3F1XA

Three dimensional structure of the serine acetyltransferase from bacteroides vulgatus, northeast structural genomics consortium target bvr62.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
276
Chain Sequence
TTFNYTNILTQAVDELSESQSYKGLFHQHKDGDPLPSAKSLYKIVELARAIIFPGYFGNSTVNSHTINYHIGVNVETLFGLLTEQILAGLCFGDNEPCRETASLLAARFISKLPELRRILATDVEAAYYGDPAATCFGEIISCYPAIRAISNYRIAHELLILGVPLIPRFITEMAHSETGIDIHPGAQIGHHFTIDHGTGVVIGATSIIGNNVKLYQGVTLGAKPRHPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine acetyltransferase
publication title Three dimensional structure of the serine acetyltransferase from Bacteroides vulgatus, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET BVR62.
rcsb
source organism Bacteroides vulgatus atcc 8482
molecule tags Transferase
total genus 88
structure length 276
sequence length 299
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.10 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3f1xA01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3f1xA02
1KK5A 4M98A 3OTZA 2VHEA 2XATA 4EABA 5E3RA 5L6VA 2VD4A 4HZCA 3R3RA 4N27A 5AFUV 5DEPA 2QIVX 1QREA 4N69A 1XATA 3FSXA 3DHOA 3GVDA 3EG4A 3PMOA 1QQ0A 2W0WA 1KRVA 3OW5A 2GGOA 2WLGA 3FSBA 3FSCA 3IGJA 3VBIA 1Z90A 3HJJA 2AQ9A 3P47A 1QRMA 4MFGA 3MQGA 5E3QA 3FSYA 1HV9A 4KNXA 3SRTA 5F42A 4M2AA 1KRUA 3FS8A 4E1KA 3R2WA 3ECTA 3I3XA 4J18A 2P2OA 3F1XA 4M28A 2IC7A 1SSQA 3CJ8A 1LXAA 3MC4A 1KQAA 3T57A 1V3WA 1HM0A 3TWDA 4EGGA 4K6RA 3KWDA 3VBJA 2WLDA 3Q1XA 3SPTA 2QIAA 2V0LA 2FKOA 1KRRA 2ICYA 2WLEA 1KGTA 2OI5A 3R1WA 3TDTA 3BSYA 2WLCA 1J2ZA 5DG3A 3MQHA 4R37A 4M9CA 3KWEA 3VBNA 3HSQA 3D98A 3ST8A 1V67A 2V0KA 5E3PA 4E79A 4EA7A 4E6TA 3TISA 1YP4A 3OTMA 3BFPA 1MR9A 4EA9A 1SSTA 3C8VA 4G3SA 4AC3A 5ADXU 4KPXA 1MR7A 1OCXA 4FCEA 4R36A 3DK5A 3DJ4A 2NPOA 4IHFA 3R5CA 4J09A 3VBLA 4E75A 3BRKX 1QRLA 3BXYA 1S80A 1HM8A 2OI7A 4KPZA 4AAWA 2WLFA 3FOQA 5DEMA 3VNPA 2OI6A 1SSMA 1T3DA 4EA8A 4KQLA 4EAAA 3I3AA 2TDTA 2JF2A 3GUEA 1THJA 2V0JA 3OUPA 2RIJA 4M2BA 4G3QA 1QRFA 3TIOA 4KNRA 3EH0A 3GOSA 3R0SA 2IUAA 4EQYA 5ADXV 4HZDA 3R5AA 4HURA 1TDTA 4DCLA 3EEVA 5AFUU 4IHGA 3NZ2A 4IHHA 1HM9A 1KGQA 1MRLA 5U2KA 3BSSA 