1AJYA

Structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
71
structure length
71
Chain Sequence
b'MSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKDLNDKTEENNRLKALLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUT3
publication title Structure and mobility of the PUT3 dimer.
pubmed doi rcsb
molecule tags Transcription regulation
total genus 14
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ajyA02
4.10.240.10 Few Secondary Structures Irregular CD2-Gal4 Zn(2)-C6 fungal-type DNA-binding domain 1ajyA01
2ERGA 2HAPC 3IN6A 2ER8A 3COQA 1QP9A 2EREA 1AW6A 1FDOA 1PYIA 1ZMEC 1D66A 1HWTC 1F4SP 1OMIA 1FDIA 1F5EP 3ALCA 1WMKA 3O6QA 1AJYA 2G8YA 2ALCA 1PYCA 3EWKA 2P10A 3H25A
chains in the Genus database with same CATH superfamily
2BCCG 2YXRB 2QG4A 1EZVE 2I8DA 3V4QA 2UWJE 2Y0EA 1H88A 4DT0A 1SQXJ 3AEBC 3SFDC 2HODA 2FY8A 1N7SC 2ERGA 3TNUA 3JC22 1VF5C 4D6TD 4PV1B 3VMXA 3TK1A 3G4SP 3RL0D 3BASA 3TGUE 3HD7B 3TYYA 4KT0J 1DEEG 1HGZA 4L76A 1L0LE 1USDA 2IX7C 1FZEA 3I55P 2V7QJ 1T3UA 1RF1A 2FYUG 3CWBG 1S5LX 4YXDC 1JY3O 2ZFCA 4RESB 4IFDK 2ITAA 2XDJA 3AE4C 3H1JD 5AVSB 4PV1C 2KZJA 3CCSP 1FZGA 3KYQA 3GW6A 3GF7A 3L74J 1LTSC 1FZCB 2ALCA 3OAKA 3TDKA 2KIKA 3USSA 3R4YA 3AE9C 3COQA 4H13D 2FXMA 4AQRD 1BCCE 5KLVJ 1GDTA 1MKMA 3HD7A 4XFJA 3KXDA 4ASVA 2E5TA 3L72G 1QX8A 1IZNB 1GMJA 1FOSF 3L72J 4H0LB 2WSEH 2YKOA 3B5NB 1P84I 3CCQP 4H44B 1YJ9P 2Q6QA 2BEZF 2JR8A 2OYHB 3E7KA 1NGMB 1GK4A 2O01H 3P8CD 3PJSK 4EIJA 1Q81Q 2WMMA 3V2RA 1OVRA 3B71A 3D6YA 1P84E 2IBZD 5KJ7D 1FZCA 2E74B 2A06G 2AXCA 3N7NA 2K9JB 2AEFA 1KILD 1PP9G 1JO5A 4H0LC 3PRJA 1YIJP 3B5NC 3CCMP 1EDIA 2R5DA 4UB8E 1OWAA 2NZ2A 4H44C 1N86A 1L2PA 1OFCX 1Q2NA 2OYHC 1W2BO 3L70D 2ER8A 3B5NA 3H1HG 1S1CX 1PPJE 2HG5D 3AE3C 2OYHA 1URQC 1GL2D 3PP5A 3HE5B 4L73A 4MN4C 2HAPC 1JUNA 1KN7A 2E74C 3BCCG 4HB1A 2IPPA 3V5BA 1VQ4P 4PJ0E 5CCHC 2M0BA 3I5CA 3L71J 1BE3G 3VOPA 1NWQA 2K9JA 1HUCA 2M3BA 1X79B 1RY3A 5CCHA 3IFMA 2Z5IA 1L4AD 1ZN5A 1N7LA 5AW5B 3OW2O 2C9NY 1DH3A 2H43A 1SQPE 3L37A 3CCEP 1YTZT 2E43A 4DCKA 2QRXA 2NPSB 3H1IG 1ZLLA 3ITKA 4D6TG 2V7QH 3H1IJ 3FXEA 1ZMEC 2KOGA 3H1LG 2BCCE 1YQ3C 2LKMA 3BRVB 1DD3A 1MFTA 3HE5A 3ABVC 2H89C 2HFED 3C9IA 2FFDB 3KZIH 3BVHA 1GK6A 1PGPA 2E75D 2B9BA 1L0NK 1SQVD 1OXZA 1OW8A 1T3JA 4YXWH 3CCUP 1JY2O 5AW2B 5CCGC 2W6JH 1X9VA 1MV8A 3PHLA 3CX5D 4LC1A 1VQMP 2Q9IA 1ZXGA 4IL6H 3VMAA 1LT9B 1J1EB 3TSIA 2POHA 2P58A 2QE7H 1MFZA 5KLVK 5BU5A 3RK3D 1RQUA 3H1JG 1OZHA 4YTPC 2NPSA 3RGUA 3RK2C 4AUWA 1BCCJ 2J58A 2Q3EA 2OYOA 2QM7A 1RF0A 2FYUE 4JQ0D 3CWBE 2XNXA 4OWFA 5E79H 4WY4C 2YMKA 5B5EH 1L0ND 1S5LE 4JPZB 4LLHA 2FFDA 2Q5UA 4NPEA 5AVZB 1IC2A 1KB9D 3II6A 1LTGC 3P32A 1NTMK 4EYYQ 5APWA 1DD4A 1LT9C 2CK3H 3BATA 2YIUB 5KAFE 1YJWP 2B88A 1Y9BA 3FGAD 1JMBA 1GD2E 1KYOH 4W7YA 2DW3A 2JO1A 3JSVC 4UB6E 3L72E 4XE5B 5CJ4A 3G6EP 3UIAA 3LW5J 3Q1MA 3E1IA 2KI7B 5B5EE 1LTBC 2QSIA 2XZRA 3L73G 4N6JA 3VP9A 3CC4P 2OQQA 1M8OB 1E5WA 3L73J 1LTAC 4TLFA 3Q5SA 1JM0A 1WRGA 1NTMD 1EXIA 2YIUC 3L75D 1URQD 5L8RJ 2JKVA 1DX7A 4OH8B 1NTKK 3HUSB 2P67A 2A06E 2OYIB 5BU8B 1KYOE 1S2EA 1PP9E 1WMKA 1BSHA 1K05A 2N9YB 4OVNF 5APTA 1KQFB 3S9OA 4C46A 5APUA 1RE3C 1ZRTE 3N4XA 2QJPB 3LIDA 