6Q B;  2D2C D;  5AW7 B;  3GHG A;  3G9R A;  1JY3 N;  1OW7 A;  3PRJ A;  4RES B;  2IYP A;  4I7Z C;  3RBZ A;  5APW A;  1OZH A;  3L71 D;  1MZ9 A;  3AE3 C;  1N8R Q;  3AE4 C;  3IF4 A;  2Q1K A;  3I5C A;  1AFO A;  3RK3 E;  3VMZ A;  1NTM K;  2N9Y B;  2R44 A;  4ZMD A;  1VQ7 P;  1S5L X;  3KQG A;  2E74 B;  4WY4 C;  1S9K D;  2FFD A;  2O1K A;  3VP9 A;  2J58 A;  1AW6 A;  1FZC B;  3L74 J;  1PP9 D;  5TIS E;  3IAO A;  1L0N E;  2IBZ I;  3H32 B;  2NZ2 A;  3CL3 D;  4AUW A;  1K05 A;  4JBZ A;  2L5G B;  1YBK A;  2E74 C;  2FXM A;  2ITA A;  3AE7 C;  1FZC C;  2QE7 H;  3L75 E;  2ZXE B;  1FDI A;  3FWN A;  2ZYG A;  1KIL A;  2HLO A;  3CWB E;  3M9Q A;  4GKG A;  1URQ A;  5AVY B;  2WSE J;  2XU6 A;  5BU8 B;  1GK4 A;  3BCC G;  1M1K Q;  5CBN A;  2FYZ A;  2A06 E;  2NPS C;  1H8A A;  1ZN5 A;  1M1J B;  4Y28 J;  1K9M Q;  3B5N A;  2QVA A;  1BGY E;  2WVR A;  1KIL D;  1VF5 D;  3NXS A;  4YXD C;  1GL2 A;  1URQ D;  2DW3 A;  1SS1 A;  4R4M A;  1RE4 A;  4KHX A;  2P67 A;  1JNM A;  1JY2 N;  3WU2 E;  1PIX A;  3A0H H;  2JEE A;  3B5N D;  2M3E A;  3O8Z A;  1NO4 A;  4H44 B;  1NTK J;  3TGU J;  1LWU A;  1GL2 D;  3MUD C;  1GU5 A;  1EDI A;  4Y99 B;  3D70 A;  1S2E A;  2V7Q J;  1DEE G;  2JO1 A;  1KN7 A;  1SQV J;  4OH8 B;  1N86 A;  1OVV A;  1JY2 O;  1SQB G;  1SQQ E;  2IBZ G;  1R8E A;  2WPR A;  1Q90 D;  1JY2 P;  1HH0 A;  3L74 E;  3MHV A;  4H44 C;  2IX7 C;  5KJ7 A;  2OYI B;  2KIK A;  4JF7 A;  2D2C B;  3AE1 C;  1VQK P;  1AJY A;  3AE9 C;  1NTM G;  4BRY A;  2C0X A;  1JB0 J;  5DJT B;  1DX7 A;  1LT1 A;  1Y47 A;  1P84 D;  2Z5I A;  3RK2 D;  1NYH A;  4U3F G;  1EZV E;  2E5Y A;  2NRG A;  2YO2 A;  2RMZ A;  1HGZ A;  5KJ7 D;  1J1D C;  4O9B A;  3L72 G;  3H1L G;  3GHG B;  3UIA A;  3BCC D;  1S5L H;  3H1H G;  1VQ8 P;  4MN4 C;  4W7Y A;  3FXD A;  2KNC B;  2FKW B;  1H0T A;  2M5A A;  5TJH A;  5KAI H;  2YKO A;  3H25 A;  1KYO I;  3GHG C;  3NTN A;  3TK1 A;  1MV8 A;  5AVR B;  2H89 C;  3FXE A;  3M0D C;  2BCC D;  3CXH H;  2H7H A;  1RF0 C;  1VL2 A;  2AEJ A;  3CX5 E;  1NTM J;  2Y9Y A;  4EI2 A;  1JUN A;  2JWD A;  1T3J A;  1NTK E;  3TGU E;  2YXR B;  4U3F J;  1KFN A;  1D7M A;  3HTK A;  2KLU A;  1GD2 E;  1PPJ G;  4YTP C;  1JM0 A;  1HJ0 A;  2XZR A;  1NU1 D;  1FDO A;  3GW6 A;  2AEF A;  3P32 A;  1QGK B;  3H1L J;  4L73 A;  1R5S A;  1SQB D;  2IBZ D;  1W5C E;  1LP1 A;  2I1J