3F1XA

Three dimensional structure of the serine acetyltransferase from bacteroides vulgatus, northeast structural genomics consortium target bvr62.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
299
structure length
276
Chain Sequence
TTFNYTNILTQAVDELSESQSYKGLFHQHKDGDPLPSAKSLYKIVELARAIIFPGYFGNSTVNSHTINYHIGVNVETLFGLLTEQILAGLCFGDNEPCRETASLLAARFISKLPELRRILATDVEAAYYGDPAATCFGEIISCYPAIRAISNYRIAHELLILGVPLIPRFITEMAHSETGIDIHPGAQIGHHFTIDHGTGVVIGATSIIGNNVKLYQGVTLGAKPRHPILEDDVIVYSNATILGRVTIGKGATVGGNIWVTENVPAGSRIVQRKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine acetyltransferase
publication title Three dimensional structure of the serine acetyltransferase from Bacteroides vulgatus, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET BVR62.
rcsb
source organism Bacteroides vulgatus atcc 8482
total genus 88
structure length 276
sequence length 299
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.10 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3f1xA01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3f1xA02
4KPXA 2WLDA 3TISA 1YP3A 2VHEA 3BSSA 1Z90A 4J09A 3D98A 4N6BA 3DHOA 3R3IA 4J18A 3VBLA 4EA9A 3Q1XA 3EG4A 1KHRA 2P2OA 2V0LA 3KWCA 3BSYA 1QRGA 2OI6A 5U2KA 5ADXV 1MR9A 3FWWA 1G95A 3MQGA 3TV0A 3D8VA 3DK5A 4N69A 4R36A 5E3RA 5E3QA 3VBMA 2V0KA 1KRRA 3FSYA 4N6AA 2TDTA 4G3PA 4E1KA 3EEVA 3HSQA 2RIJA 3ECTA 3IGJA 2WLCA 1KQAA 4HZDA 3KWEA 1YP4A 3PMOA 2WLGA 3OTMA 4HCQA 4M2BA 1QRLA 2NPOA 4E79A 3I3XA 3P47A 3MQHA 2VD4A 3P1BA 1V67A 3R5DA 1SSQA 3FSXA 3VBIA 1HV9A 4EA8A 4EABA 2JF3A 3FSCA 3KWDA 1G97A 3TK8A 1KK4A 1SSTA 3BXYA 1QQ0A 4HUSA 1QRMA 3NZ2A 2Q4JA 4AAWA 4IHFA 1KRUA 2ICXA 3OTZA 4IHHA 3JQYA 4K6RA 2QKXA 2GGQA 3GVDA 5DEPA 1HM8A 2I5KA 4MFGA 2V0HA 3C8VA 4H7OA 4EGGA 2OI7A 3R0SA 1SSMA 3R5CA 2QIVX 1OCXA 2IU9A 3OW5A 1KK6A 2IC7A 2W0VA 3VNPA 4HZCA 3VBNA 4KNRA 3DJ4A 5L6VA 4FCEA 3F1XA 3BRKX 2WLFA 4E6TA 2OEGA 3SRTA 2V0IA 4R37A 4AC3A 5DG3A 4M28A 4M2AA 3EH0A 4KPZA 3HJJA 3R5BA 3TIOA 1V3WA 2JF2A 3OUPA 4G3SA 4M98A 5L6SA 2GGOA 1HM9A 4EA7A 1QREA 3TWDA 3R2WA 5AFUV 3R1WA 4R7PA 2IU8A 1T3DA 2XATA 1S80A 1YP2A 2IUAA 3BFPA 3R3RA 3VBPA 1XATA 5DEMA 1MR7A 4KNXA 3CJ8A 