2AXTH 2PFXA 1RE3A 1KC8Q 1T8ZA 3AE8C 3VTPC 1S3JA 4RJTA 1SQPJ 3CXHD 2E76B 3BCCE 2KSEA 5KLIB 1NTKD 1L0LK 1NU1G 4R4LA 5KAIE 3WUTA 5CMZA 1NU1J 1LWUB 4PD4D 2ZJSE 2H8PD 3AE6C 4IOIH 2YXQB 1JCDA 3HUSA 1BE3E 2MKVA 3GMAA 1LNQA 2OYIA 3FWNA 3HTKB 3H1KG 1M1JB 2BCCJ 4XA4A 2AEJA 2IFNA 1X8YA 3EQ2A 5APVA 1S9KE 2WPQA 1KV4A 1OW6A 3WUUA 1SQQK 5CCGD 1HGVA 1SFCB 1ZW0A 2BEQD 1NTZD 4JYBA 2QJPC 3CLQA 2M3EA 1SQVG 2AXTE 3V2QA 1FDOA 4U3FD 3JCUE 3H1IE 1Z56A 4D6TE 5CBNA 2E76C 3EFFK 3TGUD 3H1LE 1RF1C 1L0LD 3RK2D 1X22A 3A3YB 1YJNP 2WPSA 1M1JC 3V2PA 2W90A 2YO2A 1ZR2A 1LWUA 3Q5PA 3U1CA 1EXJA 2FYUJ 2N1TD 3HTKA 3CWBJ 1M1JA 1KD1Q 1SQQD 1EDLA 3CC2P 2P7JA 1JEKA 2V4HA 2XV5A 2ZVNB 2QVAA 1SFCA 3CI9A 3WMM0 3V6IA 3OA7A 1FJPA 2OARA 3H1JE 3HD7C 1N2DC 1P84H 1A02J 4R4MA 1ZV8A 4GODA 2FXOA 1VQOP 3LW5H 1F5EP 1IFDA 3U59A 1BGYD 2K9YA 2YO3A 2QIWA 3CC7P 4C7RA 4UB8H 1FZBA 1DIPA 3W67A 3AEDC 2YNYA 3S4RA 2G8YA 3EWKA 1PGJA 1NKZB 4WBAA 2KB7P 2IBZI 2O1JA 2JEEA 2CPSA 1UIIA 3AEGC 1FZCC 2ZT9B 2D2CB 1T2KD 1QL2A 4WVZA 1F4SP 1SQBG 3P8CE 1SQBJ 1NTMG 2B87A 4PJ0H 1IFIA 3QWOC 3KDPB 4K35A 1QVFO 2ZAEB 1FU1A 1RE4A 2WPRA 4NPFX 1JCCA 3RL0g 2R5BA 4GDOA 1AA0A 1PP9J 3LIEA 2WQYC 1KILE 2FBWC 1CSBA 5B66E 3L73E 1KZUB 5DJTB 3PTZA 2WTYA 1IJDB 1EQ7A 4TT3H 1HJBA 1VPCA 1K9MQ 1JY2N 1SQPK 1FZFA 2WITA 3H1HJ 2KXPB 2I1JA 2ZT9C 5BVZA 2D2CC 2PAJA 5AW3B 1G2CB 1LTJB 4DZOA 4W80A 1AVOA 3FWLA 5AVUB 2K88A 1MZ9A 1IFPA 3Q3DA 3BCCJ 5AW4B 2GM4A 2Y9ZA 3H6PA 3A2AA 2L91A 3A7OA 4HYTB 1SQXK 3KQGA 5CBOA 1BE3J 1E79H 1VQ9P 1RQVA 1N7SD 2Z5HA 4OGQB 2J5UA 1VF5D 3VMZA 1VQNP 2G3AA 1LT1A 2W27A 2GA1A 3L36A 1OMIA 4EI2A 1SQPD 5AVWB 1NTZG 1NU1E 1LTJC 4ASWA 1G1IA 4D6TJ 4DOJA 2PGDA 2W8ZA 2WVRA 4U3FG 1H0TB 1FDIA 3H1KE 1VQLP 1G2CA 1LTJA 3H1LJ 4L74A 3RL0B 1CW5A 2IDBA 1NKNA 3VN0A 1R5LA 2FYUK 1HF9A 2AEMA 2OTJP 3CX5I 1S5LH 4GT1A 5GTIE 1SQXD 1SP4A 4ZKPA 2ZXXA 4OGQC 1HTLC 4PV1D 1SQVE 1LJ2A 4BXLA 1FJKA 2E5YA 2KLUA 3HD7D 5KAFH 3NFQA 2NPSC 1SQQG 3CD6P 3H1JJ 1RF0C 2A45I 2Q3IA 4UB6H 4QMAA 4O9BA 4I2LC 4GOEA 3RK3E 3RL0C 3NTNA 2W6BA 1USEA 2FFDC 1KB9I 1PZQA 5M1BA 5K5GB 1H0TA 4H13B 3PLNA 2CPBA 4CPGA 2C9LY 1BGYG 1GW4A 4HKZH 1GTWA 1IFJA 4GOFA 2K3RA 1VDFA 1VQ7P 2IZ0A 5H2FE 3L74D 1GU4A 1PV3A 3M0AA 5AW1B 1KORA 1J1EC 4BWNA 5KLVD 1KFMA 1FZAA 2RMZA 3MGNA 5AVVB 4W7ZA 2HYNA 2IFMA 5APYA 2KP8A 2OGUA 5AW9B 3VMYA 2N1TA 5EFWB 2HPCB 1YI2P 1OIPA 3L72D 4H0LD 3TF5A 3B5ND 2IBZG 4H13C 3VYIA 4H44D 2K1AA 2KSJA 1IK9A 3C8VA 4BRYB 5CJ0A 1H89A 1KILB 1GZLA 2LXCB 2H7HA 1M7LA 3I56P 2M8RA 4M3LA 4N78D 1NYHA 1NAYA 2YMYA 1SQBE 2ZYGA 3CCVP 1CI6B 5KAIH 3L70G 1NTME 3AEFC 2E74D 4YPCA 2H88C 3CMAP 4AYCA 5CCHD 1AV1A 1WT6A 1AJYA 1KYOD 5APQA 1YQ4C 2WWWA 1Q86Q 4I6MC 1GL2B 1KTMA 1LP1A 5KJ7C 2KNCB 2HPCA 2N9BA 2R44A 2R32A 5KKZB 2L5GB 1QGKB 3H1HE 3RBZA 2SPZA 3RBXA 5AW0B 1YYCA 1KILC 3CXHI 1YITP 3ZDMA 1U7JA 4ZKUA 1JY3N 5KJ7A 1H8AA 3JCUH 2WSCJ 4DJGA 3NXSA 4PD4I 4LGDE 3C1LA 1R5SA 4BRYA 4HJGH 1KILA 1QEXA 2KLVA 3HUSC 1N7SB 1L4AB 2OYIC 1VL2A 1NJIQ 1YTZI 1AFOA 2VRSA 1RHZB 1Y8AA 1CI6A 3CXHE 2BASA 5AVYB 3L71D 1YHQP 4JF7A 4ZMDA 1EDKA 1VQ8P 4WB4A 1KQSO 4KJMA 1GL2C 1LGHB 3H1KJ 4PD4E 3G3ZA 1VQ6P 3D6ZA 2NRGA 1OVUA 1EZVD 4N3YB 1J2JB 2IYPA 3O6QB 5AVQB 5KKZC 5APXA 