1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
molecule tags Transcription regulation
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
3IN6A 3COQA 3ALCA 1ZMEC 1HWTC 2EREA 1WMKA 1D66A 3EWKA 3H25A 2ER8A 1AJYA 1FDIA 2ERGA 2P10A 3O6QA 2G8YA 1F4SP 1OMIA 2HAPC 1PYIA 1AW6A 1F5EP 1FDOA 2ALCA 1PYCA 1QP9A
chains in the Genus database with same CATH superfamily
3H1JD 3SWYA 3BASA 1FAVA 4WBAA 1T8ZA 1VQ7P 2WSCH 2Y0CA 4LLHA 2BCCD 4GODA 1T3JA 1W5CE 1L4AD 1SQPD 1NTMK 3BCCG 4U7JA 1JB0J 3L72E 3U1CA 3USSA 1DD4A 3M91A 2K9JB 4A7PA 4EIJA 4I7ZC 1EXIA 1PGPA 4PJ0H 1S4XA 1NTKG 5B5EH 3RGUA 5GTIE 2Y0EA 1MKMA 3LW5J 1GW3A 3VN0A 1LP1A 3L73J 2SPZA 3GHGA 2W83C 2C0WA 2Q7CA 3AE4C 3D71A 2N9YB 3A2AA 1QVGO 5B66E 4KT0J 1WMKA 4JQ0D 1N7SD 3HE4A 1FDIA 1HJ0A 1X0TA 4I6MC 3CWBG 1EZVE 3L75D 4PV1B 2WPVB 2KUBA 2Y9YA 3BATA 4MN4C 1SQQG 4WY4C 2OQQA 2D2CC 1VQ9P 3ALCA 1NGMB 2RKLA 1SFCC 3TNUB 2WITA 3H1JJ 2WVRA 2YMYA 1VQ5P 4N78E 1ZOYC 1RE4A 1LGHB 1JMBA 2K9YA 1CI6B 2FXPA 1OX3A 2BCCJ 3A3YB 5BU8B 1KC8Q 3PP5A 2A45G 3SFEC 1SQPJ 2N1TD 1KILD 2QEXP 2ZYDA 1S2EA 1URQA 5GTHE 1HWTC 2JO1A 1KORA 3CCRP 3Q2YA 1OZHA 5AW1B 3O6QA 4L74A 1N7SA 1JM0A 3CCUP 1G2CB 5AVQB 2JDIH 1GK6A 2K88A 2B87A 1NU1E 3KQGA 3VP9A 2UWJE 1MZ9A 4AYCA 2P10A 1GL2B 1DEEG 2QJKC 3GHGC 1UIIA 3CCMP 4JF7A 1SQBE 1NOHA 2IZ1A 4RJTA 5APYA 2G3AA 3H1KG 3I56P 2N1TA 1KILA 3HE5B 1Q7YQ 1OVUA 2Z5HA 5AW4B 3CXHE 3IAOA 4UB6H 5APTA 2W27A 1QVFO 2WSCJ 4HKZH 1A02F 2ER8A 2Z5IA 2A06D 1AA0A 1BE3J 4D6TG 3CCJP 2AEMA 3UIAA 1RE4C 1VDFA 2OARA 1J1EC 1NTME 3PH0A 4H0LB 1SQXG 3H32B 1E5WA 2H88C 1URQC 3II6A 2YXQB 2B9BA 2BASA 3HUSA 2WTYA 2QJPC 3PLNA 1RE3A 3T97A 1YITP 3VP8A 2G8YA 5AVUB 1FS0E 3V4QA 3L71D 4QMAA 3TSIA 1P84E 1N7SC 2ZYGA 5AW6B 3IN6A 1AFOA 3H1LG 3RK2C 4OH8B 5KLVK 1IFMA 5H2FH 2H8PD 3RBZA 3VMYA 3H1HE 3A0BE 2B89A 4UB6E 3BCCD 1GDTA 1LTJA 2Q1KA 4L73A 1Z56A 2HODB 3CC2P 1HUCA 1NTKD 3H25A 1XTGB 2OYIA 3HD7D 3VMZA 2V4HA 2N1TC 2GUSA 4LC1A 1KILC 4OWFA 3V2RA 3SWKA 3C9IA 3N4XA 2WT7B 3SFDC 1NTZG 2W6JH 4ASWA 3WU2H 1VQ8P 1NAYA 1QEXA 3CWBD 1L0NK 3L70J 3CCSP 1QX8A 3FWLA 1SQQD 1RQUA 2LKMA 3I5CA 3P8CE 1H88A 1PP9J 3L71J 3V2NA 1IC2A 2ZT9C 1M56D 5AVSB 2FXOA 3TGUE 3HUSC 1OXZA 4DT0A 3A7OA 1RE3C 4HYTB 2ZVNB 4U3FJ 1RHZB 5CBOA 1LTAC 2KNCB 3L36A 3HD7A 3FWNA 3NXSA 4IFDK 1SQVD 1HBWA 1X79B 3CCLP 1NTKJ 4GDOA 2QVAA 2E42A 1LTJC 1SQPK 4R4LA 2FFDA 3H1IE 2CPSA 1S9KD 3QH9A 4EI2A 2P2UA 3GF7A 1VL2A 1ZW0A 2IBZD 2E76D 3L74D 3CCQP 1AJYA 2OYIC 1IFPA 4H44B 2KZIA 1YQ3C 2FKWB 1T2KD 3L75G 2AXTH 2KZJA 4NPFX 2YMKA 5KLIC 4EYYQ 1ZRTD 1G1JA 3RK3E 2FYZA 1VQNP 3E7KA 1L0LG 3AEBC 3H1KD 1CSBA 4PD4E 3LIEA 4XA4A 1PV3A 1A02J 2JEEA 1KTMA 2R44A 2I8DA 5KLVE 4RO0A 1IO4A 3CC7P 1S5LH 3U1AA 1LT9B 4Y28J 5AW0B 5TISE 4Z1MH 2VRSA 2YO2A 2GM4A 2R3SA 2E5YA 4C7NB 1KB9D 3WUUA 1QP9A 3HD7C 5C39A 4ZKPA 1ZP0C 5AVRB 2Y9ZA 4GKGA 3ITKA 1NKNA 1OIPA 1OW7A 1SFCD 1LTBC 1LWUA 5DJUB 1JTHB 4IL6E 1RF1A 2FFDC 4RKUJ 2CPBA 2YKQA 4PV1D 1U7MA 1IFNA 3L73E 3AE3C 4CPGA 1FBMA 3RBXA 2KI7B 1M1JB 4EOTA 5APUA 2PP6A 1YI2P 3MGNA 2E75B 1HVVA 1YIJP 2K9JA 5CHXA 1VPCA 1M57D 2A06G 4W80A 4WB4A 1IFJA 3PHLA 3VMXA 4D6TJ 1N8RQ 4H13B 2HAPC 1YYCA 