4G87A 1KGTA 4KQLA 3FOQA 2FKOA 2WLEA 5F42A 1XHDA 3SPTA 5E3PA 1KK5A 4E6UA 3I3AA 1MRLA 4G3QA 3VBKA 2QIAA 1HM0A 4E75A 4N27A 2ICYA 4AA7A 4IHGA 3IXCA 1FWYA 5AFUU 4MZUA 1KGQA 1FXJA 1TDTA 3MC4A 4M9CA 3VBJA 4ISXA 3BSWA 3FS8A 4MYOA 4EQYA 2V0JA 3R8YA 1THJA 3GUEA 4M99A 1KRVA 4EAAA 3V4EA 3GOSA 4HURA 3OU9A 1LXAA 2OEFA 3TDTA 2AQ9A 3R5AA 2OI5A 1QRFA 4DCLA 3FSBA 1J2ZA 5ADXU 3ST8A 3T57A 2W0WA 3FTTA
chains in the Genus database with same CATH superfamily
4KPXA 2WLDA 3TISA 1YP3A 2VHEA 3BSSA 1Z90A 4J09A 3D98A 4N6BA 3DHOA 3R3IA 4J18A 3VBLA 4EA9A 3OHWA 3Q1XA 3EG4A 1KHRA 2P2OA 2V0LA 3KWCA 3BSYA 1QRGA 2OI6A 5U2KA 5ADXV 1MR9A 3FWWA 3GQ9A 1G95A 3OH3A 3MQGA 3TV0A 3D8VA 3DK5A 4N69A 3PRUA 4R36A 5E3RA 5E3QA 3VBMA 2V0KA 1KRRA 3FSYA 4N6AA 2TDTA 4G3PA 4E1KA 3EEVA 3HSQA 2RIJA 3ECTA 3IGJA 2WLCA 1KQAA 2L06A 4HZDA 3KWEA 1YP4A 3PMOA 2WLGA 3OTMA 4HCQA 3OH0A 4M2BA 1QRLA 2NPOA 4E79A 1N4IA 3I3XA 3P47A 3MQHA 2VD4A 3P1BA 1V67A 3R5DA 1SSQA 3GQ7A 1EWWA 3FSXA 3VBIA 1HV9A 4EA8A 4EABA 2JF3A 3FSCA 3KWDA 1G97A 3TK8A 1KK4A 3GQAA 1SSTA 3BXYA 1QQ0A 4HUSA 1QRMA 3NZ2A 2Q4JA 4AAWA 4IHFA 1KRUA 2ICXA 3OTZA 4IHHA 3JQYA 4K6RA 2QKXA 2GGQA 3GVDA 5DEPA 1HM8A 2I5KA 4MFGA 2V0HA 3C8VA 4H7OA 4EGGA 2OI7A 3R0SA 1SSMA 3R5CA 2QIVX 1OCXA 2IU9A 3OW5A 1KK6A 2IC7A 2W0VA 3VNPA 4HZCA 3VBNA 4KNRA 3DJ4A 5L6VA 4FCEA 3F1XA 3BRKX 2WLFA 4E6TA 1M8NA 2L3WA 3NPHB 2OEGA 3SRTA 2V0IA 4R37A 4AC3A 5DG3A 4M28A 4M2AA 2KY4A 3EH0A 3OH2A 4KPZA 3HJJA 3R5BA 3TIOA 1V3WA 2JF2A 3OUPA 4G3SA 4M98A 5L6SA 2GGOA 1HM9A 4EA7A 1QREA 3TWDA 3R2WA 5AFUV 3R1WA 4R7PA 2IU8A 3OH4A 3OSJA 1T3DA 2XATA 1S80A 1YP2A 2IUAA 3BFPA 3OH1A 3R3RA 3SUCA 3OGZA 3VBPA 1L0SA 1XATA 1MR7A 5DEMA 4KNXA 3CJ8A 4G87A 2L8VA 1KGTA 4KQLA 3FOQA 2FKOA 2WLEA 5F42A 1XHDA 3SPTA 5E3PA 1KK5A 4E6UA 3I3AA 1MRLA 4G3QA 3VBKA 2QIAA 1HM0A 4E75A 4N27A 2ICYA 4AA7A 4IHGA 3IXCA 1FWYA 5AFUU 4MZUA 1KGQA 1FXJA 1TDTA 3MC4A 4M9CA 3VBJA 4ISXA 3BSWA 3GQ8A 3FS8A 4MYOA 4EQYA 2V0JA 3R8YA 1THJA 3GUEA 4M99A 1KRVA 4EAAA 3V4EA 3GOSA 4HURA 3OU9A 1LXAA 2OEFA 3TDTA 2AQ9A 3R5AA 1Z2FA 2OI5A 1QRFA 4DCLA 3FSBA 1J2ZA 5ADXU 3ST8A 3T57A 2W0WA 3FTTA
chains in the Genus database with same CATH topology