2GGQA 4G87A 1KK4A 1YP2A 2JF3A 3TK8A 3FTTA 1FWYA 4MYOA 2ICXA 3R8YA 3R5BA 3VBMA 2V0HA 2W0VA 2Q4JA 3IXCA 3BSWA 2I5KA 3V4EA 5L6SA 4H7OA 4N6BA 4G3PA 4M99A 2V0IA 4N6AA 3D8VA 1XHDA 1YP3A 3TV0A 4HUSA 2OEFA 3VBPA 3R3IA 1G95A 2IU9A 4E6UA 1FXJA 2IU8A 3FWWA 3R5DA 4R7PA 3VBKA 3P1BA 2QKXA 2OEGA 1G97A 3JQYA 4HCQA 3OU9A 4ISXA 1QRGA 4MZUA 1KHRA 1KK6A 3KWCA 4AA7A
chains in the Genus database with same CATH superfamily
3OHWA 1KK5A 4M98A 3OTZA 2VHEA 2XATA 4EABA 5E3RA 5L6VA 2VD4A 4HZCA 3R3RA 4N27A 5AFUV 5DEPA 2QIVX 1QREA 4N69A 1XATA 3FSXA 3PRUA 3DHOA 3GVDA 3EG4A 3PMOA 1QQ0A 2W0WA 1KRVA 3OW5A 2GGOA 2WLGA 3FSBA 3FSCA 3IGJA 3VBIA 1Z90A 3HJJA 2AQ9A 3P47A 1QRMA 4MFGA 3MQGA 5E3QA 3FSYA 1HV9A 4KNXA 3SRTA 5F42A 4M2AA 1KRUA 3FS8A 4E1KA 3R2WA 3ECTA 3I3XA 4J18A 2P2OA 3F1XA 4M28A 2IC7A 1SSQA 3CJ8A 2L06A 1LXAA 3MC4A 3OH1A 1KQAA 3T57A 1V3WA 1HM0A 3TWDA 3GQAA 3OH4A 4EGGA 4K6RA 3KWDA 3VBJA 2WLDA 3Q1XA 3SPTA 2QIAA 2V0LA 2FKOA 1KRRA 1N4IA 3NPHB 2ICYA 1KGTA 2WLEA 2OI5A 3OH0A 3R1WA 3TDTA 3BSYA 2WLCA 1J2ZA 5DG3A 3MQHA 4R37A 4M9CA 3KWEA 3VBNA 3HSQA 3D98A 2L8VA 1V67A 2KY4A 2V0KA 5E3PA 3ST8A 4E79A 4EA7A 3TISA 1YP4A 4E6TA 3OTMA 3BFPA 1MR9A 2L3WA 4EA9A 1SSTA 1L0SA 3C8VA 4G3SA 4AC3A 5ADXU 4KPXA 1MR7A 1OCXA 4FCEA 4R36A 3DK5A 3DJ4A 2NPOA 4IHFA 3R5CA 4J09A 3VBLA 4E75A 3BRKX 1QRLA 3BXYA 1S80A 1HM8A 2OI7A 4KPZA 4AAWA 2WLFA 3FOQA 5DEMA 3VNPA 2OI6A 1SSMA 1T3DA 4EA8A 4KQLA 4EAAA 3I3AA 2TDTA 2JF2A 1Z2FA 1THJA 2V0JA 3GUEA 2RIJA 3OUPA 3OGZA 1QRFA 4G3QA 4M2BA 3TIOA 4KNRA 3EH0A 3GOSA 1M8NA 3R0SA 2IUAA 4EQYA 5ADXV 4HZDA 3R5AA 4HURA 1TDTA 4DCLA 3EEVA 5AFUU 4IHGA 3NZ2A 4IHHA 1HM9A 1KGQA 1MRLA 5U2KA 3BSSA 2GGQA 4G87A 1KK4A 1YP2A 2JF3A 3TK8A 3FTTA 1FWYA 4MYOA 2ICXA 3R8YA 3R5BA 3VBMA 2V0HA 2W0VA 2Q4JA 3IXCA 3BSWA 2I5KA 3V4EA 5L6SA 4H7OA 4N6BA 3OH2A 4G3PA 4M99A 2V0IA 4N6AA 3GQ8A 3D8VA 1XHDA 3OSJA 3SUCA 1YP3A 3TV0A 4HUSA 2OEFA 3VBPA 3GQ7A 3R3IA 1G95A 2IU9A 4E6UA 3OH3A 1FXJA 2IU8A 3FWWA 3R5DA 4R7PA 3VBKA 3P1BA 2QKXA 2OEGA 1G97A 3JQYA 4HCQA 3OU9A 4ISXA 1QRGA 4MZUA 1EWWA 1KHRA 1KK6A 3GQ9A 3KWCA 4AA7A
chains in the Genus database with same CATH topology