3E1RA 1DH3A 1BCCJ 3H1JE 2JJLA 1SQXJ 5M1BA 1H0TA 1BGYD 2BCCE 3HTKB 3BRVB 1SQPE 2KB7P 2OYOA 2E76C 1S1CX 4GT1A 3C8VA 3JCUH 2O1KA 1FE6A 2E74B 2L5GB 3ZDMA 2IFNA 3M0DA 1JY2P 2J5UA 3H1LJ 1OW6A 1T2KC 1GL2D 1NYHA 5KKZC 3TNUA 1PL5A 1JNMA 2IX7C 2ZJSE 2MJZA 1ZN5A 5CJ4A 3GLMA 5APQA 1LWUC 1RF1C 1PYCA 2A45I 1KYOD 2QM7A 1GTWA 2L91A 2ITAA 3RK3B 2KP8A 3C1LA 1VF5D 4N3YB 2QJYB 3CX5D 1H8AA 1URQD 4EDFA 1F4SP 1L0NJ 1KMIZ 1JMMA 1NVOA 2WSFH 5AVWB 4ASVA 1FZCB 1NTZJ 2IBZI 3Q5PA 3TDKA 1MFTA 1NTKK 3IF4A 3RK2D 1NAFA 1GL2A 1OFCX 2H7HA 1L0LD 1USDA 1BE3E 3RL0g 1K05A 2XZRA 1AVOA 2Q3IA 1FOSF 2KLUA 3S1KA 1DIPA 1ZR2A 3A0HH 3HE5A 3CPWO 4PV1C 2C9LY 4PJ0E 1FZEA 5B5EE 2QRXA 3M0DC 3MIWA 2FYNB 2FYUG 4NPDA 1JY2N 3B5NB 1SQVG 1EZVD 3M9HA 1JCDA 2KSJA 1AQ5A 1KB9I 3AE2C 2Q9IA 2IZ0A 2M5AA 3H32A 2IBZG 4N78D 1RH5B 3L74G 3F5HA 2IDBA 5DJTB 3TGUG 1NKZB 2H89C 2ZT9D 1J1DB 2OTLP 1Y47A 1JOCA 3M9BA 1SVFA 1NJIQ 3L75J 3U59A 1LTSC 1FZBA 1ZLLA 5AW9B 3AE6C 1PZQA 2P67A 2HFED 1L0LJ 3G4SP 3KXDA 5AVZB 4YPCA 1FDOA 2WPSA 1L4AB 1GL2C 1TU3F 2W6AA 1NU1D 4WWIA 1R5LA 2HODA 3V4WA 1YJWP 1J1EB 3AECC 3L70E 3D6YA 3A5TA 2O01H 4OVNF 1PP9E 3L71E 4Y99B 4BRYB 3P32A 3SWFA 1SQBD 1VF5C 3WUTA 2WT7A 5AVYB 1GU4A 1OVVA 2R32A 2LXCB 4U3FE 1PGOA 2Q3EA 2WSFJ 2IYOA 3CXHD 3RL0B 1QL2A 3N7NA 1SQXK 4H44D 3OAKA 1HH0A 5KAFH 2A45H 3IR9A 1YJNP 4KJMA 3CMEP 1NTKE 3MZWB 3G3ZA 5BVZA 1KFMA 2LXBA 1YTZI 1AW6A 1ZV8A 4I2LC 1YQ4C 2FY8A 1EDLA 2NRGA 3AE1C 1KD1Q 1KYOI 2KNCA 3VTPC 3CL3D 5KJ7A 4JBZA 1KILB 3CMAP 1AVYA 2M8RA 4W7YA 3G6EP 3CX5I 4ZNCA 1YTZT 1BDCA 1GU5A 4DCKA 1HGZA 1KFNA 3TK1A 1YJ9P 3H1HD 3CLQA 1XTCC 2O01N 3D70A 3KYQA 1JUNA 1BGYG 5K5GB 1LT1A 2CK3H 2Q6QA 4K3AA 1PYIA 1HTLC 1PPJG 3S9OA 5H2FE 1MV8A 3COQA 2YKOA 1ZR4A 2YIUC 3HUSB 1NTZK 1YHQP 3AE8C 2V7QH 2N9BA 5AW7B 1EQ7A 1N73B 4GIFA 2GUVA 3PJSK 2OYHB 5AVTB 1DD3A 1S9KE 3BCCJ 4AQRD 4UB8H 2NPSB 5TJHA 1KB9H 2FYUD 2BEQD 2ZYAA 4ZKUA 1EC5A 4OGQB 2WPRA 1WRGA 4RESB 1LT9A 1RF0A 1LNQA 1EZVI 2KS1B 4GOEA 5KAIH 3CCVP 4XE5B 4YXWH 3WU2E 2OTKE 1M7LA 1ZRTE 2JR8A 5KJ7C 1K73Q 3TGUD 2HPCB 5E79H 2O01J 2HLOA 5KLIB 3CWBJ 3L72G 1FJKA 3LIDA 1JTHA 1SQQJ 1PGQA 4KHXA 4D6TE 1KZUB 2ZVOB 2E74D 3OA7A 2XNDH 4H44C 1BCCE 2W90A 2W8ZA 1SQXE 3EFFK 1JY3P 1SP4A 1MFZA 1NH4A 1L0LK 1S3JA 1LJ2A 3E1IA 3MD0A 2FYUJ 2WPQA 1SQVJ 1EZVG 1K8AQ 1OMIA 3HD7B 5AVVB 1U57A 1LTTC 3CCEP 3RK3D 3AEEC 3H1LE 2AEFA 5CJ0A 2POHA 4N6JA 2AXTE 3L74J 1LT9C 2FFDB 1RF0C 3KZIH 4WVZA 1R5SA 2O1JA 3HTKA 2I1KA 2IYPA 2JWDA 3CXHI 5CCGD 2ZFCA 2M3EA 3NFQA 1L0NE 1KYOH 3H1KJ 1IZNB 1BDDA 1S5LE 4HJGH 2WSEH 3SSUA 1FC2C 4NPEA 3CX5H 1NTZE 2WSSH 2PRRA 2V7QJ 2PFXA 1N2DC 1NU1G 4O9BA 2PAJA 3MUDA 2WWWA 2IFMA 2KK7A 2JWAA 4DZOA 2JP3A 1P84I 1JEKA 3GMAA 1BSNA 1KQFB 3B5ND 1SQBG 1HJBA 2QM8A 3L4FA 4R4MA 1JY3N 2OGUA 1PIXA 1FZAA 2E75C 1FZCA 2RH0A 2HG5D 3S4RA 5CCGA 1PPJD 4IL6X 3AE9C 1Y9BA 5KKZB 4C46A 1DEBA 3L70G 3G9RA 5B66H 3K5BA 1NTMG 5CBNA 1Q81Q 1PP9G 4I7ZB 1CI6A 1YBKA 1AV1A 2M3BA 1ZMEC 2E74C 1H89A 2KSEA 1FU1A 4U3FG 3B5NA 3L75E 2XNXA 1IFDA 1RQVA 4IFFA 2YKPA 1L0LE 1G2CA 3D6ZA 4IOIH 3MUDC 4L76A 4H0LD 1PGJA 3JCUE 5GTHH 3P7KA 3RK3C 3H1HG 3MHVA 4WY4B 2D2CB 3L72D 4DOJA 2QJYC 1BGYJ 