4KPXA 2WLDA 3TISA 1YP3A 2VHEA 3BSSA 1Z90A 4J09A 3D98A 4N6BA 3DHOA 3R3IA 4J18A 3VBLA 4EA9A 3OHWA 3Q1XA 3EG4A 1KHRA 2P2OA 2V0LA 3KWCA 3BSYA 1QRGA 2OI6A 5U2KA 5ADXV 1MR9A 3FWWA 1G95A 3MQGA 3TV0A 3D8VA 3DK5A 4N69A 3PRUA 4R36A 5E3RA 5E3QA 3VBMA 2V0KA 1KRRA 3FSYA 4N6AA 2TDTA 4G3PA 4E1KA 3EEVA 3HSQA 2RIJA 3ECTA 3IGJA 2WLCA 1KQAA 2L06A 4HZDA 3KWEA 1YP4A 3PMOA 2WLGA 3OTMA 4HCQA 4M2BA 1QRLA 2NPOA 4E79A 3I3XA 3P47A 3MQHA 2VD4A 3P1BA 1V67A 3R5DA 1SSQA 3FSXA 3VBIA 1HV9A 4EA8A 4EABA 2JF3A 3FSCA 3KWDA 1G97A 3TK8A 1KK4A 1SSTA 3BXYA 1QQ0A 4HUSA 1QRMA 3NZ2A 2Q4JA 4AAWA 4IHFA 1KRUA 2ICXA 3OTZA 4IHHA 3JQYA 4K6RA 2QKXA 2GGQA 3GVDA 5DEPA 1HM8A 2I5KA 4MFGA 2V0HA 3C8VA 4H7OA 4EGGA 2OI7A 3R0SA 1SSMA 3R5CA 2QIVX 1OCXA 2IU9A 3OW5A 1KK6A 2IC7A 2W0VA 3VNPA 4HZCA 3VBNA 4KNRA 3DJ4A 5L6VA 4FCEA 3F1XA 3BRKX 2WLFA 4E6TA 2L3WA 3NPHB 2OEGA 3SRTA 2V0IA 4R37A 4AC3A 5DG3A 4M28A 4M2AA 2KY4A 3EH0A 4KPZA 3HJJA 3R5BA 3TIOA 1V3WA 2JF2A 3OUPA 4G3SA 4M98A 5L6SA 2GGOA 1HM9A 4EA7A 1QREA 3TWDA 3R2WA 5AFUV 3R1WA 4R7PA 2IU8A 3OSJA 1T3DA 2XATA 1S80A 1YP2A 2IUAA 3BFPA 3R3RA 3VBPA 1XATA 5DEMA 1MR7A 4KNXA 3CJ8A 4G87A 2L8VA 1KGTA 4KQLA 3FOQA 2FKOA 2WLEA 5F42A 1XHDA 3SPTA 5E3PA 1KK5A 4E6UA 3I3AA 1MRLA 4G3QA 3VBKA 2QIAA 1HM0A 4E75A 4N27A 2ICYA 4AA7A 4IHGA 3IXCA 1FWYA 5AFUU 4MZUA 1KGQA 1FXJA 1TDTA 3MC4A 4M9CA 3VBJA 4ISXA 3BSWA 3FS8A 4MYOA 4EQYA 2V0JA 3R8YA 1THJA 3GUEA 4M99A 1KRVA 4EAAA 3V4EA 3GOSA 4HURA 3OU9A 1LXAA 2OEFA 3TDTA 2AQ9A 3R5AA 2OI5A 1QRFA 4DCLA 3FSBA 1J2ZA 5ADXU 3ST8A 3T57A 2W0WA 3FTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPX A;  2WLD A;  3TIS A;  1YP3 A;  2VHE A;  3BSS A;  1Z90 A;  4J09 A;  3D98 A;  4N6B A;  3DHO A;  3R3I A;  4J18 A;  3VBL A;  4EA9 A;  3Q1X A;  3EG4 A;  1KHR A;  2P2O A;  2V0L A;  3KWC A;  3BSY A;  1QRG A;  2OI6 A;  5U2K A;  5ADX V;  1MR9 A;  3FWW A;  1G95 A;  3MQG A;  3TV0 A;  3D8V A;  3DK5 A;  4N69 A;  4R36 A;  5E3R A;  5E3Q A;  3VBM A;  2V0K A;  1KRR A;  3FSY A;  4N6A A;  2TDT A;  4G3P A;  4E1K A;  3EEV A;  3HSQ A;  2RIJ A;  3ECT A;  3IGJ A;  2WLC A;  1KQA A;  4HZD A;  3KWE A;  1YP4 A;  3PMO A;  2WLG A;  3OTM A;  4HCQ A;  4M2B A;  1QRL A;  2NPO A;  4E79 A;  3I3X A;  3P47 A;  3MQH