3OHWA 1KK5A 4M98A 3OTZA 2VHEA 2XATA 4EABA 5E3RA 5L6VA 2VD4A 4HZCA 3R3RA 4N27A 5AFUV 5DEPA 2QIVX 1QREA 4N69A 1XATA 3FSXA 3PRUA 3DHOA 3GVDA 3EG4A 3PMOA 1QQ0A 2W0WA 1KRVA 3OW5A 2GGOA 2WLGA 3FSBA 3FSCA 3IGJA 3VBIA 1Z90A 3HJJA 2AQ9A 3P47A 1QRMA 4MFGA 3MQGA 5E3QA 3FSYA 1HV9A 4KNXA 3SRTA 5F42A 4M2AA 1KRUA 3FS8A 4E1KA 3R2WA 3ECTA 3I3XA 4J18A 2P2OA 3F1XA 4M28A 2IC7A 1SSQA 3CJ8A 2L06A 1LXAA 3MC4A 1KQAA 3T57A 1V3WA 1HM0A 3TWDA 4EGGA 4K6RA 3KWDA 3VBJA 2WLDA 3Q1XA 3SPTA 2QIAA 2V0LA 2FKOA 1KRRA 2ICYA 3NPHB 2WLEA 1KGTA 2OI5A 3R1WA 3TDTA 3BSYA 2WLCA 1J2ZA 5DG3A 3MQHA 4R37A 4M9CA 3KWEA 3VBNA 3HSQA 3D98A 2L8VA 1V67A 2KY4A 2V0KA 5E3PA 3ST8A 4E79A 4EA7A 3TISA 1YP4A 4E6TA 3OTMA 3BFPA 1MR9A 2L3WA 4EA9A 1SSTA 3C8VA 4G3SA 4AC3A 5ADXU 4KPXA 1MR7A 1OCXA 4FCEA 4R36A 3DK5A 3DJ4A 2NPOA 4IHFA 3R5CA 4J09A 3VBLA 4E75A 3BRKX 1QRLA 3BXYA 1S80A 1HM8A 2OI7A 4KPZA 4AAWA 2WLFA 3FOQA 5DEMA 3VNPA 2OI6A 1SSMA 1T3DA 4EA8A 4KQLA 4EAAA 3I3AA 2TDTA 2JF2A 3GUEA 1THJA 2V0JA 3OUPA 2RIJA 4M2BA 4G3QA 1QRFA 3TIOA 4KNRA 3EH0A 3GOSA 3R0SA 2IUAA 4EQYA 5ADXV 4HZDA 3R5AA 4HURA 1TDTA 4DCLA 3EEVA 5AFUU 4IHGA 3NZ2A 4IHHA 1HM9A 1KGQA 1MRLA 5U2KA 3BSSA 2GGQA 4G87A 1KK4A 1YP2A 2JF3A 3TK8A 3FTTA 1FWYA 4MYOA 2ICXA 3R8YA 3R5BA 3VBMA 2V0HA 2W0VA 2Q4JA 3IXCA 3BSWA 2I5KA 3V4EA 5L6SA 4H7OA 4N6BA 4G3PA 4M99A 2V0IA 4N6AA 3D8VA 1XHDA 3OSJA 1YP3A 3TV0A 4HUSA 2OEFA 3VBPA 3R3IA 1G95A 2IU9A 4E6UA 1FXJA 2IU8A 3FWWA 3R5DA 4R7PA 3VBKA 3P1BA 2QKXA 2OEGA 1G97A 3JQYA 4HCQA 3OU9A 4ISXA 1QRGA 4MZUA 1KHRA 1KK6A 3KWCA 4AA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK5 A;  4M98 A;  3OTZ A;  2VHE A;  2XAT A;  4EAB A;  5E3R A;  5L6V A;  2VD4 A;  4HZC A;  3R3R A;  4N27 A;  5AFU V;  5DEP A;  2QIV X;  1QRE A;  4N69 A;  1XAT A;  3FSX A;  3DHO A;  3GVD A;  3EG4 A;  3PMO A;  1QQ0 A;  2W0W A;  1KRV A;  3OW5 A;  2GGO A;  2WLG A;  3FSB A;  3FSC A;  3IGJ A;  3VBI A;  1Z90 A;  3HJJ A;  2AQ9 A;  3P47 A;  1QRM A;  4MFG A;  3MQG A;  5E3Q A;  3FSY A;  1HV9 A;  4KNX A;  3SRT A;  5F42 A;  4M2A A;  1KRU A;  3FS8 A;  4E1K A;  3R2W A;  3ECT A;  3I3X A;  4J18 A;  2P2O A;  3F1X A;  4M28 A;  2IC7 A;  1SSQ A;  3CJ8 A;  1LXA A;  3MC4 A;  1KQA A;  3T57 A;  1V3W A;  1HM0 A;  3TWD A;  4EGG