1SFCB 2K37A 1HF9A 3JSVC 1KILE 2RN0A 3W68A 1H0TB 4LGDE 1T3UA 3KPEA 1X22A 3ABVC 3NTNA 1FZCC 3RL0D 3PRJA 4GOFA 1JY2O 5CCGC 2KLVA 1CZQA 1SQQK 1L4AA 4JYBA 1D66A 1VQ6P 2WSEJ 1U7JA 5AW2B 1HGVA 2ZAEB 1T6AA 1GMJA 4BRYA 1BE3D 2WMMA 3EWKA 2FYUK 3CXHH 1SQVK 2FYNC 1LP1B 3B5NC 3GF3A 3TYYA 2QJKB 4PD4I 3GHGB 2E5TA 2HYNA 2OTJP 1FJPA 2YO3A 2LR2A 2XDJA 3L72J 3FX0A 3HE4B 3M0AA 5BU5A 2QE7H 2R5BA 3A0HE 5APSA 3NMDA 3CC4P 1BSHA 2A06E 2XU6A 4B86A 1GZLA 3AEAC 2R5DA 3H1IG 1J1DC 2J58A 1Q82Q 1EDIA 1P84H 1KQSO 1OW8A 1OWAA 3BVHA 2O3JA 1M8OB 2Q5UA 3BRTB 5KJ7D 1K04A 1VF5B 2NPSD 3HRNA 1URQB 1X9VA 3A0BH 1FOSE 4OGQD 4JPZB 1L4AC 2NZ2A 3H6PA 2QJPB 2BEZF 2AXCA 3O6QB 2K3RA 2QSIA 3MP7B 3AEGC 2YXRB 4XFJA 1N7SB 4K35A 3BCCE 1BCCG 5CCHD 3RK2B 2B87B 2M5AB 4H0LC 4Y99C 1IK9A 1GD2E 5KLVG 3L70D 1LTIC 1MUUA 1FZGA 2YNYA 1NTMD 1LTGC 1JO5A 1KQGB 1RY3A 1PP9D 3VOPA 3W67A 4I1LA 1N73A 3QWOC 5AW5B 3VYIA 2OYHA 2QIWA 3RL0C 2Y0DA 3Q5SA 2N1TB 2NPSA 1SLQA 1NU1J 4U3FD 4C7RA 1FZFA 2AEJA 4ZMDA 1QGKB 3CWBE 3V2QA 1P84D 1SS1A 1W2BO 2KS1A 1SQQE 3O8ZA 1CW5A 1IK7A 4IFMA 4W7ZA 1VQ4P 1QL1A 2DW3A 3GW6A 3R2PA 4BXLA 1SQBJ 4AUWA 4YTPC 3FGAD 5CCHA 1L0NG 1WT6A 1KN7A 2PGDA 3L73G 5EFWB 3B4SA 5L8RJ 2W6BA 2HPCA 1Q2NA 2IPPA 2YIUB 1GW4A 1S72P 5KAFE 2ZT9B 3FXEA 2Z4EA 3EFGA 1Q86Q 4TLFA 2XKMA 2FYUE 3L35A 3T97B 1SQVE 3PTZA 2ERGA 2HR3A 3WMM0 1NTMJ 1PFIA 1VQPP 1Q90D 2KOGA 2R3CA 1E79H 1NHLA 1QLED 3H1JG 2EREA 3AE7C 1D7MA 1AQTA 1R8EA 3B71A 2IBZE 2B88A 3L74E 3G71P 1J2JB 1LTJB 2BCCG 1L2PA 1SQPG 2E43A 1IJDB 2K1AA 3P8CD 1N73C 2C9NY 2E75D 4C7NA 4JYCA 3I55P 4PD4H 2OYIB 2OYHC 3L37A 3JC22 2C0XA 4H13D 2NPSC 3H1KE 4TT3H 1Y8AA 4OGQC 2QG4A 3KDPB 3H1HJ 1EDKA 4BWNA 5TISH 2KIKA 2P7JA 3M06A 5AW8B 3OW2O 5CCHC 4HB1A 1OVRA 2WZ7A 3R4YA 4YXDC 1VQMP 2XV5A 4UB8E 3H1ID 1KB9E 2ZXEB 2FBWC 3Q5RA 4IL6H 2ZXXA 3VMAA 1M1JA 2RMZA 1VQLP 5KAIE 2KYVA 1NWQA 1F5EP 3WUVA 3LW5H 1VQOP 1KQLA 2JKVA 3P8MC 5E79E 1BE3G 1DX7A 4D6TD 1USEA 1JCCA 5AW3B 4PD4D 3TGUJ 1BCCD 3AEDC 1SQXD 1N86A 2J59M 3F89A 5APXA 3AE5C 5KLVD 2P1JA 1KV4A 2FXMA 1ZXGA 4WY4D 2D2CD 3CD6P 3V2PA 3IFMA 5APVA 3Q1MA 1EXJA 3TF5A 5KTBA 2H43A 3H1LD 3B8EB 1EDJA 3OJAB 3KHUA 5AVXB 3H1IJ 3M9QA 5CMZA 4M3LA 1G1IA 2GA1A 4L75A 1M90Q 3MTUE 1BGYE 1JY3O 3V6IA 1NO4A 2ALCA 1PPJE 3AEFC 1GK4A 3FXDA 1UIXA 1W2EA 2P58A 1M1KQ 1NU1K 4DJGA 3KZIE 1L0ND 5APWA 1M1JC 3L73D 2QA4P 2E76B 4HH2A 2WQYC 3V5BA 5GTIH 3CI9A 4WY4A 1NTZD 4H13C 1VQKP 1FDMA 1X8YA 1KYOE 1SFCA 1SQBK 1IFIA 2M0BA 1K9MQ 5KLVJ 3GG2A 1N7LA 1LWUB 2KXPB 2MKVA 1RF1B 2I1JA 3CX5E 3EQ2A 3L71G 1S5LX 3Q3DA
chains in the Genus database with same CATH topology
1RQVA 1TU3F 3AE5C 1KTMA 1HWTC 2H88C 2QIWA 2V7QJ 2JO1A 2ZT9C 1KORA 3D6ZA 3Q5SA 3RL0g 1K05A 4Y28J 3Q2YA 5M1BA 3AECC 4H13D 2D2CD 4H0LD 3D6YA 4TT3H 4Z1MH 2QJPC 3D70A 2E74D 3O6QA 2G8YA 4OGQC 1DIPA 3Q1MA 2D2CB 1EXJA 3AEAC 2E76C 2JP3A 4U7JA 4H44C 1S1CX 1JB0J 2QJYC 3GMAA 3C8VA 3S9OA 1QP9A 4PV1C 2E74B 1DD4A 3IN6A 1KQFB 1IK7A 3COQA 1HF9A 1VF5C 2YIUC 4I7ZC 1EXIA 1KILE 1ZP0C 4R4MA 1OW8A 2J5UA 1OW6A 3AE8C 4YTPC 1NYHA 3FGAD 1PIXA 5KKZC 3ABVC 2E75C 1PL5A 1MKMA 2P10A 5L8RJ 1OW7A 3LW5J 4GDOA 1OMIA 3R4YA 4YXDC 3GLMA 1U57A 