A;  4NPD A;  1BE3 G;  1YQ4 C;  3D6Z A;  3H1H J;  2FXO A;  1URQ B;  3VYI A;  3C8V A;  2ALC A;  3LW5 H;  3BVH A;  2KLV A;  2B87 A;  3S4R A;  3M9H A;  3IFM A;  3A2A A;  1SFC A;  1NGM B;  1PYI A;  4B86 A;  1SQX D;  1L4A C;  3B5N B;  3GF3 A;  2ZAE B;  3AE5 C;  4H0L B;  5KLI B;  3Q2Y A;  2OYH B;  1KMI Z;  2M3B A;  3L72 D;  1A02 J;  2JKV A;  2XDJ A;  1F5E P;  1IC2 A;  4EYY Q;  1KQF B;  5CCG A;  2HYN A;  1OVR A;  1SFC D;  4UB6 E;  5KAF E;  2OTL P;  1KB9 D;  4IOI H;  1IFJ A;  1JCD A;  4HH2 A;  5B66 E;  4H0L C;  3VMA A;  5KLI C;  2HG5 D;  2OYH C;  1P84 H;  1LWU B;  1QX8 A;  4JYB A;  2N1T B;  2IFN A;  2A45 I;  3MGN A;  3EFG A;  3RK2 B;  2GM4 A;  5CCG D;  3USS A;  3VP8 A;  1BE3 J;  1FZG A;  1FE6 A;  1JMM A;  3MIW A;  1PGO A;  3A0B H;  1LTJ A;  5B5E H;  3CCM P;  1NTM E;  3PJS K;  3D6Y A;  1EDL A;  3VN0 A;  1L0L J;  2N1T C;  1VDF A;  1BCC D;  5AVZ B;  5H2F H;  4U3F E;  4BRY B;  1JTH B;  3IN6 A;  1KQL A;  1QVF O;  1PGQ A;  1QLE D;  3H1L E;  2KP8 A;  4N78 D;  2JR8 A;  1FDM A;  3ALC A;  3P8M C;  2E75 D;  4PV1 D;  2BEQ D;  1YYC A;  3H1H E;  1KQS O;  3L75 G;  1G1I A;  2AXT E;  1SQP J;  2OTK E;  1HTL C;  4HB1 A;  2Z4E A;  3HD7 A;  1ZW0 A;  4GOD A;  1H0T B;  1G2C A;  1OIP A;  2M5A B;  2ERE A;  3QH9 A;  3JCU E;  1KQG B;  3AEC C;  1X8Y A;  3CC2 P;  1LTT C;  3H1J J;  3CI9 A;  2G3A A;  1NTK K;  2O1J A;  2Q6Q A;  5GTH H;  4GDO A;  2FYN B;  3RL0 B;  3E1I A;  1ZR2 A;  2P7J A;  3HD7 D;  1RY3 A;  2H8P D;  5CCH C;  1SQV K;  1ZP0 C;  1LT9 A;  3C1L A;  1LJ2 A;  1PPJ E;  3Q5R A;  3HE5 B;  4GT1 A;  4PJ0 H;  2A45 G;  3KZI E;  4DCK A;  4A7P A;  3R4Y A;  3CX5 I;  3RL0 C;  2WPQ A;  4DZO A;  1PL5 A;  3RK3 D;  2WQY C;  1BE3 E;  2KS1 A;  1FZF A;  3AE6 C;  1NOH A;  4OGQ B;  1FZB A;  1LP1 B;  1S1C X;  2K88 A;  2H88 C;  2B87 B;  3KXD A;  3L74 G;  5GTI H;  1KB9 H;  2PRR A;  1L0N D;  2E76 C;  1RE3 A;  3V5B A;  4PD4 H;  1IFD A;  3V6I A;  5EFW B;  4OGQ C;  4U7J A;  2HOD A;  1SVF A;  2KUB A;  3B8E B;  2W27 A;  2N9B A;  3P8C E;  3L75 D;  1USD A;  5APQ A;  1ZRT E;  1SQP E;  3B4S A;  3GF7 A;  2ZT9 D;  1T8Z A;  3CWB D;  1KYO E;  2WSF H;  4ZKP A;  1L2P A;  5E79 H;  1NAY A;  4L75 A;  2A06 D;  3TYY A;  1E79 H;  1KD1 Q;  1PP9 J;  2KI7 B;  4EIJ A;  1BGY D;  2JJL A;  3H1J E;  1CZQ A;  1AQ5 A;  1VQM P;  1OX3 A;  4PV1 B;  2QA4 