A;  4K6R A;  3KWD A;  3VBJ A;  2WLD A;  3Q1X A;  3SPT A;  2QIA A;  2V0L A;  2FKO A;  1KRR A;  2ICY A;  2WLE A;  1KGT A;  2OI5 A;  3R1W A;  3TDT A;  3BSY A;  2WLC A;  1J2Z A;  5DG3 A;  3MQH A;  4R37 A;  4M9C A;  3KWE A;  3VBN A;  3HSQ A;  3D98 A;  3ST8 A;  1V67 A;  2V0K A;  5E3P A;  4E79 A;  4EA7 A;  4E6T A;  3TIS A;  1YP4 A;  3OTM A;  3BFP A;  1MR9 A;  4EA9 A;  1SST A;  3C8V A;  4G3S A;  4AC3 A;  5ADX U;  4KPX A;  1MR7 A;  1OCX A;  4FCE A;  4R36 A;  3DK5 A;  3DJ4 A;  2NPO A;  4IHF A;  3R5C A;  4J09 A;  3VBL A;  4E75 A;  3BRK X;  1QRL A;  3BXY A;  1S80 A;  1HM8 A;  2OI7 A;  4KPZ A;  4AAW A;  2WLF A;  3FOQ A;  5DEM A;  3VNP A;  2OI6 A;  1SSM A;  1T3D A;  4EA8 A;  4KQL A;  4EAA A;  3I3A A;  2TDT A;  2JF2 A;  3GUE A;  1THJ A;  2V0J A;  3OUP A;  2RIJ A;  4M2B A;  4G3Q A;  1QRF A;  3TIO A;  4KNR A;  3EH0 A;  3GOS A;  3R0S A;  2IUA A;  4EQY A;  5ADX V;  4HZD A;  3R5A A;  4HUR A;  1TDT A;  4DCL A;  3EEV A;  5AFU U;  4IHG A;  3NZ2 A;  4IHH A;  1HM9 A;  1KGQ A;  1MRL A;  5U2K A;  3BSS A;  2GGQ A;  4G87 A;  1KK4 A;  1YP2 A;  2JF3 A;  3TK8 A;  3FTT A;  1FWY A;  4MYO A;  2ICX A;  3R8Y A;  3R5B A;  3VBM A;  2V0H A;  2W0V A;  2Q4J A;  3IXC A;  3BSW A;  2I5K A;  3V4E A;  5L6S A;  4H7O A;  4N6B A;  4G3P A;  4M99 A;  2V0I A;  4N6A A;  3D8V A;  1XHD A;  1YP3 A;  3TV0 A;  4HUS A;  2OEF A;  3VBP A;  3R3I A;  1G95 A;  2IU9 A;  4E6U A;  1FXJ A;  2IU8 A;  3FWW A;  3R5D A;  4R7P A;  3VBK A;  3P1B A;  2QKX A;  2OEG A;  1G97 A;  3JQY A;  4HCQ A;  3OU9 A;  4ISX A;  1QRG A;  4MZU A;  1KHR A;  1KK6 A;  3KWC A;  4AA7 A; 
#chains in the Genus database with same CATH topology
 3OHW A;  1KK5 A;  4M98 A;  3OTZ A;  2VHE A;  2XAT A;  4EAB A;  5E3R A;  5L6V A;  2VD4 A;  4HZC A;  3R3R A;  4N27 A;  5AFU V;  5DEP A;  2QIV X;  1QRE A;  4N69 A;  1XAT A;  3FSX A;  3PRU A;  3DHO A;  3GVD A;  3EG4 A;  3PMO A;  1QQ0 A;  2W0W A;  1KRV A;  3OW5 A;  2GGO A;  2WLG A;  3FSB A;  3FSC A;  3IGJ A;  3VBI A;  1Z90 A;  3HJJ A;  2AQ9 A;  3P47 A;  1QRM A;  4MFG A;  3MQG A;  5E3Q A;  3FSY A;  1HV9 A;  4KNX A;  3SRT A;  5F42 A;  4M2A A;  1KRU A;  3FS8 A;  4E1K A;  3R2W A;  3ECT A;  3I3X A;  4J18 