1GL2A 1NVOA 5AW6B 3B8EB 1M90Q 3B4SA 1ZOYC 2KNCA 1JB0J 3SFEC 1KMIZ 1NTZE 1SQXG 1SQVJ 2E75B 2NPSD 3A0BE 2KYVA 1CZQA 2XNDH 2C0XA 1S72P 1JNMA 1FAVA 2QJKB 1L4AC 5KLIC 3H1ID 3HE4A 4U3FE 1LWUC 4Y28J 2JWDA 3H1LD 5GTHH 4Y99B 1N7SA 3VP8A 1L4AA 3CCJP 1G1JA 4WY4D 3GG2A 1IFNA 3RK3B 3E1RA 1Q90D 3MZWB 1LTTC 2QJYB 1SFCC 2KS1B 2ZYDA 5AW8B 4EOTA 1SVFA 1R8EA 2A45G 2FYNB 3O6QA 1OW7A 2E75C 1L0NG 1SQQE 2KZIA 2B87B 1L0NJ 3Q5RA 3AEAC 2QJKC 1PFIA 1N8RQ 3L74G 3S1KA 3M91A 4Y99C 3ALCA 1BCCD 4IL6X 5GTHE 3HRNA 1K73Q 3SWFA 3D71A 1W2EA 1W5CE 5KLVG 1JY2P 3KPEA 3RK3C 3H32B 4Z1MH 5B66H 1BGYE 2QM8A 2QJYC 3MHVA 2IZ1A 5KTBA 2WT7B 1HWTC 3IAOA 5AVXB 3SWKA 1HVVA 1HH0A 3IR9A 1JOCA 1HBWA 2FYNC 5AVRB 1Q7YQ 2FYZA 2KS1A 3AECC 2FKWB 3A5TA 1PYIA 4JBZA 1IO4A 1PGOA 2E42A 1KFNA 1RE4C 4NPDA 1FBMA 1D7MA 3P8MC 1P84D 3L75G 1NTMJ 3IN6A 3M9QA 3MTUE 3L75J 2KK7A 4RKUJ 2IBZE 2J59M 4IFMA 1URQB 3QH9A 1FS0E 1TU3F 3CMEP 2PP6A 2IYOA 3M0DC 3AEEC 2JDIH 3H25A 2WSCH 4WWIA 3L73D 3P7KA 2XKMA 3H32A 4U7JA 3M0DA 2YKPA 2WT7A 3KHUA 1FOSE 3NMDA 5DJUB 3L70E 3CPWO 2C0WA 3R2PA 1NU1K 3F5HA 1PPJD 3O8ZA 2FXPA 3M06A 3F89A 3AE7C 2MJZA 1DEBA 3L4FA 2W6AA 3Q2YA 1D66A 3CCRP 1X0TA 1U7MA 2Q1KA 2B89A 1K04A 1NTKG 1PIXA 2P10A 5GTIH 2OTLP 3D70A 1KQGB 5APSA 1NTKJ 4GIFA 1QLED 3FXDA 1OX3A 1URQA 1NAFA 3L71G 1HJ0A 1M57D 1SQVK 2WPVB 3GHGB 1EZVG 4IFFA 1GW3A 1OVVA 1YBKA 1Y47A 2JWAA 2E76D 3WU2H 2RKLA 3CX5H 2ZYAA 1EDJA 4C7NB 2JJLA 1NTZJ 5TJHA 2LXBA 5CHXA 1NU1D 2Y0DA 4U3FJ 2BCCD 1PL5A 3SWYA 1XTGB 2WSFJ 3H1KD 3TGUG 3GF3A 3G71P 1ZP0C 3CCLP 2QEXP 2WZ7A 1IFMA 3TGUJ 1SFCD 1L0LG 1JTHB 2K37A 4I7ZB 1L0LJ 2A45H 3RK2B 1FDMA 1FC2C 1AQ5A 5H2FH 1BDDA 1A02F 1SQXE 2RH0A 3GHGC 2OTKE 1U57A 1IK7A 4WY4B 1MUUA 1KB9H 2O01N 2LR2A 3W68A 1SLQA 1SS1A 2N1TB 3WU2E 3CX5E 3GHGA 1SQQJ 1NHLA 2M5AB 5AW7B 3FX0A 1BSNA 1J1DB 5CCGA 4C7NA 1QP9A 2WSSH 3MIWA 1K8AQ 2HR3A 1XTCC 2RN0A 2R3CA 2FYUD 3CWBD 1FE6A 3U1AA 1PYCA 1BCCG 4I7ZC 2GUVA 1JMMA 5C39A 1BGYJ 1AVYA 2EREA 1BDCA 3V2NA 2YKQA 1JTHA 1L0NE 3V4WA 3KZIE 1S4XA 1VQPP 1VQ5P 3GLMA 1KB9E 3MUDC 1ZR4A 1SQBK 2N1TC 1NH4A 3L74E 2ZVOB 4WY4A 3WUVA 4I1LA 3L35A 4GKGA 2P1JA 4A7PA 3MP7B 3MUDA 1LP1B 1J1DC 4IL6E 5KLVE 2JP3A 4EDFA 1EC5A 2PRRA 1KQLA 2M5AA 4ZNCA 1JY3P 3T97B 1LT9A 1NOHA 2O1KA 2HLOA 4JYCA 2XU6A 3PH0A 1N73B 2GUSA 3AE5C 2ZT9D 2D2CD 5E79E 2O3JA 4K3AA 3A0HH 2Q7CA 4B86A 1KYOI 3MD0A 1M56D 3M9HA 2W83C 1UIXA 5TISH 1SQBD 2WSEJ 1M1KQ 4N78E 3L70J 1T6AA 3L75E 2ZXEB 3G9RA 1QVGO 1Q82Q 2Z4EA 2Y9YA 2A06D 3CXHH 3EFGA 3AE2C 3K5BA 1PPJG 1PP9D 4PD4H 4KHXA 2O01J 1T2KC 2R3SA 3CL3D 1AW6A 3AE1C 1VQKP 5AVTB 4HH2A 2P2UA 1ZRTD 3T97A 2I1KA 4RO0A 1N73C 2HODB 3OJAB 1GU5A 3H1HD 4L75A 3TNUB 3HE4B 3IF4A 3A0BH 1RH5B 1NTZK 2Y0CA 1LTIC 3BRTB 1AQTA 1N73A 3A0HE 3SSUA 1VF5B 2WSFH 5TISE 1EZVI 2KUBA 3BCCD 1QL1A 2QA4P 1SQPG 1NTKE 3M9BA 1BE3D 1NO4A 1PGQA 1RF1B 4OGQD 3L71E 1S9KD
chains in the Genus database with same CATH topology