1K04A 2ALCA 1VF5B 4IL6X 4R4LA 2WSFJ 1PYCA 4RKUJ 2QJKC 3AE9C 1Y9BA 3AEFC 2ZT9B 3AE4C 3AE2C 1DD3A 3D71A 1UIXA 3AEEC 3GF7A 4OGQD 2FBWC 1VL2A 2NZ2A 3Q5RA 4KT0J 2E76D 4H44D 1WMKA 1D66A 2BEQD 3H25A 2BEZF 4PV1D 2IDBA 3T97B 1AJYA 2G3AA 1FDIA 4OGQB 3G9RA 2QSIA 1HJ0A 1VF5D 2E76B 4H44B 3AEGC 2ERGA 2H89C 3AE3C 1F4SP 1YQ3C 4XFJA 2ZT9D 4PV1B 2WQYC 2WPVB 1KMIZ 2WSEJ 1AW6A 1F5EP 1PYIA 1YQ4C 4I7ZB 1Q90D 2YMKA 5KLIC 2OQQA 4H13C 2D2CC 4H0LC 3SFDC 1GMJA 3IAOA 1ZRTE 3AE1C 3ALCA 1NGMB 3RK3E 1ZMEC 2WSCJ 2E74C 2EREA 2E75B 3AE7C 1R8EA 3AEBC 3B71A 3EWKA 2ER8A 3AE6C 3Q5PA 1ZOYC 2O01J 2FYNC 2K9YA 2MKVA 3GF3A 1KQGB 2FXPA 4H13B 4H0LB 2HAPC 1FDOA 1RQUA 3AEDC 1S5LX 1PV3A 3SFEC 2E75D 3Q3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IN6 A;  3COQ A;  3ALC A;  1ZME C;  1HWT C;  2ERE A;  1WMK A;  1D66 A;  3EWK A;  3H25 A;  2ER8 A;  1AJY A;  1FDI A;  2ERG A;  2P10 A;  3O6Q A;  2G8Y A;  1F4S P;  1OMI A;  2HAP C;  1PYI A;  1AW6 A;  1F5E P;  1FDO A;  2ALC A;  1PYC A;  1QP9 A; 
#chains in the Genus database with same CATH topology
 3H1J D;  3SWY A;  3BAS A;  1FAV A;  4WBA A;  1T8Z A;  1VQ7 P;  2WSC H;  2Y0C A;  4LLH A;  2BCC D;  4GOD A;  1T3J A;  1W5C E;  1L4A D;  1SQP D;  1NTM K;  3BCC G;  4U7J A;  1JB0 J;  3L72 E;  3U1C A;  3USS A;  1DD4 A;  3M91 A;  2K9J B;  4A7P A;  4EIJ A;  4I7Z C;  1EXI A;  1PGP A;  4PJ0 H;  1S4X A;  1NTK G;  5B5E H;  3RGU A;  5GTI E;  2Y0E A;  1MKM A;  3LW5 J;  1GW3 A;  3VN0 A;  1LP1 A;  3L73 J;  2SPZ A;  3GHG A;  2W83 C;  2C0W A;  2Q7C A;  3AE4 C;  3D71 A;  2N9Y B;  3A2A A;  1QVG O;  5B66 E;  4KT0 J;  1WMK A;  4JQ0 D;  1N7S D;  3HE4 A;  1FDI A;  1HJ0 A;  1X0T A;  4I6M C;  3CWB G;  1EZV E;  3L75 D;  4PV1 B;  2WPV B;  2KUB A;  2Y9Y A;  3BAT A;  4MN4 C;  1SQQ G;  4WY4 C;  2OQQ A;  2D2C C;  1VQ9 P;  3ALC A;  1NGM B;  2RKL A;  1SFC C;  3TNU B;  2WIT A;  3H1J J;  2WVR A;  2YMY A;  1VQ5 P;  4N78 E;  1ZOY C;  1RE4 A;  1LGH B;  1JMB A;  2K9Y A;  1CI6 B;  2FXP A;  1OX3 A;  2BCC J;  3A3Y B;  5BU8 B;  1KC8 Q;  3PP5 A;  2A45 G;  3SFE C;  1SQP J;  2N1T D;  1KIL D;  2QEX P;  2ZYD A;  1S2E A;  1URQ A;  5GTH E;  1HWT C;  2JO1 A;  1KOR A;  3CCR P;  3Q2Y A;  1OZH A;  5AW1 B;  3O6Q A;  4L74 A;  1N7S A;  1JM0 A;  3CCU P;  1G2C B;  5AVQ B;  2JDI H;  1GK6 A;  2K88 A;  2B87 A;  1NU1 E;  3KQG A;  3VP9 A;  2UWJ E;  1MZ9 A;  4AYC A;  2P10 A;  1GL2 B;  1DEE G;  2QJK C;  3GHG C;  1UII A;  3CCM P;  4JF7 A;  1SQB E;  1NOH A;  2IZ1 A;  4RJT A;  5APY A;  2G3A A;  3H1K G;  3I56 P;  2N1T A;  1KIL A;  3HE5 B;  1Q7Y Q;  1OVU A;  2Z5H A;  5AW4 B;  3CXH E;  3IAO A;  4UB6 H;  5APT A;  2W27 A;  1QVF O;  2WSC J;  4HKZ H;  1A02 F;  2ER8 A;  2Z5I A;  2A06 D;  1AA0 A;  1BE3 J;  4D6T G;  3CCJ P;  2AEM A;  3UIA A;  1RE4 C;  1VDF A;  2OAR A;  1J1E C;  1NTM E;  3PH0 A;  4H0L B;  1SQX G;  3H32 B;  1E5W A;  2H88 C;  1URQ C;  3II6 A;  2YXQ B;  2B9B A;  2BAS A;  3HUS A;  2WTY A;  2QJP C;  3PLN A;  1RE3 A;  3T97 A;  1YIT P;  3VP8 A;  2G8Y A;  5AVU B;  1FS0 E;  3V4Q A;  3L71 D;  4QMA A;  3TSI A;  1P84 E;  1N7S C;  2ZYG A;  5AW6 B;  3IN6 A;  1AFO A;  3H1L G;  3RK2 C;  4OH8 B;  