P;  3CMA P;  1M7L A;  3W68 A;  1OFC X;  2YKQ A;  3KPE A;  2I8D A;  3HUS A;  2PGD A;  1RQV A;  3L37 A;  5AVW B;  4C46 A;  3VTP C;  1NTK G;  1PGP A;  3TGU G;  2Q3E A;  2QJY B;  3QWO C;  1RF1 A;  1SQV G;  1JEK A;  1NKN A;  3MP7 B;  3PHL A;  1SLQ A;  1SQQ D;  1DD4 A;  1T2K D;  2C9L Y;  1YTZ T;  2KK7 A;  2LXB A;  2ERG A;  5AW4 B;  5K5G B;  2KZJ A;  1DD3 A;  2QSI A;  4RKU J;  3SWF A;  3EWK A;  3L73 D;  3TDK A;  1MFT A;  2W83 C;  3U1A A;  3PP5 A;  2YIU B;  5KLV K;  4WWI A;  4R4L A;  3BAT A;  3E7K A;  2BAS A;  2O01 H;  4ZKU A;  1EZV D;  3SWK A;  4Z1M H;  3TNU A;  1Q86 Q;  1EDK A;  3RBX A;  3RK3 B;  1M1J C;  4WVZ A;  1DEB A;  1ZV8 A;  5APY A;  1D66 A;  5AW8 B;  3SFD C;  2KOG A;  5TIS H;  2YIU C;  4DOJ A;  1PP9 E;  4UB8 H;  3CC4 P;  1S3J A;  1Y9B A;  1BDD A;  5APS A;  2W6J H;  3HE4 A;  1L0L K;  2R5D A;  1FOS E;  3LID A;  2AXC A;  1NKZ B;  1DIP A;  2WMM A;  1GMJ A;  4ASW A;  4NPE A;  1T6A A;  1U7J A;  3WUT A;  2FXP A;  1VQ5 P;  2YKP A;  2WT7 A;  4YXW H;  2B89 A;  1EXI A;  4HKZ H;  4Y99 C;  1T3U A;  5AVT B;  3CX5 D;  1IO4 A;  1FJP A;  2ZT9 B;  1XTC C;  2M8R A;  4EOT A;  4I1L A;  3CXH E;  1ZXG A;  2GA1 A;  1ZR4 A;  3H1K G;  3I56 P;  1NTZ K;  3FWL A;  1SQP K;  2HOD B;  4HYT B;  5KTB A;  2OYI C;  1N73 A;  1X0T A;  1KTM A;  2D2C C;  2K3R A;  1PYC A;  3S9O A;  3II6 A;  3V2R A;  2ER8 A;  3CCS P;  2ZVN B;  5AW6 B;  3SFE C;  3VOP A;  2IFM A;  4H13 D;  1OW6 A;  1K8A Q;  3FX0 A;  3PH0 A;  4D6T G;  2Z5H A;  1EC5 A;  2QJK B;  3WUV A;  1J2J B;  2WPV B;  3G71 P;  1W2B O;  1VQ9 P;  4XA4 A;  2Q3I A;  2FYU K;  2FFD B;  1AVY A;  1HGV A;  1OMI A;  2Q5U A;  3V4Q A;  2QJK C;  3U59 A;  1EDJ A;  1LTA C;  2J59 M;  3H1K J;  1KZU B;  3K5B A;  3HUS B;  2OTJ P;  1UII A;  2FFD C;  1BDC A;  1SQV E;  3JSV C;  1BSN A;  3CCU P;  1SQX J;  2ZXX A;  1X79 B;  1RF1 B;  1KIL B;  1QP9 A;  1VF5 B;  3FGA D;  1PZQ A;  4D6T J;  1JMB A;  3SSU A;  3V2Q A;  1NTM D;  2B9B A;  1Q2N A;  5B5E E;  2W6A A;  2R32 A;  1L0L G;  2C9N Y;  1FBM A;  1J1E B;  4IL6 X;  3CCV P;  4U3F D;  5C39 A;  4WBA A;  1CSB A;  1KIL C;  1VF5 C;  5H2F E;  4HJG H;  1URQ C;  1NVO A;  1GL2 B;  2K37 A;  5CBO A;  3H1L D;  3VMX A;  5AW1 B;  3AEB C;  1QEX A;  4K3A A;  3TSI A;  3AEF C;  2WSS H;  3M91 A;  3H1H D;  3B5N C;  4DT0 A;  5KLV J;  1RQU A;  1NTZ G;  1OW8 