1KQGB 2FYNC 1EXJA 3R4YA 3AE9C 2ER8A 3COQA 2E75D 4H13D 2JO1A 1S1CX 1OW8A 3AE8C 3AECC 1QP9A 1Y9BA 1KTMA 4Y28J 3RL0g 1PV3A 1UIXA 1PYIA 4GDOA 1HJ0A 2WSEJ 1MKMA 1KORA 2E76B 2WQYC 3AE3C 3G9RA 4XFJA 2WPVB 1KILE 1FDIA 4R4LA 2FBWC 3AEBC 3SFDC 1PYCA 2IDBA 3LW5J 4I7ZC 3Q1MA 3AE2C 2ERGA 2HAPC 3AE6C 1GMJA 2QSIA 1Q90D 2E76D 1VF5C 3IN6A 4TT3H 2E74C 2WSCJ 4H0LB 2O01J 4PV1B 2MKVA 3GMAA 1HF9A 4RKUJ 2EREA 1AW6A 4R4MA 2OQQA 4H44B 3AE1C 2ZT9C 1RQUA 4OGQC 1TU3F 2BEZF 2D2CC 3Q5SA 1R8EA 1VL2A 3GLMA 1F5EP 4H0LD 4PV1D 1EXIA 1OW6A 3O6QA 3AEEC 1OW7A 2YIUC 4KT0J 2K9YA 1NGMB 2E75C 4H13C 5L8RJ 2BEQD 4YTPC 3H25A 2QIWA 1PL5A 4H44D 2QJPC 2WSFJ 3Q5RA 3GF3A 3AEAC 1ZP0C 2QJKC 4U7JA 3C8VA 3Q3DA 1FDOA 3Q5PA 2V7QJ 3B71A 1DIPA 3D6YA 2YMKA 3D6ZA 4I7ZB 3AEDC 2JP3A 3ALCA 1WMKA 4IL6X 1VF5B 2E74B 2G8YA 2E76C 3EWKA 5KKZC 1NYHA 3T97B 1S5LX 1K05A 2FXPA 1U57A 1IK7A 3RK3E 3D71A 3AE7C 1KQFB 4YXDC 3AEGC 1RQVA 3S9OA 2ZT9B 4OGQB 1ZOYC 2J5UA 3AE4C 3AEFC 2D2CB 1JB0J 1VF5D 4Z1MH 2E74D 1DD4A 5M1BA 4H0LC 2QJYC 1ZRTE 4PV1C 1ZMEC 3Q2YA 3SFEC 1KMIZ 2H88C 1D66A 2G3AA 1YQ3C 2E75B 4H13B 1F4SP 1HWTC 1OMIA 1DD3A 3IAOA 3GF7A 3AE5C 2NZ2A 3ABVC 2H89C 2ZT9D 4H44C 1AJYA 2ALCA 4OGQD 1K04A 2D2CD 1PIXA 2P10A 1YQ4C 3D70A 5KLIC 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERG A;  2HAP C;  3IN6 A;  2ER8 A;  3COQ A;  1QP9 A;  2ERE A;  1AW6 A;  1FDO A;  1PYI A;  1ZME C;  1D66 A;  1HWT C;  1F4S P;  1OMI A;  1FDI A;  1F5E P;  3ALC A;  1WMK A;  3O6Q A;  1AJY A;  2G8Y A;  2ALC A;  1PYC A;  3EWK A;  2P10 A;  3H25 A; 
#chains in the Genus database with same CATH topology
 2BCC G;  2YXR B;  2QG4 A;  1EZV E;  2I8D A;  3V4Q A;  2UWJ E;  2Y0E A;  1H88 A;  4DT0 A;  1SQX J;  3AEB C;  3SFD C;  2HOD A;  2FY8 A;  1N7S C;  2ERG A;  3TNU A;  3JC2 2;  1VF5 C;  4D6T D;  4PV1 B;  3VMX A;  3TK1 A;  3G4S P;  3RL0 D;  3BAS A;  3TGU E;  3HD7 B;  3TYY A;  4KT0 J;  1DEE G;  1HGZ A;  4L76 A;  1L0L E;  1USD A;  2IX7 C;  1FZE A;  3I55 P;  2V7Q J;  1T3U A;  1RF1 A;  2FYU G;  3CWB G;  1S5L X;  4YXD C;  1JY3 O;  2ZFC A;  4RES B;  4IFD K;  2ITA A;  2XDJ A;  3AE4 C;  3H1J D;  5AVS B;  4PV1 C;  2KZJ A;  3CCS P;  1FZG A;  3KYQ A;  3GW6 A;  3GF7 A;  3L74 J;  1LTS C;  1FZC B;  2ALC A;  3OAK A;  3TDK A;  2KIK A;  3USS A;  3R4Y A;  3AE9 C;  3COQ A;  4H13 D;  2FXM A;  4AQR D;  1BCC E;  5KLV J;  1GDT A;  1MKM A;  3HD7 A;  4XFJ A;  3KXD A;  4ASV A;  2E5T A;  3L72 G;  1QX8 A;  1IZN B;  1GMJ A;  1FOS F;  3L72 J;  4H0L B;  2WSE H;  2YKO A;  3B5N B;  1P84 I;  3CCQ P;  4H44 B;  1YJ9 P;  2Q6Q A;  2BEZ F;  2JR8 A;  2OYH B;  3E7K A;  1NGM B;  1GK4 A;  2O01 H;  3P8C D;  3PJS K;  4EIJ A;  1Q81 Q;  2WMM A;  3V2R A;  1OVR A;  3B71 A;  3D6Y A;  1P84 E;  2IBZ D;  5KJ7 D;  1FZC A;  2E74 B;  2A06 G;  2AXC A;  3N7N A;  2K9J B;  2AEF A;  1KIL D;  1PP9 G;  1JO5 A;  4H0L C;  3PRJ A;  1YIJ P;  3B5N C;  3CCM P;  1EDI A;  2R5D A;  4UB8 E;  1OWA A;  2NZ2 A;  4H44 C;  1N86 A;  1L2P A;  1OFC X;  1Q2N A;  2OYH C;  1W2B O;  3L70 D;  2ER8 A;  3B5N A;  3H1H G;  1S1C X;  1PPJ E;  2HG5 D;  3AE3 C;  2OYH A;  1URQ C;  1GL2 D;  3PP5 A;  3HE5 B;  4L73 A;  4MN4 C;  2HAP C;  1JUN A;  1KN7 A;  2E74 C;  3BCC G;  4HB1 A;  2IPP A;  3V5B A;  1VQ4 P;  4PJ0 E;  5CCH C;  2M0B A;  3I5C A;  3L71 J;  1BE3 G;  3VOP A;  1NWQ A;  2K9J A;  1HUC A;  2M3B A;  1X79 B;  1RY3 A;  5CCH A;  3IFM A;  2Z5I A;  1L4A D;  1ZN5 A;  1N7L A;  5AW5 B;  3OW2 O;  2C9N Y;  1DH3 A;  2H43 A;  1SQP E;  3L37 