5KLV K;  1IFM A;  5H2F H;  2H8P D;  3RBZ A;  3VMY A;  3H1H E;  3A0B E;  2B89 A;  4UB6 E;  3BCC D;  1GDT A;  1LTJ A;  2Q1K A;  4L73 A;  1Z56 A;  2HOD B;  3CC2 P;  1HUC A;  1NTK D;  3H25 A;  1XTG B;  2OYI A;  3HD7 D;  3VMZ A;  2V4H A;  2N1T C;  2GUS A;  4LC1 A;  1KIL C;  4OWF A;  3V2R A;  3SWK A;  3C9I A;  3N4X A;  2WT7 B;  3SFD C;  1NTZ G;  2W6J H;  4ASW A;  3WU2 H;  1VQ8 P;  1NAY A;  1QEX A;  3CWB D;  1L0N K;  3L70 J;  3CCS P;  1QX8 A;  3FWL A;  1SQQ D;  1RQU A;  2LKM A;  3I5C A;  3P8C E;  1H88 A;  1PP9 J;  3L71 J;  3V2N A;  1IC2 A;  2ZT9 C;  1M56 D;  5AVS B;  2FXO A;  3TGU E;  3HUS C;  1OXZ A;  4DT0 A;  3A7O A;  1RE3 C;  4HYT B;  2ZVN B;  4U3F J;  1RHZ B;  5CBO A;  1LTA C;  2KNC B;  3L36 A;  3HD7 A;  3FWN A;  3NXS A;  4IFD K;  1SQV D;  1HBW A;  1X79 B;  3CCL P;  1NTK J;  4GDO A;  2QVA A;  2E42 A;  1LTJ C;  1SQP K;  4R4L A;  2FFD A;  3H1I E;  2CPS A;  1S9K D;  3QH9 A;  4EI2 A;  2P2U A;  3GF7 A;  1VL2 A;  1ZW0 A;  2IBZ D;  2E76 D;  3L74 D;  3CCQ P;  1AJY A;  2OYI C;  1IFP A;  4H44 B;  2KZI A;  1YQ3 C;  2FKW B;  1T2K D;  3L75 G;  2AXT H;  2KZJ A;  4NPF X;  2YMK A;  5KLI C;  4EYY Q;  1ZRT D;  1G1J A;  3RK3 E;  2FYZ A;  1VQN P;  3E7K A;  1L0L G;  3AEB C;  3H1K D;  1CSB A;  4PD4 E;  3LIE A;  4XA4 A;  1PV3 A;  1A02 J;  2JEE A;  1KTM A;  2R44 A;  2I8D A;  5KLV E;  4RO0 A;  1IO4 A;  3CC7 P;  1S5L H;  3U1A A;  1LT9 B;  4Y28 J;  5AW0 B;  5TIS E;  4Z1M H;  2VRS A;  2YO2 A;  2GM4 A;  2R3S A;  2E5Y A;  4C7N B;  1KB9 D;  3WUU A;  1QP9 A;  3HD7 C;  5C39 A;  4ZKP A;  1ZP0 C;  5AVR B;  2Y9Z A;  4GKG A;  3ITK A;  1NKN A;  1OIP A;  1OW7 A;  1SFC D;  1LTB C;  1LWU A;  5DJU B;  1JTH B;  4IL6 E;  1RF1 A;  2FFD C;  4RKU J;  2CPB A;  2YKQ A;  4PV1 D;  1U7M A;  1IFN A;  3L73 E;  3AE3 C;  4CPG A;  1FBM A;  3RBX A;  2KI7 B;  1M1J B;  4EOT A;  5APU A;  2PP6 A;  1YI2 P;  3MGN A;  2E75 B;  1HVV A;  1YIJ P;  2K9J A;  5CHX A;  1VPC A;  1M57 D;  2A06 G;  4W80 A;  4WB4 A;  1IFJ A;  3PHL A;  3VMX A;  4D6T J;  1N8R Q;  4H13 B;  2HAP C;  1YYC A;  3E1R A;  1DH3 A;  1BCC J;  3H1J E;  2JJL A;  1SQX J;  5M1B A;  1H0T A;  1BGY D;  2BCC E;  3HTK B;  3BRV B;  1SQP E;  2KB7 P;  2OYO A;  2E76 C;  1S1C X;  4GT1 A;  3C8V A;  3JCU H;  2O1K A;  1FE6 A;  2E74 B;  2L5G B;  3ZDM A;  2IFN A;  3M0D A;  1JY2 P;  2J5U A;  3H1L J;  1OW6 A;  1T2K C;  1GL2 D;  1NYH A;  5KKZ C;  3TNU A;  1PL5 A;  1JNM A;  2IX7 C;  2ZJS E;  2MJZ A;  1ZN5 A;  5CJ4 A;  3GLM A;  5APQ A;  1LWU C;  1RF1 C;  1PYC A;  2A45 I;  1KYO D;  2QM7 A;  1GTW A;  2L91 A;  2ITA A;  3RK3 B;  2KP8 A;  3C1L A;  1VF5 D;  4N3Y B;  2QJY B;  3CX5 D;  1H8A A;  1URQ D;  4EDF A;  1F4S P;  1L0N J;  1KMI Z;  1JMM A;  1NVO A;  2WSF H;  5AVW B;  4ASV A;  1FZC B;  1NTZ J;  2IBZ I;  3Q5P A;  3TDK A;  1MFT A;  1NTK K;  3IF4 A;  3RK2 D;  1NAF A;  1GL2 A;  1OFC X;  2H7H A;  1L0L D;  1USD A;  1BE3 E;  3RL0 g;  1K05 A;  2XZR A;  1AVO A;  2Q3I A;  1FOS F;  2KLU A;  3S1K A;  1DIP A;  1ZR2 A;  3A0H H;  3HE5 A;  3CPW O;  4PV1 C;  2C9L Y;  4PJ0 E;  1FZE A;  5B5E E;  2QRX A;  3M0D C;  3MIW A;  2FYN B;  2FYU G;  4NPD A;  1JY2 N;  3B5N