A;  2VD4 A;  3P1B A;  1V67 A;  3R5D A;  1SSQ A;  3FSX A;  3VBI A;  1HV9 A;  4EA8 A;  4EAB A;  2JF3 A;  3FSC A;  3KWD A;  1G97 A;  3TK8 A;  1KK4 A;  1SST A;  3BXY A;  1QQ0 A;  4HUS A;  1QRM A;  3NZ2 A;  2Q4J A;  4AAW A;  4IHF A;  1KRU A;  2ICX A;  3OTZ A;  4IHH A;  3JQY A;  4K6R A;  2QKX A;  2GGQ A;  3GVD A;  5DEP A;  1HM8 A;  2I5K A;  4MFG A;  2V0H A;  3C8V A;  4H7O A;  4EGG A;  2OI7 A;  3R0S A;  1SSM A;  3R5C A;  2QIV X;  1OCX A;  2IU9 A;  3OW5 A;  1KK6 A;  2IC7 A;  2W0V A;  3VNP A;  4HZC A;  3VBN A;  4KNR A;  3DJ4 A;  5L6V A;  4FCE A;  3F1X A;  3BRK X;  2WLF A;  4E6T A;  2OEG A;  3SRT A;  2V0I A;  4R37 A;  4AC3 A;  5DG3 A;  4M28 A;  4M2A A;  3EH0 A;  4KPZ A;  3HJJ A;  3R5B A;  3TIO A;  1V3W A;  2JF2 A;  3OUP A;  4G3S A;  4M98 A;  5L6S A;  2GGO A;  1HM9 A;  4EA7 A;  1QRE A;  3TWD A;  3R2W A;  5AFU V;  3R1W A;  4R7P A;  2IU8 A;  1T3D A;  2XAT A;  1S80 A;  1YP2 A;  2IUA A;  3BFP A;  3R3R A;  3VBP A;  1XAT A;  5DEM A;  1MR7 A;  4KNX A;  3CJ8 A;  4G87 A;  1KGT A;  4KQL A;  3FOQ A;  2FKO A;  2WLE A;  5F42 A;  1XHD A;  3SPT A;  5E3P A;  1KK5 A;  4E6U A;  3I3A A;  1MRL A;  4G3Q A;  3VBK A;  2QIA A;  1HM0 A;  4E75 A;  4N27 A;  2ICY A;  4AA7 A;  4IHG A;  3IXC A;  1FWY A;  5AFU U;  4MZU A;  1KGQ A;  1FXJ A;  1TDT A;  3MC4 A;  4M9C A;  3VBJ A;  4ISX A;  3BSW A;  3FS8 A;  4MYO A;  4EQY A;  2V0J A;  3R8Y A;  1THJ A;  3GUE A;  4M99 A;  1KRV A;  4EAA A;  3V4E A;  3GOS A;  4HUR A;  3OU9 A;  1LXA A;  2OEF A;  3TDT A;  2AQ9 A;  3R5A A;  2OI5 A;  1QRF A;  4DCL A;  3FSB A;  1J2Z A;  5ADX U;  3ST8 A;  3T57 A;  2W0W A;  3FTT A; 
#chains in the Genus database with same CATH topology
 4KPX A;  2WLD A;  3TIS A;  1YP3 A;  2VHE A;  3BSS A;  1Z90 A;  4J09 A;  3D98 A;  4N6B A;  3DHO A;  3R3I A;  4J18 A;  3VBL A;  4EA9 A;  3OHW A;  3Q1X A;  3EG4 A;  1KHR A;  2P2O A;  2V0L A;  3KWC A;  3BSY A;  1QRG A;  2OI6 A;  5U2K A;  5ADX V;  1MR9 A;  3FWW A;  3GQ9 A;  1G95 A;  3OH3 A;  3MQG A;  3TV0 A;  3D8V A;  3DK5 A;  4N69 A;  3PRU A;  4R36 A;  5E3R A;  5E3Q A;  3VBM A;  2V0K A;  1KRR A;  3FSY A;  4N6A A;  2TDT A;  4G3P A;  4E1K A;  3EEV A;  3HSQ A;  2RIJ A;  3ECT A;  3IGJ A;  