A;  2P2O A;  3F1X A;  4M28 A;  2IC7 A;  1SSQ A;  3CJ8 A;  2L06 A;  1LXA A;  3MC4 A;  3OH1 A;  1KQA A;  3T57 A;  1V3W A;  1HM0 A;  3TWD A;  3GQA A;  3OH4 A;  4EGG A;  4K6R A;  3KWD A;  3VBJ A;  2WLD A;  3Q1X A;  3SPT A;  2QIA A;  2V0L A;  2FKO A;  1KRR A;  1N4I A;  3NPH B;  2ICY A;  1KGT A;  2WLE A;  2OI5 A;  3OH0 A;  3R1W A;  3TDT A;  3BSY A;  2WLC A;  1J2Z A;  5DG3 A;  3MQH A;  4R37 A;  4M9C A;  3KWE A;  3VBN A;  3HSQ A;  3D98 A;  2L8V A;  1V67 A;  2KY4 A;  2V0K A;  5E3P A;  3ST8 A;  4E79 A;  4EA7 A;  3TIS A;  1YP4 A;  4E6T A;  3OTM A;  3BFP A;  1MR9 A;  2L3W A;  4EA9 A;  1SST A;  1L0S A;  3C8V A;  4G3S A;  4AC3 A;  5ADX U;  4KPX A;  1MR7 A;  1OCX A;  4FCE A;  4R36 A;  3DK5 A;  3DJ4 A;  2NPO A;  4IHF A;  3R5C A;  4J09 A;  3VBL A;  4E75 A;  3BRK X;  1QRL A;  3BXY A;  1S80 A;  1HM8 A;  2OI7 A;  4KPZ A;  4AAW A;  2WLF A;  3FOQ A;  5DEM A;  3VNP A;  2OI6 A;  1SSM A;  1T3D A;  4EA8 A;  4KQL A;  4EAA A;  3I3A A;  2TDT A;  2JF2 A;  1Z2F A;  1THJ A;  2V0J A;  3GUE A;  2RIJ A;  3OUP A;  3OGZ A;  1QRF A;  4G3Q A;  4M2B A;  3TIO A;  4KNR A;  3EH0 A;  3GOS A;  1M8N A;  3R0S A;  2IUA A;  4EQY A;  5ADX V;  4HZD A;  3R5A A;  4HUR A;  1TDT A;  4DCL A;  3EEV A;  5AFU U;  4IHG A;  3NZ2 A;  4IHH A;  1HM9 A;  1KGQ A;  1MRL A;  5U2K A;  3BSS A;  2GGQ A;  4G87 A;  1KK4 A;  1YP2 A;  2JF3 A;  3TK8 A;  3FTT A;  1FWY A;  4MYO A;  2ICX A;  3R8Y A;  3R5B A;  3VBM A;  2V0H A;  2W0V A;  2Q4J A;  3IXC A;  3BSW A;  2I5K A;  3V4E A;  5L6S A;  4H7O A;  4N6B A;  3OH2 A;  4G3P A;  4M99 A;  2V0I A;  4N6A A;  3GQ8 A;  3D8V A;  1XHD A;  3OSJ A;  3SUC A;  1YP3 A;  3TV0 A;  4HUS A;  2OEF A;  3VBP A;  3GQ7 A;  3R3I A;  1G95 A;  2IU9 A;  4E6U A;  3OH3 A;  1FXJ A;  2IU8 A;  3FWW A;  3R5D A;  4R7P A;  3VBK A;  3P1B A;  2QKX A;  2OEG A;  1G97 A;  3JQY A;  4HCQ A;  3OU9 A;  4ISX A;  1QRG A;  4MZU A;  1EWW A;  1KHR A;  1KK6 A;  3GQ9 A;  3KWC A;  4AA7 A; 
#chains in the Genus database with same CATH homology