B;  1SQV G;  1EZV D;  3M9H A;  1JCD A;  2KSJ A;  1AQ5 A;  1KB9 I;  3AE2 C;  2Q9I A;  2IZ0 A;  2M5A A;  3H32 A;  2IBZ G;  4N78 D;  1RH5 B;  3L74 G;  3F5H A;  2IDB A;  5DJT B;  3TGU G;  1NKZ B;  2H89 C;  2ZT9 D;  1J1D B;  2OTL P;  1Y47 A;  1JOC A;  3M9B A;  1SVF A;  1NJI Q;  3L75 J;  3U59 A;  1LTS C;  1FZB A;  1ZLL A;  5AW9 B;  3AE6 C;  1PZQ A;  2P67 A;  2HFE D;  1L0L J;  3G4S P;  3KXD A;  5AVZ B;  4YPC A;  1FDO A;  2WPS A;  1L4A B;  1GL2 C;  1TU3 F;  2W6A A;  1NU1 D;  4WWI A;  1R5L A;  2HOD A;  3V4W A;  1YJW P;  1J1E B;  3AEC C;  3L70 E;  3D6Y A;  3A5T A;  2O01 H;  4OVN F;  1PP9 E;  3L71 E;  4Y99 B;  4BRY B;  3P32 A;  3SWF A;  1SQB D;  1VF5 C;  3WUT A;  2WT7 A;  5AVY B;  1GU4 A;  1OVV A;  2R32 A;  2LXC B;  4U3F E;  1PGO A;  2Q3E A;  2WSF J;  2IYO A;  3CXH D;  3RL0 B;  1QL2 A;  3N7N A;  1SQX K;  4H44 D;  3OAK A;  1HH0 A;  5KAF H;  2A45 H;  3IR9 A;  1YJN P;  4KJM A;  3CME P;  1NTK E;  3MZW B;  3G3Z A;  5BVZ A;  1KFM A;  2LXB A;  1YTZ I;  1AW6 A;  1ZV8 A;  4I2L C;  1YQ4 C;  2FY8 A;  1EDL A;  2NRG A;  3AE1 C;  1KD1 Q;  1KYO I;  2KNC A;  3VTP C;  3CL3 D;  5KJ7 A;  4JBZ A;  1KIL B;  3CMA P;  1AVY A;  2M8R A;  4W7Y A;  3G6E P;  3CX5 I;  4ZNC A;  1YTZ T;  1BDC A;  1GU5 A;  4DCK A;  1HGZ A;  1KFN A;  3TK1 A;  1YJ9 P;  3H1H D;  3CLQ A;  1XTC C;  2O01 N;  3D70 A;  3KYQ A;  1JUN A;  1BGY G;  5K5G B;  1LT1 A;  2CK3 H;  2Q6Q A;  4K3A A;  1PYI A;  1HTL C;  1PPJ G;  3S9O A;  5H2F E;  1MV8 A;  3COQ A;  2YKO A;  1ZR4 A;  2YIU C;  3HUS B;  1NTZ K;  1YHQ P;  3AE8 C;  2V7Q H;  2N9B A;  5AW7 B;  1EQ7 A;  1N73 B;  4GIF A;  2GUV A;  3PJS K;  2OYH B;  5AVT B;  1DD3 A;  1S9K E;  3BCC J;  4AQR D;  4UB8 H;  2NPS B;  5TJH A;  1KB9 H;  2FYU D;  2BEQ D;  2ZYA A;  4ZKU A;  1EC5 A;  4OGQ B;  2WPR A;  1WRG A;  4RES B;  1LT9 A;  1RF0 A;  1LNQ A;  1EZV I;  2KS1 B;  4GOE A;  5KAI H;  3CCV P;  4XE5 B;  4YXW H;  3WU2 E;  2OTK E;  1M7L A;  1ZRT E;  2JR8 A;  5KJ7 C;  1K73 Q;  3TGU D;  2HPC B;  5E79 H;  2O01 J;  2HLO A;  5KLI B;  3CWB J;  3L72 G;  1FJK A;  3LID A;  1JTH A;  1SQQ J;  1PGQ A;  4KHX A;  4D6T E;  1KZU B;  2ZVO B;  2E74 D;  3OA7 A;  2XND H;  4H44 C;  1BCC E;  2W90 A;  2W8Z A;  1SQX E;  3EFF K;  1JY3 P;  1SP4 A;  1MFZ A;  1NH4 A;  1L0L K;  1S3J A;  1LJ2 A;  3E1I A;  3MD0 A;  2FYU J;  2WPQ A;  1SQV J;  1EZV G;  1K8A Q;  1OMI A;  3HD7 B;  5AVV B;  1U57 A;  1LTT C;  3CCE P;  3RK3 D;  3AEE C;  3H1L E;  2AEF A;  5CJ0 A;  2POH A;  4N6J A;  2AXT E;  3L74 J;  1LT9 C;  2FFD B;  1RF0 C;  3KZI H;  4WVZ A;  1R5S A;  2O1J A;  3HTK A;  2I1K A;  2IYP A;  2JWD A;  3CXH I;  5CCG D;  2ZFC A;  2M3E A;  3NFQ A;  1L0N E;  1KYO H;  3H1K J;  1IZN B;  1BDD A;  1S5L E;  4HJG H;  2WSE H;  3SSU A;  1FC2 C;  4NPE A;  3CX5 H;  1NTZ E;  2WSS H;  2PRR A;  2V7Q J;  2PFX A;  1N2D C;  1NU1 G;  4O9B A;  2PAJ A;  3MUD A;  2WWW A;  2IFM A;  2KK7 A;  2JWA A;  4DZO A;  2JP3 A;  1P84 I;  1JEK A;  3GMA A;  1BSN A;  1KQF B;  3B5N D;  1SQB G;  1HJB A;  2QM8 A;  3L4F A;  4R4M A;  1JY3 N;  2OGU A;  1PIX A;  1FZA A;  2E75 C;  1FZC A;  2RH0 A;  2HG5 D;  3S4R A;  5CCG A;  1PPJ D;  4IL6 X;  