A;  3CCE P;  1YTZ T;  2E43 A;  4DCK A;  2QRX A;  2NPS B;  3H1I G;  1ZLL A;  3ITK A;  4D6T G;  2V7Q H;  3H1I J;  3FXE A;  1ZME C;  2KOG A;  3H1L G;  2BCC E;  1YQ3 C;  2LKM A;  3BRV B;  1DD3 A;  1MFT A;  3HE5 A;  3ABV C;  2H89 C;  2HFE D;  3C9I A;  2FFD B;  3KZI H;  3BVH A;  1GK6 A;  1PGP A;  2E75 D;  2B9B A;  1L0N K;  1SQV D;  1OXZ A;  1OW8 A;  1T3J A;  4YXW H;  3CCU P;  1JY2 O;  5AW2 B;  5CCG C;  2W6J H;  1X9V A;  1MV8 A;  3PHL A;  3CX5 D;  4LC1 A;  1VQM P;  2Q9I A;  1ZXG A;  4IL6 H;  3VMA A;  1LT9 B;  1J1E B;  3TSI A;  2POH A;  2P58 A;  2QE7 H;  1MFZ A;  5KLV K;  5BU5 A;  3RK3 D;  1RQU A;  3H1J G;  1OZH A;  4YTP C;  2NPS A;  3RGU A;  3RK2 C;  4AUW A;  1BCC J;  2J58 A;  2Q3E A;  2OYO A;  2QM7 A;  1RF0 A;  2FYU E;  4JQ0 D;  3CWB E;  2XNX A;  4OWF A;  5E79 H;  4WY4 C;  2YMK A;  5B5E H;  1L0N D;  1S5L E;  4JPZ B;  4LLH A;  2FFD A;  2Q5U A;  4NPE A;  5AVZ B;  1IC2 A;  1KB9 D;  3II6 A;  1LTG C;  3P32 A;  1NTM K;  4EYY Q;  5APW A;  1DD4 A;  1LT9 C;  2CK3 H;  3BAT A;  2YIU B;  5KAF E;  1YJW P;  2B88 A;  1Y9B A;  3FGA D;  1JMB A;  1GD2 E;  1KYO H;  4W7Y A;  2DW3 A;  2JO1 A;  3JSV C;  4UB6 E;  3L72 E;  4XE5 B;  5CJ4 A;  3G6E P;  3UIA A;  3LW5 J;  3Q1M A;  3E1I A;  2KI7 B;  5B5E E;  1LTB C;  2QSI A;  2XZR A;  3L73 G;  4N6J A;  3VP9 A;  3CC4 P;  2OQQ A;  1M8O B;  1E5W A;  3L73 J;  1LTA C;  4TLF A;  3Q5S A;  1JM0 A;  1WRG A;  1NTM D;  1EXI A;  2YIU C;  3L75 D;  1URQ D;  5L8R J;  2JKV A;  1DX7 A;  4OH8 B;  1NTK K;  3HUS B;  2P67 A;  2A06 E;  2OYI B;  5BU8 B;  1KYO E;  1S2E A;  1PP9 E;  1WMK A;  1BSH A;  1K05 A;  2N9Y B;  4OVN F;  5APT A;  1KQF B;  3S9O A;  4C46 A;  5APU A;  1RE3 C;  1ZRT E;  3N4X A;  2QJP B;  3LID A;  2AXT H;  2PFX A;  1RE3 A;  1KC8 Q;  1T8Z A;  3AE8 C;  3VTP C;  1S3J A;  4RJT A;  1SQP J;  3CXH D;  2E76 B;  3BCC E;  2KSE A;  5KLI B;  1NTK D;  1L0L K;  1NU1 G;  4R4L A;  5KAI E;  3WUT A;  5CMZ A;  1NU1 J;  1LWU B;  4PD4 D;  2ZJS E;  2H8P D;  3AE6 C;  4IOI H;  2YXQ B;  1JCD A;  3HUS A;  1BE3 E;  2MKV A;  3GMA A;  1LNQ A;  2OYI A;  3FWN A;  3HTK B;  3H1K G;  1M1J B;  2BCC J;  4XA4 A;  2AEJ A;  2IFN A;  1X8Y A;  3EQ2 A;  5APV A;  1S9K E;  2WPQ A;  1KV4 A;  1OW6 A;  3WUU A;  1SQQ K;  5CCG D;  1HGV A;  1SFC B;  1ZW0 A;  2BEQ D;  1NTZ D;  4JYB A;  2QJP C;  3CLQ A;  2M3E A;  1SQV G;  2AXT E;  3V2Q A;  1FDO A;  4U3F D;  3JCU E;  3H1I E;  1Z56 A;  4D6T E;  5CBN A;  2E76 C;  3EFF K;  3TGU D;  3H1L E;  1RF1 C;  1L0L D;  3RK2 D;  1X22 A;  3A3Y B;  1YJN P;  2WPS A;  1M1J C;  3V2P A;  2W90 A;  2YO2 A;  1ZR2 A;  1LWU A;  3Q5P A;  3U1C A;  1EXJ A;  2FYU J;  2N1T D;  3HTK A;  3CWB J;  1M1J A;  1KD1 Q;  1SQQ D;  1EDL A;  3CC2 P;  2P7J A;  1JEK A;  2V4H A;  2XV5 A;  2ZVN B;  2QVA A;  1SFC A;  3CI9 A;  3WMM 0;  3V6I A;  3OA7 A;  1FJP A;  2OAR A;  3H1J E;  3HD7 C;  1N2D C;  1P84 H;  1A02 J;  4R4M A;  1ZV8 A;  4GOD A;  2FXO A;  1VQO P;  3LW5 H;  1F5E P;  1IFD A;  3U59 A;  1BGY D;  2K9Y A;  2YO3 A;  2QIW A;  3CC7 P;  4C7R A;  4UB8 H;  1FZB A;  1DIP A;  3W67 A;  3AED C;  2YNY A;  3S4R A;  2G8Y A;  3EWK A;  1PGJ A;  1NKZ B;  4WBA A;  2KB7 P;  2IBZ I;  2O1J A;  2JEE A;  2CPS A;  1UII