2WLC A;  1KQA A;  2L06 A;  4HZD A;  3KWE A;  1YP4 A;  3PMO A;  2WLG A;  3OTM A;  4HCQ A;  3OH0 A;  4M2B A;  1QRL A;  2NPO A;  4E79 A;  1N4I A;  3I3X A;  3P47 A;  3MQH A;  2VD4 A;  3P1B A;  1V67 A;  3R5D A;  1SSQ A;  3GQ7 A;  1EWW A;  3FSX A;  3VBI A;  1HV9 A;  4EA8 A;  4EAB A;  2JF3 A;  3FSC A;  3KWD A;  1G97 A;  3TK8 A;  1KK4 A;  3GQA A;  1SST A;  3BXY A;  1QQ0 A;  4HUS A;  1QRM A;  3NZ2 A;  2Q4J A;  4AAW A;  4IHF A;  1KRU A;  2ICX A;  3OTZ A;  4IHH A;  3JQY A;  4K6R A;  2QKX A;  2GGQ A;  3GVD A;  5DEP A;  1HM8 A;  2I5K A;  4MFG A;  2V0H A;  3C8V A;  4H7O A;  4EGG A;  2OI7 A;  3R0S A;  1SSM A;  3R5C A;  2QIV X;  1OCX A;  2IU9 A;  3OW5 A;  1KK6 A;  2IC7 A;  2W0V A;  3VNP A;  4HZC A;  3VBN A;  4KNR A;  3DJ4 A;  5L6V A;  4FCE A;  3F1X A;  3BRK X;  2WLF A;  4E6T A;  1M8N A;  2L3W A;  3NPH B;  2OEG A;  3SRT A;  2V0I A;  4R37 A;  4AC3 A;  5DG3 A;  4M28 A;  4M2A A;  2KY4 A;  3EH0 A;  3OH2 A;  4KPZ A;  3HJJ A;  3R5B A;  3TIO A;  1V3W A;  2JF2 A;  3OUP A;  4G3S A;  4M98 A;  5L6S A;  2GGO A;  1HM9 A;  4EA7 A;  1QRE A;  3TWD A;  3R2W A;  5AFU V;  3R1W A;  4R7P A;  2IU8 A;  3OH4 A;  3OSJ A;  1T3D A;  2XAT A;  1S80 A;  1YP2 A;  2IUA A;  3BFP A;  3OH1 A;  3R3R A;  3SUC A;  3OGZ A;  3VBP A;  1L0S A;  1XAT A;  1MR7 A;  5DEM A;  4KNX A;  3CJ8 A;  4G87 A;  2L8V A;  1KGT A;  4KQL A;  3FOQ A;  2FKO A;  2WLE A;  5F42 A;  1XHD A;  3SPT A;  5E3P A;  1KK5 A;  4E6U A;  3I3A A;  1MRL A;  4G3Q A;  3VBK A;  2QIA A;  1HM0 A;  4E75 A;  4N27 A;  2ICY A;  4AA7 A;  4IHG A;  3IXC A;  1FWY A;  5AFU U;  4MZU A;  1KGQ A;  1FXJ A;  1TDT A;  3MC4 A;  4M9C A;  3VBJ A;  4ISX A;  3BSW A;  3GQ8 A;  3FS8 A;  4MYO A;  4EQY A;  2V0J A;  3R8Y A;  1THJ A;  3GUE A;  4M99 A;  1KRV A;  4EAA A;  3V4E A;  3GOS A;  4HUR A;  3OU9 A;  1LXA A;  2OEF A;  3TDT A;  2AQ9 A;  3R5A A;  1Z2F A;  2OI5 A;  1QRF A;  4DCL A;  3FSB A;  1J2Z A;  5ADX U;  3ST8 A;  3T57 A;  2W0W A;  3FTT A; 
#chains in the Genus database with same CATH homology
