The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
188
|
sequence length |
485
|
structure length |
485
|
Chain Sequence |
MSIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFENYDVVVGPTAPTTAFNLGEEIDDPLTMYANDLLTTPVNLAGLPGISVPCGQSNGRPIGLQFIGKPFDEKTLYRVAYQYETQYNLHDVYEKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Ligase
|
source organism |
Staphylococcus aureus
|
publication title |
Ammonia channel couples glutaminase with transamidase reactions in GatCAB
pubmed doi rcsb |
molecule keywords |
Glutamyl-tRNA(Gln) amidotransferase subunit A
|
total genus |
188
|
structure length |
485
|
sequence length |
485
|
ec nomenclature |
ec
6.3.5.7: Glutaminyl-tRNA synthase (glutamine-hydrolyzing). |
pdb deposition date | 2006-02-23 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01425 | Amidase | Amidase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Amidase signature (AS) enzymes | Amidase signature (AS) domain |
#chains in the Genus database with same CATH superfamily 2DQN A; 4DO3 A; 3K7F A; 2G5H A; 4CP8 A; 3PR0 A; 3H0M A; 1OCH A; 2DF4 A; 2F2A A; 3OJ8 A; 4YJI A; 1O9N A; 3A1K A; 1O9O A; 3QK5 A; 5EWQ A; 3AL0 A; 3LJ6 A; 1OBL A; 1O9Q A; 1M22 A; 2WJ1 A; 4N0H A; 4HBP A; 2WJ2 A; 3KFU E; 3A2Q A; 4ISS A; 4GYR A; 3IP4 A; 3H0R A; 4YJ6 A; 1OCL A; 2G5I A; 2GI3 A; 5AC3 A; 4J5P A; 3K84 A; 1OBJ A; 2DC0 A; 1O9P A; 1OBI A; 1OBK A; 3LJ7 A; 1OCK A; 2WAP A; 3PPM A; 1MT5 A; 4GYS A; 1OCM A; 2VYA A; 1M21 A; 3QJ9 A; 4WJ3 A; 4N0I A; 3QKV A; 3A2P A; 3K83 A; 3QJ8 A; 3A1I A; 4IST A; 3H0L A; #chains in the Genus database with same CATH topology 2DQN A; 4DO3 A; 3K7F A; 2G5H A; 4CP8 A; 3PR0 A; 3H0M A; 1OCH A; 2DF4 A; 2F2A A; 3OJ8 A; 4YJI A; 1O9N A; 3A1K A; 1O9O A; 3QK5 A; 5EWQ A; 3AL0 A; 3LJ6 A; 1OBL A; 1O9Q A; 1M22 A; 2WJ1 A; 4N0H A; 4HBP A; 2WJ2 A; 3KFU E; 3A2Q A; 4ISS A; 4GYR A; 3IP4 A; 3H0R A; 4YJ6 A; 1OCL A; 2G5I A; 2GI3 A; 5AC3 A; 4J5P A; 3K84 A; 1OBJ A; 2DC0 A; 1O9P A; 1OBI A; 1OBK A; 3LJ7 A; 1OCK A; 2WAP A; 3PPM A; 1MT5 A; 4GYS A; 1OCM A; 2VYA A; 1M21 A; 3QJ9 A; 4WJ3 A; 4N0I A; 3QKV A; 3A2P A; 3K83 A; 3QJ8 A; 3A1I A; 4IST A; 3H0L A; #chains in the Genus database with same CATH homology 2DQN A; 4DO3 A; 3K7F A; 2G5H A; 4CP8 A; 3PR0 A; 3H0M A; 1OCH A; 2DF4 A; 2F2A A; 3OJ8 A; 4YJI A; 1O9N A; 3A1K A; 1O9O A; 3QK5 A; 5EWQ A; 3AL0 A; 3LJ6 A; 1OBL A; 1O9Q A; 1M22 A; 2WJ1 A; 4N0H A; 4HBP A; 2WJ2 A; 3KFU E; 3A2Q A; 4ISS A; 4GYR A; 3IP4 A; 3H0R A; 4YJ6 A; 1OCL A; 2G5I A; 2GI3 A; 5AC3 A; 4J5P A; 3K84 A; 1OBJ A; 2DC0 A; 1O9P A; 1OBI A; 1OBK A; 3LJ7 A; 1OCK A; 2WAP A; 3PPM A; 1MT5 A; 4GYS A; 1OCM A; 2VYA A; 1M21 A; 3QJ9 A; 4WJ3 A; 4N0I A; 3QKV A; 3A2P A; 3K83 A; 3QJ8 A; 3A1I A; 4IST A; 3H0L A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...