A;  3AEG C;  1FZC C;  2ZT9 B;  2D2C B;  1T2K D;  1QL2 A;  4WVZ A;  1F4S P;  1SQB G;  3P8C E;  1SQB J;  1NTM G;  2B87 A;  4PJ0 H;  1IFI A;  3QWO C;  3KDP B;  4K35 A;  1QVF O;  2ZAE B;  1FU1 A;  1RE4 A;  2WPR A;  4NPF X;  1JCC A;  3RL0 g;  2R5B A;  4GDO A;  1AA0 A;  1PP9 J;  3LIE A;  2WQY C;  1KIL E;  2FBW C;  1CSB A;  5B66 E;  3L73 E;  1KZU B;  5DJT B;  3PTZ A;  2WTY A;  1IJD B;  1EQ7 A;  4TT3 H;  1HJB A;  1VPC A;  1K9M Q;  1JY2 N;  1SQP K;  1FZF A;  2WIT A;  3H1H J;  2KXP B;  2I1J A;  2ZT9 C;  5BVZ A;  2D2C C;  2PAJ A;  5AW3 B;  1G2C B;  1LTJ B;  4DZO A;  4W80 A;  1AVO A;  3FWL A;  5AVU B;  2K88 A;  1MZ9 A;  1IFP A;  3Q3D A;  3BCC J;  5AW4 B;  2GM4 A;  2Y9Z A;  3H6P A;  3A2A A;  2L91 A;  3A7O A;  4HYT B;  1SQX K;  3KQG A;  5CBO A;  1BE3 J;  1E79 H;  1VQ9 P;  1RQV A;  1N7S D;  2Z5H A;  4OGQ B;  2J5U A;  1VF5 D;  3VMZ A;  1VQN P;  2G3A A;  1LT1 A;  2W27 A;  2GA1 A;  3L36 A;  1OMI A;  4EI2 A;  1SQP D;  5AVW B;  1NTZ G;  1NU1 E;  1LTJ C;  4ASW A;  1G1I A;  4D6T J;  4DOJ A;  2PGD A;  2W8Z A;  2WVR A;  4U3F G;  1H0T B;  1FDI A;  3H1K E;  1VQL P;  1G2C A;  1LTJ A;  3H1L J;  4L74 A;  3RL0 B;  1CW5 A;  2IDB A;  1NKN A;  3VN0 A;  1R5L A;  2FYU K;  1HF9 A;  2AEM A;  2OTJ P;  3CX5 I;  1S5L H;  4GT1 A;  5GTI E;  1SQX D;  1SP4 A;  4ZKP A;  2ZXX A;  4OGQ C;  1HTL C;  4PV1 D;  1SQV E;  1LJ2 A;  4BXL A;  1FJK A;  2E5Y A;  2KLU A;  3HD7 D;  5KAF H;  3NFQ A;  2NPS C;  1SQQ G;  3CD6 P;  3H1J J;  1RF0 C;  2A45 I;  2Q3I A;  4UB6 H;  4QMA A;  4O9B A;  4I2L C;  4GOE A;  3RK3 E;  3RL0 C;  3NTN A;  2W6B A;  1USE A;  2FFD C;  1KB9 I;  1PZQ A;  5M1B A;  5K5G B;  1H0T A;  4H13 B;  3PLN A;  2CPB A;  4CPG A;  2C9L Y;  1BGY G;  1GW4 A;  4HKZ H;  1GTW A;  1IFJ A;  4GOF A;  2K3R A;  1VDF A;  1VQ7 P;  2IZ0 A;  5H2F E;  3L74 D;  1GU4 A;  1PV3 A;  3M0A A;  5AW1 B;  1KOR A;  1J1E C;  4BWN A;  5KLV D;  1KFM A;  1FZA A;  2RMZ A;  3MGN A;  5AVV B;  4W7Z A;  2HYN A;  2IFM A;  5APY A;  2KP8 A;  2OGU A;  5AW9 B;  3VMY A;  2N1T A;  5EFW B;  2HPC B;  1YI2 P;  1OIP A;  3L72 D;  4H0L D;  3TF5 A;  3B5N D;  2IBZ G;  4H13 C;  3VYI A;  4H44 D;  2K1A A;  2KSJ A;  1IK9 A;  3C8V A;  4BRY B;  5CJ0 A;  1H89 A;  1KIL B;  1GZL A;  2LXC B;  2H7H A;  1M7L A;  3I56 P;  2M8R A;  4M3L A;  4N78 D;  1NYH A;  1NAY A;  2YMY A;  1SQB E;  2ZYG A;  3CCV P;  1CI6 B;  5KAI H;  3L70 G;  1NTM E;  3AEF C;  2E74 D;  4YPC A;  2H88 C;  3CMA P;  4AYC A;  5CCH D;  1AV1 A;  1WT6 A;  1AJY A;  1KYO D;  5APQ A;  1YQ4 C;  2WWW A;  1Q86 Q;  4I6M C;  1GL2 B;  1KTM A;  1LP1 A;  5KJ7 C;  2KNC B;  2HPC A;  2N9B A;  2R44 A;  2R32 A;  5KKZ B;  2L5G B;  1QGK B;  3H1H E;  3RBZ A;  2SPZ A;  3RBX A;  5AW0 B;  1YYC A;  1KIL C;  3CXH I;  1YIT P;  3ZDM A;  1U7J A;  4ZKU A;  1JY3 N;  5KJ7 A;  1H8A A;  3JCU H;  2WSC J;  4DJG A;  3NXS A;  4PD4 I;  4LGD E;  3C1L A;  1R5S A;  4BRY A;  4HJG H;  1KIL A;  1QEX A;  2KLV A;  3HUS C;  1N7S B;  1L4A B;  2OYI C;  1VL2 A;  1NJI Q;  1YTZ I;  1AFO A;  2VRS A;  1RHZ B;  1Y8A A;  1CI6 A;  3CXH E;  2BAS A;  5AVY B;  3L71 D;  1YHQ P;  4JF7 A;  4ZMD A;  1EDK A;  1VQ8 P;  4WB4 A;  1KQS O;  4KJM A;  1GL2 C;  1LGH B;  3H1K J;  