 3OHW A;  1KK5 A;  4M98 A;  3OTZ A;  2VHE A;  2XAT A;  4EAB A;  5E3R A;  5L6V A;  2VD4 A;  4HZC A;  3R3R A;  4N27 A;  5AFU V;  5DEP A;  2QIV X;  1QRE A;  4N69 A;  1XAT A;  3FSX A;  3PRU A;  3DHO A;  3GVD A;  3EG4 A;  3PMO A;  1QQ0 A;  2W0W A;  1KRV A;  3OW5 A;  2GGO A;  2WLG A;  3FSB A;  3FSC A;  3IGJ A;  3VBI A;  1Z90 A;  3HJJ A;  2AQ9 A;  3P47 A;  1QRM A;  4MFG A;  3MQG A;  5E3Q A;  3FSY A;  1HV9 A;  4KNX A;  3SRT A;  5F42 A;  4M2A A;  1KRU A;  3FS8 A;  4E1K A;  3R2W A;  3ECT A;  3I3X A;  4J18 A;  2P2O A;  3F1X A;  4M28 A;  2IC7 A;  1SSQ A;  3CJ8 A;  2L06 A;  1LXA A;  3MC4 A;  1KQA A;  3T57 A;  1V3W A;  1HM0 A;  3TWD A;  4EGG A;  4K6R A;  3KWD A;  3VBJ A;  2WLD A;  3Q1X A;  3SPT A;  2QIA A;  2V0L A;  2FKO A;  1KRR A;  2ICY A;  3NPH B;  2WLE A;  1KGT A;  2OI5 A;  3R1W A;  3TDT A;  3BSY A;  2WLC A;  1J2Z A;  5DG3 A;  3MQH A;  4R37 A;  4M9C A;  3KWE A;  3VBN A;  3HSQ A;  3D98 A;  2L8V A;  1V67 A;  2KY4 A;  2V0K A;  5E3P A;  3ST8 A;  4E79 A;  4EA7 A;  3TIS A;  1YP4 A;  4E6T A;  3OTM A;  3BFP A;  1MR9 A;  2L3W A;  4EA9 A;  1SST A;  3C8V A;  4G3S A;  4AC3 A;  5ADX U;  4KPX A;  1MR7 A;  1OCX A;  4FCE A;  4R36 A;  3DK5 A;  3DJ4 A;  2NPO A;  4IHF A;  3R5C A;  4J09 A;  3VBL A;  4E75 A;  3BRK X;  1QRL A;  3BXY A;  1S80 A;  1HM8 A;  2OI7 A;  4KPZ A;  4AAW A;  2WLF A;  3FOQ A;  5DEM A;  3VNP A;  2OI6 A;  1SSM A;  1T3D A;  4EA8 A;  4KQL A;  4EAA A;  3I3A A;  2TDT A;  2JF2 A;  3GUE A;  1THJ A;  2V0J A;  3OUP A;  2RIJ A;  4M2B A;  4G3Q A;  1QRF A;  3TIO A;  4KNR A;  3EH0 A;  3GOS A;  3R0S A;  2IUA A;  4EQY A;  5ADX V;  4HZD A;  3R5A A;  4HUR A;  1TDT A;  4DCL A;  3EEV A;  5AFU U;  4IHG A;  3NZ2 A;  4IHH A;  1HM9 A;  1KGQ A;  1MRL A;  5U2K A;  3BSS A;  2GGQ A;  4G87 A;  1KK4 A;  1YP2 A;  2JF3 A;  3TK8 A;  3FTT A;  1FWY A;  4MYO A;  2ICX A;  3R8Y A;  3R5B A;  3VBM A;  2V0H A;  2W0V A;  2Q4J A;  3IXC A;  3BSW A;  2I5K A;  3V4E A;  5L6S A;  4H7O A;  4N6B A;  4G3P A;  4M99 A;  2V0I A;  4N6A A;  3D8V A;  1XHD A;  3OSJ A;  1YP3 A;  3TV0 A;  4HUS A;  2OEF A;  3VBP A;  3R3I A;  1G95 A;  2IU9 A;  4E6U A;  1FXJ A;  2IU8 A;  3FWW A;  3R5D A;  4R7P A;  3VBK A;  3P1B A;  2QKX A;  2OEG A;  1G97 A;  3JQY A;  4HCQ A;  3OU9 A;  4ISX A;  1QRG A;  4MZU A;  1KHR A;  1KK6 A;  3KWC A;  4AA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...