The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
44
|
sequence length |
155
|
structure length |
155
|
Chain Sequence |
PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGRGPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution NMR structure of the PBS linker polypeptide domain of phycobilisome
linker protein apcE from Synechocystis sp. Northeast Structural Genomics Consortium
Target SgR209C
rcsb |
molecule tags |
Protein binding
|
source organism |
Synechocystis sp.
|
molecule keywords |
Phycobilisome LCM core-membrane linker polypeptide
|
total genus |
44
|
structure length |
155
|
sequence length |
155
|
ec nomenclature | |
pdb deposition date | 2010-06-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00427 | PBS_linker_poly | Phycobilisome Linker polypeptide |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | serine acetyltransferase, domain 1 | serine acetyltransferase, domain 1 |
#chains in the Genus database with same CATH superfamily 2KY4 A; 3OHW A; 3PRU A; 3NPH B; 2L06 A; 2L3W A; 3OSJ A; 2L8V A; #chains in the Genus database with same CATH topology 3GVD A; 3Q1X A; 1S80 A; 3P1B A; 2L06 A; 1SSM A; 3NPH B; 4HZD A; 3OSJ A; 1T3D A; 1SST A; 2L3W A; 4N6A A; 2L8V A; 3OHW A; 3PRU A; 3P47 A; 4HZC A; 3F1X A; 2KY4 A; 3MC4 A; 4N6B A; 4N69 A; 1SSQ A; 4H7O A; #chains in the Genus database with same CATH homology 3GVD A; 3Q1X A; 1S80 A; 3P1B A; 2L06 A; 1SSM A; 3NPH B; 4HZD A; 3OSJ A; 1T3D A; 1SST A; 2L3W A; 4N6A A; 2L8V A; 3OHW A; 3PRU A; 3P47 A; 4HZC A; 3F1X A; 2KY4 A; 3MC4 A; 4N6B A; 4N69 A; 1SSQ A; 4H7O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...