4PD4 E;  3G3Z A;  1VQ6 P;  3D6Z A;  2NRG A;  1OVU A;  1EZV D;  4N3Y B;  1J2J B;  2IYP A;  3O6Q B;  5AVQ B;  5KKZ C;  5APX A;  1GL2 A;  1NVO A;  5AW6 B;  3B8E B;  1M90 Q;  3B4S A;  1ZOY C;  2KNC A;  1JB0 J;  3SFE C;  1KMI Z;  1NTZ E;  1SQX G;  1SQV J;  2E75 B;  2NPS D;  3A0B E;  2KYV A;  1CZQ A;  2XND H;  2C0X A;  1S72 P;  1JNM A;  1FAV A;  2QJK B;  1L4A C;  5KLI C;  3H1I D;  3HE4 A;  4U3F E;  1LWU C;  4Y28 J;  2JWD A;  3H1L D;  5GTH H;  4Y99 B;  1N7S A;  3VP8 A;  1L4A A;  3CCJ P;  1G1J A;  4WY4 D;  3GG2 A;  1IFN A;  3RK3 B;  3E1R A;  1Q90 D;  3MZW B;  1LTT C;  2QJY B;  1SFC C;  2KS1 B;  2ZYD A;  5AW8 B;  4EOT A;  1SVF A;  1R8E A;  2A45 G;  2FYN B;  3O6Q A;  1OW7 A;  2E75 C;  1L0N G;  1SQQ E;  2KZI A;  2B87 B;  1L0N J;  3Q5R A;  3AEA C;  2QJK C;  1PFI A;  1N8R Q;  3L74 G;  3S1K A;  3M91 A;  4Y99 C;  3ALC A;  1BCC D;  4IL6 X;  5GTH E;  3HRN A;  1K73 Q;  3SWF A;  3D71 A;  1W2E A;  1W5C E;  5KLV G;  1JY2 P;  3KPE A;  3RK3 C;  3H32 B;  4Z1M H;  5B66 H;  1BGY E;  2QM8 A;  2QJY C;  3MHV A;  2IZ1 A;  5KTB A;  2WT7 B;  1HWT C;  3IAO A;  5AVX B;  3SWK A;  1HVV A;  1HH0 A;  3IR9 A;  1JOC A;  1HBW A;  2FYN C;  5AVR B;  1Q7Y Q;  2FYZ A;  2KS1 A;  3AEC C;  2FKW B;  3A5T A;  1PYI A;  4JBZ A;  1IO4 A;  1PGO A;  2E42 A;  1KFN A;  1RE4 C;  4NPD A;  1FBM A;  1D7M A;  3P8M C;  1P84 D;  3L75 G;  1NTM J;  3IN6 A;  3M9Q A;  3MTU E;  3L75 J;  2KK7 A;  4RKU J;  2IBZ E;  2J59 M;  4IFM A;  1URQ B;  3QH9 A;  1FS0 E;  1TU3 F;  3CME P;  2PP6 A;  2IYO A;  3M0D C;  3AEE C;  2JDI H;  3H25 A;  2WSC H;  4WWI A;  3L73 D;  3P7K A;  2XKM A;  3H32 A;  4U7J A;  3M0D A;  2YKP A;  2WT7 A;  3KHU A;  1FOS E;  3NMD A;  5DJU B;  3L70 E;  3CPW O;  2C0W A;  3R2P A;  1NU1 K;  3F5H A;  1PPJ D;  3O8Z A;  2FXP A;  3M06 A;  3F89 A;  3AE7 C;  2MJZ A;  1DEB A;  3L4F A;  2W6A A;  3Q2Y A;  1D66 A;  3CCR P;  1X0T A;  1U7M A;  2Q1K A;  2B89 A;  1K04 A;  1NTK G;  1PIX A;  2P10 A;  5GTI H;  2OTL P;  3D70 A;  1KQG B;  5APS A;  1NTK J;  4GIF A;  1QLE D;  3FXD A;  1OX3 A;  1URQ A;  1NAF A;  3L71 G;  1HJ0 A;  1M57 D;  1SQV K;  2WPV B;  3GHG B;  1EZV G;  4IFF A;  1GW3 A;  1OVV A;  1YBK A;  1Y47 A;  2JWA A;  2E76 D;  3WU2 H;  2RKL A;  3CX5 H;  2ZYA A;  1EDJ A;  4C7N B;  2JJL A;  1NTZ J;  5TJH A;  2LXB A;  5CHX A;  1NU1 D;  2Y0D A;  4U3F J;  2BCC D;  1PL5 A;  3SWY A;  1XTG B;  2WSF J;  3H1K D;  3TGU G;  3GF3 A;  3G71 P;  1ZP0 C;  3CCL P;  2QEX P;  2WZ7 A;  1IFM A;  3TGU J;  1SFC D;  1L0L G;  1JTH B;  2K37 A;  4I7Z B;  1L0L J;  2A45 H;  3RK2 B;  1FDM A;  1FC2 C;  1AQ5 A;  5H2F H;  1BDD A;  1A02 F;  1SQX E;  2RH0 A;  3GHG C;  2OTK E;  1U57 A;  1IK7 A;  4WY4 B;  1MUU A;  1KB9 H;  2O01 N;  2LR2 A;  3W68 A;  1SLQ A;  1SS1 A;  2N1T B;  3WU2 E;  3CX5 E;  3GHG A;  1SQQ J;  1NHL A;  2M5A B;  5AW7 B;  3FX0 A;  1BSN A;  1J1D B;  5CCG A;  4C7N A;  1QP9 A;  2WSS H;  3MIW A;  1K8A Q;  2HR3 A;  1XTC C;  2RN0 A;  2R3C A;  2FYU D;  3CWB D;  1FE6 A;  3U1A A;  1PYC A;  1BCC G;  4I7Z C;  2GUV A;  1JMM A;  5C39 A;  1BGY J;  1AVY A;  2ERE A;  1BDC A;  3V2N A;  2YKQ A;  1JTH A;  1L0N E;  3V4W A;  3KZI E;  1S4X A;  1VQP P;  1VQ5 P;  3GLM A;  1KB9 