3P1BA

Crystal structure of the native serine acetyltransferase 1 from entamoeba histolytica
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
266
Chain Sequence
AMDNYIYSIAHQLYEMYLQDEDAFHSKRDYPHKKVFTELQKLRKIFFPDFFMKHQKITESHIASELTKLVDYIKDSVTAYNDELFAHQCVMAILEKLPSIKRTLKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine acetyltransferase
publication title Structural and biochemical studies of serine acetyltransferase reveal why the parasite Entamoeba histolytica cannot form a cysteine synthase complex
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 102
structure length 266
sequence length 269
ec nomenclature ec 2.3.1.30: Serine O-acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.10 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3p1bA01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3p1bA02
3R8YA 2XATA 1QRGA 3BSWA 3CJ8A 1KRRA 4N6AA 3OW5A 4N6BA 1KQAA 2IU9A 2TDTA 3I3AA 1YP4A 4J18A 3OUPA 1KGQA 2WLEA 4KQLA 3R3RA 4K6RA 1HM9A 1QRFA 1V67A 1YP3A 3VBIA 3PMOA 2WLFA 2RIJA 5AFUV 3VBLA 4G3PA 1TDTA 1V3WA 3VNPA 3EH0A 1KHRA 4M9CA 4M28A 3D98A 1KGTA 4E6TA 1XATA 3VBNA 3GOSA 3T57A 4EABA 3R5AA 3R5CA 3F1XA 4E6UA 2OEFA 3R0SA 3FSCA 4M2BA 5DEMA 3TK8A 4EA8A 4N69A 1QQ0A 5ADXU 1Z90A 3JQYA 1KK4A 3P1BA 4G3SA 4R37A 3EG4A 4H7OA 3OU9A 3Q1XA 3IXCA 3R5DA 4HUSA 1MR9A 3TWDA 3TDTA 4G3QA 3FSXA 1SSMA 2NPOA 2OI5A 2Q4JA 3MQHA 3EEVA 2VD4A 3DHOA 4G87A 1QREA 3VBPA 1KRUA 2V0LA 2WLGA 5E3QA 1FXJA 4DCLA 3R2WA 5L6VA 5DG3A 1J2ZA 2QIAA 1KRVA 4MFGA 4EA7A 5U2KA 2IC7A 3SPTA 3R1WA 2ICYA 2I5KA 1HV9A 1HM0A 1MRLA 4KPZA 5F42A 4E79A 1HM8A 2V0IA 3FS8A 4ISXA 3BSYA 4HZDA 2IUAA 3FOQA 3MQGA 3KWCA 4IHHA 4R7PA 3ST8A 4E1KA 2QIVX 4E75A 3HJJA 1YP2A 1MR7A 3TISA 2JF3A 4M99A 3FSBA 1QRMA 1G97A 1THJA 3VBJA 2WLDA 2FKOA 4HURA 4MYOA 3KWEA 3HSQA 3MC4A 2GGQA 4M98A 4KNXA 5AFUU 4EGGA 2JF2A 4FCEA 3TV0A 3D8VA 3FTTA 3BRKX 3TIOA 1KK5A 4EQYA 4M2AA 4N27A 3NZ2A 