3AE9 C;  1Y9B A;  5KKZ B;  4C46 A;  1DEB A;  3L70 G;  3G9R A;  5B66 H;  3K5B A;  1NTM G;  5CBN A;  1Q81 Q;  1PP9 G;  4I7Z B;  1CI6 A;  1YBK A;  1AV1 A;  2M3B A;  1ZME C;  2E74 C;  1H89 A;  2KSE A;  1FU1 A;  4U3F G;  3B5N A;  3L75 E;  2XNX A;  1IFD A;  1RQV A;  4IFF A;  2YKP A;  1L0L E;  1G2C A;  3D6Z A;  4IOI H;  3MUD C;  4L76 A;  4H0L D;  1PGJ A;  3JCU E;  5GTH H;  3P7K A;  3RK3 C;  3H1H G;  3MHV A;  4WY4 B;  2D2C B;  3L72 D;  4DOJ A;  2QJY C;  1BGY J;  1SFC B;  2K37 A;  1HF9 A;  3JSV C;  1KIL E;  2RN0 A;  3W68 A;  1H0T B;  4LGD E;  1T3U A;  3KPE A;  1X22 A;  3ABV C;  3NTN A;  1FZC C;  3RL0 D;  3PRJ A;  4GOF A;  1JY2 O;  5CCG C;  2KLV A;  1CZQ A;  1SQQ K;  1L4A A;  4JYB A;  1D66 A;  1VQ6 P;  2WSE J;  1U7J A;  5AW2 B;  1HGV A;  2ZAE B;  1T6A A;  1GMJ A;  4BRY A;  1BE3 D;  2WMM A;  3EWK A;  2FYU K;  3CXH H;  1SQV K;  2FYN C;  1LP1 B;  3B5N C;  3GF3 A;  3TYY A;  2QJK B;  4PD4 I;  3GHG B;  2E5T A;  2HYN A;  2OTJ P;  1FJP A;  2YO3 A;  2LR2 A;  2XDJ A;  3L72 J;  3FX0 A;  3HE4 B;  3M0A A;  5BU5 A;  2QE7 H;  2R5B A;  3A0H E;  5APS A;  3NMD A;  3CC4 P;  1BSH A;  2A06 E;  2XU6 A;  4B86 A;  1GZL A;  3AEA C;  2R5D A;  3H1I G;  1J1D C;  2J58 A;  1Q82 Q;  1EDI A;  1P84 H;  1KQS O;  1OW8 A;  1OWA A;  3BVH A;  2O3J A;  1M8O B;  2Q5U A;  3BRT B;  5KJ7 D;  1K04 A;  1VF5 B;  2NPS D;  3HRN A;  1URQ B;  1X9V A;  3A0B H;  1FOS E;  4OGQ D;  4JPZ B;  1L4A C;  2NZ2 A;  3H6P A;  2QJP B;  2BEZ F;  2AXC A;  3O6Q B;  2K3R A;  2QSI A;  3MP7 B;  3AEG C;  2YXR B;  4XFJ A;  1N7S B;  4K35 A;  3BCC E;  1BCC G;  5CCH D;  3RK2 B;  2B87 B;  2M5A B;  4H0L C;  4Y99 C;  1IK9 A;  1GD2 E;  5KLV G;  3L70 D;  1LTI C;  1MUU A;  1FZG A;  2YNY A;  1NTM D;  1LTG C;  1JO5 A;  1KQG B;  1RY3 A;  1PP9 D;  3VOP A;  3W67 A;  4I1L A;  1N73 A;  3QWO C;  5AW5 B;  3VYI A;  2OYH A;  2QIW A;  3RL0 C;  2Y0D A;  3Q5S A;  2N1T B;  2NPS A;  1SLQ A;  1NU1 J;  4U3F D;  4C7R A;  1FZF A;  2AEJ A;  4ZMD A;  1QGK B;  3CWB E;  3V2Q A;  1P84 D;  1SS1 A;  1W2B O;  2KS1 A;  1SQQ E;  3O8Z A;  1CW5 A;  1IK7 A;  4IFM A;  4W7Z A;  1VQ4 P;  1QL1 A;  2DW3 A;  3GW6 A;  3R2P A;  4BXL A;  1SQB J;  4AUW A;  4YTP C;  3FGA D;  5CCH A;  1L0N G;  1WT6 A;  1KN7 A;  2PGD A;  3L73 G;  5EFW B;  3B4S A;  5L8R J;  2W6B A;  2HPC A;  1Q2N A;  2IPP A;  2YIU B;  1GW4 A;  1S72 P;  5KAF E;  2ZT9 B;  3FXE A;  2Z4E A;  3EFG A;  1Q86 Q;  4TLF A;  2XKM A;  2FYU E;  3L35 A;  3T97 B;  1SQV E;  3PTZ A;  2ERG A;  2HR3 A;  3WMM 0;  1NTM J;  1PFI A;  1VQP P;  1Q90 D;  2KOG A;  2R3C A;  1E79 H;  1NHL A;  1QLE D;  3H1J G;  2ERE A;  3AE7 C;  1D7M A;  1AQT A;  1R8E A;  3B71 A;  2IBZ E;  2B88 A;  3L74 E;  3G71 P;  1J2J B;  1LTJ B;  2BCC G;  1L2P A;  1SQP G;  2E43 A;  1IJD B;  2K1A A;  3P8C D;  1N73 C;  2C9N Y;  2E75 D;  4C7N A;  4JYC A;  3I55 P;  4PD4 H;  2OYI B;  2OYH C;  3L37 A;  3JC2 2;  2C0X A;  4H13 D;  2NPS C;  3H1K E;  4TT3 H;  1Y8A A;  4OGQ C;  2QG4 A;  3KDP B;  3H1H J;  1EDK A;  4BWN A;  5TIS H;  2KIK A;  2P7J A;  3M06 A;  5AW8 B;  3OW2 O;  5CCH C;  4HB1 A;  1OVR A;  2WZ7 A;  3R4Y A;  4YXD C;  1VQM P;  2XV5 A;  