A;  1SQP G;  1RH5 B;  4I2L C;  3H1I J;  3MD0 A;  2ZJS E;  1GL2 C;  3B71 A;  2PFX A;  1AV1 A;  1RE4 C;  1NJI Q;  2WSF J;  4WY4 A;  3P7K A;  3HE4 B;  2V7Q H;  3CME P;  4L74 A;  1XTG B;  2ZYA A;  2RH0 A;  2E5T A;  1JO5 A;  3AED C;  3H1J G;  2POH A;  1Q82 Q;  3H6P A;  1OWA A;  1VQL P;  4LC1 A;  3C9I A;  2KSE A;  1LWU C;  3ABV C;  3H1K E;  1AVO A;  3RK2 C;  1UIX A;  1PPJ D;  4H13 B;  2HFE D;  4WY4 D;  4TT3 H;  1FZC A;  2R5B A;  2IYO A;  2FYU G;  1N2D C;  3MZW B;  2R3S A;  5KJ7 C;  1WT6 A;  2YMY A;  3CXH I;  1BE3 D;  2Y0D A;  1OVU A;  3L70 G;  3L35 A;  2NPS A;  2E74 D;  4D6T E;  1NTZ J;  2CK3 H;  1IFP A;  2GUV A;  3I55 P;  1PV3 A;  3CC7 P;  4UB6 H;  2HR3 A;  4DJG A;  5KAF H;  2HPC A;  4TLF A;  5GTI E;  1BSH A;  1PGJ A;  1NAF A;  3Q3D A;  1FZA A;  1GDT A;  4WB4 A;  2Q9I A;  4PD4 E;  3NFQ A;  2NPS D;  3AEG C;  4IFF A;  2WWW A;  3D71 A;  5KLV E;  5APT A;  4RO0 A;  2LR2 A;  1AA0 A;  1ZRT D;  4AYC A;  4LGD E;  3H1I E;  3MUD A;  1KYO D;  2K9Y A;  1LTG C;  3CLQ A;  2FYU J;  3HTK B;  2W8Z A;  3ITK A;  1PP9 G;  2FYN C;  3L70 J;  4IL6 H;  1VPC A;  1HUC A;  3H1J D;  2H43 A;  4N78 E;  1IFN A;  2Y0C A;  1MUU A;  5AW9 B;  2WTY A;  3T97 A;  2GUS A;  1L0L E;  2QJP B;  1Q7Y Q;  2XNX A;  2AXT H;  1YJN P;  3N4X A;  1P84 I;  3CCJ P;  3PTZ A;  1SFC B;  1FJK A;  1IK7 A;  4LLH A;  2PP6 A;  1USE A;  4I6M C;  4C7N A;  2UWJ E;  1Z56 A;  4H44 D;  2E42 A;  3L71 J;  4CPG A;  1F4S P;  1KC8 Q;  1U7M A;  5CMZ A;  2IZ0 A;  4I7Z B;  1NTZ E;  1SFC C;  2J5U A;  3WMM 0;  1IJD B;  3AE2 C;  1HVV A;  3CPW O;  2P58 A;  2MKV A;  5APU A;  2RN0 A;  3M0A A;  1NU1 K;  5AVU B;  3KZI H;  5AVX B;  1VQ4 P;  5CCG C;  1SQB K;  2WSC H;  4WY4 B;  2O01 N;  2IPP A;  3M0D A;  3BRV B;  3G6E P;  2KNC A;  3N7N A;  1RF0 A;  4JQ0 D;  3W67 A;  1LTJ B;  1X22 A;  5AW0 B;  4AQR D;  2E75 B;  1GK6 A;  3L4F A;  3OA7 A;  1SQX K;  2KYV A;  1JY3 O;  2FYU E;  1HBW A;  1SP4 A;  1SQQ J;  1JY3 P;  3A0H E;  1N7L A;  2IZ1 A;  3G4S P;  1LTJ C;  2B88 A;  2P10 A;  2G8Y A;  3OAK A;  2E43 A;  2RKL A;  3L70 E;  2E75 C;  4PV1 C;  4UB8 E;  4N6J A;  3L73 J;  5CJ0 A;  1NWQ A;  2KSJ A;  3CCQ P;  2NPS B;  3L74 D;  1IFM A;  2OQQ A;  4XE5 B;  3V2P A;  2YXQ B;  1L4A A;  1A02 F;  3CCR P;  3HD7 B;  1KYO H;  1VQ6 P;  2CPS A;  2QJY C;  2HPC B;  3SWY A;  3LW5 J;  1G2C