3VBMA 2OI6A 4KPXA 2P2OA 4AAWA 4EAAA 2IU8A 4J09A 1LXAA 3BFPA 2OEGA 1S80A 3BSSA 3FWWA 3OTZA 3SRTA 3R5BA 3V4EA 5E3RA 5L6SA 2VHEA 5ADXV 2ICXA 3R3IA 4HCQA 1KK6A 3GVDA 3OTMA 1OCXA 2GGOA 3VBKA 5DEPA 2WLCA 4IHGA 2AQ9A 2V0HA 2W0VA 4IHFA 3I3XA 1T3DA 3FSYA 3C8VA 5E3PA 1SSTA 1QRLA 3DJ4A 2V0JA 3GUEA 1XHDA 3KWDA 1SSQA 3BXYA 3IGJA 3DK5A 4KNRA 4MZUA 4HZCA 2W0WA 2OI7A 1FWYA 1G95A 3P47A 4AA7A 3ECTA 4EA9A 4R36A 2V0KA 2QKXA 4AC3A
chains in the Genus database with same CATH superfamily
3R8YA 2XATA 1QRGA 3BSWA 3CJ8A 1KRRA 3OHWA 4N6AA 2L8VA 3OW5A 4N6BA 1KQAA 2IU9A 2TDTA 3I3AA 1YP4A 4J18A 3OUPA 1KGQA 2WLEA 4KQLA 3R3RA 4K6RA 1HM9A 1QRFA 1V67A 1YP3A 3OH0A 3PMOA 2WLFA 2RIJA 5AFUV 3VBLA 4G3PA 1TDTA 1V3WA 3VNPA 3EH0A 1KHRA 4M9CA 4M28A 3OH4A 3D98A 1KGTA 4E6TA 1XATA 3VBNA 3GOSA 1L0SA 3T57A 3GQAA 4EABA 3R5AA 3R5CA 3F1XA 4E6UA 3PRUA 2OEFA 3R0SA 3FSCA 1M8NA 4M2BA 5DEMA 2L06A 3TK8A 4EA8A 1QQ0A 4N69A 5ADXU 3OSJA 1Z90A 3JQYA 1KK4A 3P1BA 4G3SA 4R37A 3EG4A 4H7OA 3OU9A 3Q1XA 3OH3A 3IXCA 3R5DA 4HUSA 1MR9A 3TWDA 3TDTA 4G3QA 3FSXA 1SSMA 2NPOA 2OI5A 2Q4JA 3GQ7A 3MQHA 3EEVA 2VD4A 3DHOA 1EWWA 4G87A 1QREA 3VBPA 1KRUA 2V0LA 2WLGA 5E3QA 1FXJA 4DCLA 3R2WA 3GQ9A 5L6VA 5DG3A 1J2ZA 2QIAA 1KRVA 4MFGA 4EA7A 5U2KA 2IC7A 3VBIA 3OH1A 3SPTA 3R1WA 2ICYA 2I5KA 1HV9A 3NPHB 1HM0A 1MRLA 1N4IA 4KPZA 5F42A 4E79A 1HM8A 2V0IA 2KY4A 3FS8A 4ISXA 3BSYA 4HZDA 2IUAA 3FOQA 3MQGA 3KWCA 4IHHA 4R7PA 3ST8A 4E1KA 2QIVX 4E75A 3HJJA 1YP2A 1MR7A 1Z2FA 3TISA 2JF3A 4M99A 3OGZA 2L3WA 3FSBA 1QRMA 1G97A 1THJA 3VBJA 2WLDA 2FKOA 4HURA 4MYOA 3KWEA 3HSQA 3MC4A 2GGQA 4M98A 4KNXA 5AFUU 4EGGA 2JF2A 4FCEA 3TV0A 3D8VA 3FTTA 3BRKX 3TIOA 1KK5A 4EQYA 4M2AA 4N27A 3NZ2A 3VBMA 2OI6A 4KPXA 2P2OA 4AAWA 4EAAA 2IU8A 4J09A 1LXAA 3BFPA 2OEGA 1S80A 3BSSA 3FWWA 3OTZA 3SRTA 3R5BA 3V4EA 5E3RA 5L6SA 2VHEA 5ADXV 2ICXA 3R3IA 3SUCA 4HCQA 1KK6A 3GVDA 3OTMA 1OCXA 2GGOA 3VBKA 5DEPA 2WLCA 4IHGA 2AQ9A 2V0HA 2W0VA 4IHFA 3I3XA 1T3DA 3FSYA 3C8VA 5E3PA 1SSTA 1QRLA 3DJ4A 2V0JA 3GUEA 1XHDA 3KWDA 1SSQA 3BXYA 3IGJA 3DK5A 4KNRA 4MZUA 4HZCA 2W0WA 2OI7A 1FWYA 1G95A 3P47A 4AA7A 3ECTA 4EA9A 4R36A 3OH2A 2V0KA 2QKXA 3GQ8A 4AC3A