E;  3MUD C;  1ZR4 A;  1SQB K;  2N1T C;  1NH4 A;  3L74 E;  2ZVO B;  4WY4 A;  3WUV A;  4I1L A;  3L35 A;  4GKG A;  2P1J A;  4A7P A;  3MP7 B;  3MUD A;  1LP1 B;  1J1D C;  4IL6 E;  5KLV E;  2JP3 A;  4EDF A;  1EC5 A;  2PRR A;  1KQL A;  2M5A A;  4ZNC A;  1JY3 P;  3T97 B;  1LT9 A;  1NOH A;  2O1K A;  2HLO A;  4JYC A;  2XU6 A;  3PH0 A;  1N73 B;  2GUS A;  3AE5 C;  2ZT9 D;  2D2C D;  5E79 E;  2O3J A;  4K3A A;  3A0H H;  2Q7C A;  4B86 A;  1KYO I;  3MD0 A;  1M56 D;  3M9H A;  2W83 C;  1UIX A;  5TIS H;  1SQB D;  2WSE J;  1M1K Q;  4N78 E;  3L70 J;  1T6A A;  3L75 E;  2ZXE B;  3G9R A;  1QVG O;  1Q82 Q;  2Z4E A;  2Y9Y A;  2A06 D;  3CXH H;  3EFG A;  3AE2 C;  3K5B A;  1PPJ G;  1PP9 D;  4PD4 H;  4KHX A;  2O01 J;  1T2K C;  2R3S A;  3CL3 D;  1AW6 A;  3AE1 C;  1VQK P;  5AVT B;  4HH2 A;  2P2U A;  1ZRT D;  3T97 A;  2I1K A;  4RO0 A;  1N73 C;  2HOD B;  3OJA B;  1GU5 A;  3H1H D;  4L75 A;  3TNU B;  3HE4 B;  3IF4 A;  3A0B H;  1RH5 B;  1NTZ K;  2Y0C A;  1LTI C;  3BRT B;  1AQT A;  1N73 A;  3A0H E;  3SSU A;  1VF5 B;  2WSF H;  5TIS E;  1EZV I;  2KUB A;  3BCC D;  1QL1 A;  2QA4 P;  1SQP G;  1NTK E;  3M9B A;  1BE3 D;  1NO4 A;  1PGQ A;  1RF1 B;  4OGQ D;  3L71 E;  1S9K D; 
#chains in the Genus database with same CATH homology
 1KQG B;  2FYN C;  1EXJ A;  3R4Y A;  3AE9 C;  2ER8 A;  3COQ A;  2E75 D;  4H13 D;  2JO1 A;  1S1C X;  1OW8 A;  3AE8 C;  3AEC C;  1QP9 A;  1Y9B A;  1KTM A;  4Y28 J;  3RL0 g;  1PV3 A;  1UIX A;  1PYI A;  4GDO A;  1HJ0 A;  2WSE J;  1MKM A;  1KOR A;  2E76 B;  2WQY C;  3AE3 C;  3G9R A;  4XFJ A;  2WPV B;  1KIL E;  1FDI A;  4R4L A;  2FBW C;  3AEB C;  3SFD C;  1PYC A;  2IDB A;  3LW5 J;  4I7Z C;  3Q1M A;  3AE2 C;  2ERG A;  2HAP C;  3AE6 C;  1GMJ A;  2QSI A;  1Q90 D;  2E76 D;  1VF5 C;  3IN6 A;  4TT3 H;  2E74 C;  2WSC J;  4H0L B;  2O01 J;  4PV1 B;  2MKV A;  3GMA A;  1HF9 A;  4RKU J;  2ERE A;  1AW6 A;  4R4M A;  2OQQ A;  4H44 B;  3AE1 C;  2ZT9 C;  1RQU A;  4OGQ C;  1TU3 F;  2BEZ F;  2D2C C;  3Q5S A;  1R8E A;  1VL2 A;  3GLM A;  1F5E P;  4H0L D;  4PV1 D;  1EXI A;  1OW6 A;  3O6Q A;  3AEE C;  1OW7 A;  2YIU C;  4KT0 J;  2K9Y A;  1NGM B;  2E75 C;  4H13 C;  5L8R J;  2BEQ D;  4YTP C;  3H25 A;  2QIW A;  1PL5 A;  4H44 D;  2QJP C;  2WSF J;  3Q5R A;  3GF3 A;  3AEA C;  1ZP0 C;  2QJK C;  4U7J A;  3C8V A;  3Q3D A;  1FDO A;  3Q5P A;  2V7Q J;  3B71 A;  1DIP A;  3D6Y A;  2YMK A;  3D6Z A;  4I7Z B;  3AED C;  2JP3 A;  3ALC A;  1WMK A;  4IL6 X;  1VF5 B;  2E74 B;  2G8Y A;  2E76 C;  3EWK A;  5KKZ C;  1NYH A;  3T97 B;  1S5L X;  1K05 A;  2FXP A;  1U57 A;  1IK7 A;  3RK3 E;  3D71 A;  3AE7 C;  1KQF B;  4YXD C;  3AEG C;  1RQV A;  3S9O A;  2ZT9 B;  4OGQ B;  1ZOY C;  2J5U A;  3AE4 C;  3AEF C;  2D2C B;  1JB0 J;  1VF5 D;  4Z1M H;  2E74 D;  1DD4 A;  5M1B A;  4H0L C;  2QJY C;  1ZRT E;  4PV1 C;  1ZME C;  3Q2Y A;  3SFE C;  1KMI Z;  2H88 C;  1D66 A;  2G3A A;  1YQ3 C;  2E75 B;  4H13 B;  1F4S P;  1HWT C;  1OMI A;  1DD3 A;  3IAO A;  3GF7 A;  3AE5 C;  2NZ2 A;  3ABV C;  2H89 C;  2ZT9 D;  4H44 C;  1AJY A;  2ALC A;  4OGQ D;  1K04 A;  2D2C D;  1PIX A;  2P10 A;  1YQ4 C;  3D70 A;  5KLI C;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...