B;  3CXH D;  3U1C A;  3L71 E;  2FBW C;  4C7R A;  1LTI C;  3KDP B;  3HD7 C;  1L4A D;  1KB9 I;  2AEM A;  1S9K E;  1KV4 A;  1LT9 B;  4PD4 I;  1NH4 A;  2OYH A;  2YNY A;  1GTW A;  1QL1 A;  1IK9 A;  1ZOY C;  4ZNC A;  2C0W A;  1S5L E;  5AVS B;  2WZ7 A;  1GW3 A;  2BCC G;  3RK3 C;  4IFD K;  3A5T A;  2KS1 B;  3AEA C;  5CJ4 A;  5KAI E;  1LT9 C; 
#chains in the Genus database with same CATH homology
 4H0L B;  4H0L D;  4KT0 J;  3COQ A;  3FGA D;  3Q2Y A;  3AE3 C;  4R4M A;  3AE4 C;  1KMI Z;  2ERG A;  2YMK A;  2P10 A;  2WSC J;  1F5E P;  3RK3 E;  2G8Y A;  3Q5S A;  3Q1M A;  1KQF B;  1KTM A;  2D2C C;  3T97 B;  1HF9 A;  2E75 C;  4PV1 C;  1PYC A;  1DD3 A;  2QSI A;  5KKZ C;  4RKU J;  1K04 A;  1YQ3 C;  3EWK A;  1ZRT E;  1PIX A;  3S9O A;  1HWT C;  2ERE A;  3RL0 g;  3H25 A;  3GF7 A;  1IK7 A;  4IL6 X;  2ZT9 D;  2ER8 A;  1S5L X;  2E74 B;  3Q5P A;  1KQG B;  2E74 D;  1VF5 C;  3AEC C;  4R4L A;  3SFE C;  4H44 B;  4H13 D;  4H44 D;  1OW6 A;  4H0L C;  1AW6 A;  2G3A A;  5KLI C;  2OQQ A;  2H89 C;  4Z1M H;  1PV3 A;  4GDO A;  3D70 A;  1F4S P;  2JP3 A;  3IAO A;  1VL2 A;  2E76 B;  3AEB C;  3GMA A;  2V7Q J;  2JO1 A;  1EXJ A;  2QJY C;  3AEF C;  4I7Z B;  1ZME C;  2NZ2 A;  1D66 A;  1ZP0 C;  1K05 A;  2ZT9 C;  3LW5 J;  2WPV B;  1KIL E;  2J5U A;  3SFD C;  3Q5R A;  1TU3 F;  3AE2 C;  3Q3D A;  1R8E A;  1Q90 D;  2E74 C;  1RQU A;  2YIU C;  1OW8 A;  4H13 C;  4H44 C;  4YTP C;  4XFJ A;  3AE7 C;  5M1B A;  1HJ0 A;  2IDB A;  3AEG C;  2FBW C;  2MKV A;  3R4Y A;  2BEZ F;  5L8R J;  2HAP C;  1Y9B A;  2D2C B;  3D6Y A;  1FDO A;  3AE1 C;  3B71 A;  1AJY A;  1OMI A;  4PV1 B;  3AE9 C;  3D71 A;  1PL5 A;  2QJP C;  2E76 D;  2WQY C;  1FDI A;  2QJK C;  2WSF J;  1JB0 J;  3AE6 C;  4OGQ B;  1YQ4 C;  4OGQ D;  1NYH A;  3D6Z A;  1DIP A;  3GLM A;  2WSE J;  3C8V A;  1S1C X;  2ALC A;  1GMJ A;  3IN6 A;  3AE8 C;  1RQV A;  2K9Y A;  3AED C;  2FXP A;  1ZOY C;  1WMK A;  3O6Q A;  2H88 C;  2QIW A;  1EXI A;  2E75 B;  3ALC A;  2D2C D;  1NGM B;  2FYN C;  4Y28 J;  2E75 D;  1PYI A;  1KOR A;  2E76 C;  4PV1 D;  3ABV C;  2BEQ D;  1U57 A;  2ZT9 B;  3AEE C;  3G9R A;  1MKM A;  3GF3 A;  1OW7 A;  4I7Z C;  3AE5 C;  2O01 J;  1QP9 A;  4OGQ C;  1UIX A;  1VF5 B;  3AEA C;  4H13 B;  4U7J A;  1VF5 D;  4TT3 H;  4YXD C;  1DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...