4UB8 E;  3H1I D;  1KB9 E;  2ZXE B;  2FBW C;  3Q5R A;  4IL6 H;  2ZXX A;  3VMA A;  1M1J A;  2RMZ A;  1VQL P;  5KAI E;  2KYV A;  1NWQ A;  1F5E P;  3WUV A;  3LW5 H;  1VQO P;  1KQL A;  2JKV A;  3P8M C;  5E79 E;  1BE3 G;  1DX7 A;  4D6T D;  1USE A;  1JCC A;  5AW3 B;  4PD4 D;  3TGU J;  1BCC D;  3AED C;  1SQX D;  1N86 A;  2J59 M;  3F89 A;  5APX A;  3AE5 C;  5KLV D;  2P1J A;  1KV4 A;  2FXM A;  1ZXG A;  4WY4 D;  2D2C D;  3CD6 P;  3V2P A;  3IFM A;  5APV A;  3Q1M A;  1EXJ A;  3TF5 A;  5KTB A;  2H43 A;  3H1L D;  3B8E B;  1EDJ A;  3OJA B;  3KHU A;  5AVX B;  3H1I J;  3M9Q A;  5CMZ A;  4M3L A;  1G1I A;  2GA1 A;  4L75 A;  1M90 Q;  3MTU E;  1BGY E;  1JY3 O;  3V6I A;  1NO4 A;  2ALC A;  1PPJ E;  3AEF C;  1GK4 A;  3FXD A;  1UIX A;  1W2E A;  2P58 A;  1M1K Q;  1NU1 K;  4DJG A;  3KZI E;  1L0N D;  5APW A;  1M1J C;  3L73 D;  2QA4 P;  2E76 B;  4HH2 A;  2WQY C;  3V5B A;  5GTI H;  3CI9 A;  4WY4 A;  1NTZ D;  4H13 C;  1VQK P;  1FDM A;  1X8Y A;  1KYO E;  1SFC A;  1SQB K;  1IFI A;  2M0B A;  1K9M Q;  5KLV J;  3GG2 A;  1N7L A;  1LWU B;  2KXP B;  2MKV A;  1RF1 B;  2I1J A;  3CX5 E;  3EQ2 A;  3L71 G;  1S5L X;  3Q3D A; 
#chains in the Genus database with same CATH homology
 1RQV A;  1TU3 F;  3AE5 C;  1KTM A;  1HWT C;  2H88 C;  2QIW A;  2V7Q J;  2JO1 A;  2ZT9 C;  1KOR A;  3D6Z A;  3Q5S A;  3RL0 g;  1K05 A;  4Y28 J;  3Q2Y A;  5M1B A;  3AEC C;  4H13 D;  2D2C D;  4H0L D;  3D6Y A;  4TT3 H;  4Z1M H;  2QJP C;  3D70 A;  2E74 D;  3O6Q A;  2G8Y A;  4OGQ C;  1DIP A;  3Q1M A;  2D2C B;  1EXJ A;  3AEA C;  2E76 C;  2JP3 A;  4U7J A;  4H44 C;  1S1C X;  1JB0 J;  2QJY C;  3GMA A;  3C8V A;  3S9O A;  1QP9 A;  4PV1 C;  2E74 B;  1DD4 A;  3IN6 A;  1KQF B;  1IK7 A;  3COQ A;  1HF9 A;  1VF5 C;  2YIU C;  4I7Z C;  1EXI A;  1KIL E;  1ZP0 C;  4R4M A;  1OW8 A;  2J5U A;  1OW6 A;  3AE8 C;  4YTP C;  1NYH A;  3FGA D;  1PIX A;  5KKZ C;  3ABV C;  2E75 C;  1PL5 A;  1MKM A;  2P10 A;  5L8R J;  1OW7 A;  3LW5 J;  4GDO A;  1OMI A;  3R4Y A;  4YXD C;  3GLM A;  1U57 A;  1K04 A;  2ALC A;  1VF5 B;  4IL6 X;  4R4L A;  2WSF J;  1PYC A;  4RKU J;  2QJK C;  3AE9 C;  1Y9B A;  3AEF C;  2ZT9 B;  3AE4 C;  3AE2 C;  1DD3 A;  3D71 A;  1UIX A;  3AEE C;  3GF7 A;  4OGQ D;  2FBW C;  1VL2 A;  2NZ2 A;  3Q5R A;  4KT0 J;  2E76 D;  4H44 D;  1WMK A;  1D66 A;  2BEQ D;  3H25 A;  2BEZ F;  4PV1 D;  2IDB A;  3T97 B;  1AJY A;  2G3A A;  1FDI A;  4OGQ B;  3G9R A;  2QSI A;  1HJ0 A;  1VF5 D;  2E76 B;  4H44 B;  3AEG C;  2ERG A;  2H89 C;  3AE3 C;  1F4S P;  1YQ3 C;  4XFJ A;  2ZT9 D;  4PV1 B;  2WQY C;  2WPV B;  1KMI Z;  2WSE J;  1AW6 A;  1F5E P;  1PYI A;  1YQ4 C;  4I7Z B;  1Q90 D;  2YMK A;  5KLI C;  2OQQ A;  4H13 C;  2D2C C;  4H0L C;  3SFD C;  1GMJ A;  3IAO A;  1ZRT E;  3AE1 C;  3ALC A;  1NGM B;  3RK3 E;  1ZME C;  2WSC J;  2E74 C;  2ERE A;  2E75 B;  3AE7 C;  1R8E A;  3AEB C;  3B71 A;  3EWK A;  2ER8 A;  3AE6 C;  3Q5P A;  1ZOY C;  2O01 J;  2FYN C;  2K9Y A;  2MKV A;  3GF3 A;  1KQG B;  2FXP A;  4H13 B;  4H0L B;  2HAP C;  1FDO A;  1RQU A;  3AED C;  1S5L X;  1PV3 A;  3SFE C;  2E75 D;  3Q3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...