 4KPX A;  2WLD A;  3TIS A;  1YP3 A;  2VHE A;  3BSS A;  1Z90 A;  4J09 A;  3D98 A;  4N6B A;  3DHO A;  3R3I A;  4J18 A;  3VBL A;  4EA9 A;  3OHW A;  3Q1X A;  3EG4 A;  1KHR A;  2P2O A;  2V0L A;  3KWC A;  3BSY A;  1QRG A;  2OI6 A;  5U2K A;  5ADX V;  1MR9 A;  3FWW A;  1G95 A;  3MQG A;  3TV0 A;  3D8V A;  3DK5 A;  4N69 A;  3PRU A;  4R36 A;  5E3R A;  5E3Q A;  3VBM A;  2V0K A;  1KRR A;  3FSY A;  4N6A A;  2TDT A;  4G3P A;  4E1K A;  3EEV A;  3HSQ A;  2RIJ A;  3ECT A;  3IGJ A;  2WLC A;  1KQA A;  2L06 A;  4HZD A;  3KWE A;  1YP4 A;  3PMO A;  2WLG A;  3OTM A;  4HCQ A;  4M2B A;  1QRL A;  2NPO A;  4E79 A;  3I3X A;  3P47 A;  3MQH A;  2VD4 A;  3P1B A;  1V67 A;  3R5D A;  1SSQ A;  3FSX A;  3VBI A;  1HV9 A;  4EA8 A;  4EAB A;  2JF3 A;  3FSC A;  3KWD A;  1G97 A;  3TK8 A;  1KK4 A;  1SST A;  3BXY A;  1QQ0 A;  4HUS A;  1QRM A;  3NZ2 A;  2Q4J A;  4AAW A;  4IHF A;  1KRU A;  2ICX A;  3OTZ A;  4IHH A;  3JQY A;  4K6R A;  2QKX A;  2GGQ A;  3GVD A;  5DEP A;  1HM8 A;  2I5K A;  4MFG A;  2V0H A;  3C8V A;  4H7O A;  4EGG A;  2OI7 A;  3R0S A;  1SSM A;  3R5C A;  2QIV X;  1OCX A;  2IU9 A;  3OW5 A;  1KK6 A;  2IC7 A;  2W0V A;  3VNP A;  4HZC A;  3VBN A;  4KNR A;  3DJ4 A;  5L6V A;  4FCE A;  3F1X A;  3BRK X;  2WLF A;  4E6T A;  2L3W A;  3NPH B;  2OEG A;  3SRT A;  2V0I A;  4R37 A;  4AC3 A;  5DG3 A;  4M28 A;  4M2A A;  2KY4 A;  3EH0 A;  4KPZ A;  3HJJ A;  3R5B A;  3TIO A;  1V3W A;  2JF2 A;  3OUP A;  4G3S A;  4M98 A;  5L6S A;  2GGO A;  1HM9 A;  4EA7 A;  1QRE A;  3TWD A;  3R2W A;  5AFU V;  3R1W A;  4R7P A;  2IU8 A;  3OSJ A;  1T3D A;  2XAT A;  1S80 A;  1YP2 A;  2IUA A;  3BFP A;  3R3R A;  3VBP A;  1XAT A;  5DEM A;  1MR7 A;  4KNX A;  3CJ8 A;  4G87 A;  2L8V A;  1KGT A;  4KQL A;  3FOQ A;  2FKO A;  2WLE A;  5F42 A;  1XHD A;  3SPT A;  5E3P A;  1KK5 A;  4E6U A;  3I3A A;  1MRL A;  4G3Q A;  3VBK A;  2QIA A;  1HM0 A;  4E75 A;  4N27 A;  2ICY A;  4AA7 A;  4IHG A;  3IXC A;  1FWY A;  5AFU U;  4MZU A;  1KGQ A;  1FXJ A;  1TDT A;  3MC4 A;  4M9C A;  3VBJ A;  4ISX A;  3BSW A;  3FS8 A;  4MYO A;  4EQY A;  2V0J A;  3R8Y A;  1THJ A;  3GUE A;  4M99 A;  1KRV A;  4EAA A;  3V4E A;  3GOS A;  4HUR A;  3OU9 A;  1LXA A;  2OEF A;  3TDT A;  2AQ9 A;  3R5A A;  2OI5 A;  1QRF A;  4DCL A;  3FSB A;  1J2Z A;  5ADX U;  3ST8 A;  3T57 A;  2W0W A;  3FTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...