chains in the Genus database with same CATH topology
3R8YA 2XATA 1QRGA 3BSWA 3CJ8A 1KRRA 3OHWA 4N6AA 2L8VA 3OW5A 4N6BA 1KQAA 2IU9A 2TDTA 3I3AA 1YP4A 4J18A 3OUPA 1KGQA 2WLEA 4KQLA 3R3RA 4K6RA 1HM9A 1QRFA 1V67A 1YP3A 3VBIA 3PMOA 2WLFA 2RIJA 5AFUV 3VBLA 4G3PA 1TDTA 1V3WA 3VNPA 3EH0A 1KHRA 4M9CA 4M28A 3D98A 1KGTA 4E6TA 1XATA 3VBNA 3GOSA 3T57A 4EABA 3R5AA 3R5CA 3F1XA 4E6UA 3PRUA 2OEFA 3R0SA 3FSCA 4M2BA 5DEMA 3TK8A 2L06A 4EA8A 1QQ0A 4N69A 5ADXU 3OSJA 1Z90A 3JQYA 1KK4A 3P1BA 4G3SA 4R37A 3EG4A 4H7OA 3OU9A 3Q1XA 3IXCA 3R5DA 4HUSA 1MR9A 3TWDA 3TDTA 4G3QA 3FSXA 1SSMA 2NPOA 2OI5A 2Q4JA 3MQHA 3EEVA 2VD4A 3DHOA 4G87A 1QREA 3VBPA 1KRUA 2V0LA 2WLGA 5E3QA 1FXJA 4DCLA 3R2WA 5L6VA 5DG3A 1J2ZA 2QIAA 1KRVA 4MFGA 4EA7A 5U2KA 2IC7A 3SPTA 3R1WA 2ICYA 2I5KA 1HV9A 3NPHB 1HM0A 1MRLA 4KPZA 5F42A 4E79A 1HM8A 2V0IA 2KY4A 3FS8A 4ISXA 3BSYA 4HZDA 2IUAA 3FOQA 3MQGA 3KWCA 4IHHA 4R7PA 3ST8A 4E1KA 2QIVX 4E75A 3HJJA 1YP2A 1MR7A 3TISA 2JF3A 4M99A 2L3WA 3FSBA 1QRMA 1G97A 1THJA 3VBJA 2WLDA 2FKOA 4HURA 4MYOA 3KWEA 3HSQA 3MC4A 2GGQA 4M98A 4KNXA 5AFUU 4EGGA 2JF2A 4FCEA 3TV0A 3D8VA 3FTTA 3BRKX 3TIOA 1KK5A 4EQYA 4M2AA 4N27A 3NZ2A 3VBMA 2OI6A 4KPXA 2P2OA 4AAWA 4EAAA 2IU8A 4J09A 1LXAA 3BFPA 2OEGA 1S80A 3BSSA 3FWWA 3OTZA 3SRTA 3R5BA 3V4EA 5E3RA 5L6SA 2VHEA 5ADXV 2ICXA 3R3IA 4HCQA 1KK6A 3GVDA 3OTMA 1OCXA 2GGOA 3VBKA 5DEPA 2WLCA 4IHGA 2AQ9A 2V0HA 2W0VA 4IHFA 3I3XA 1T3DA 3FSYA 3C8VA 5E3PA 1SSTA 1QRLA 3DJ4A 2V0JA 3GUEA 1XHDA 3KWDA 1SSQA 3BXYA 3IGJA 3DK5A 4KNRA 4MZUA 4HZCA 2W0WA 2OI7A 1FWYA 1G95A 3P47A 4AA7A 3ECTA 4EA9A 4R36A 2V0KA 2QKXA 4AC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R8Y A;  2XAT A;  1QRG A;  3BSW A;  3CJ8 A;  1KRR A;  4N6A A;  3OW5 A;  4N6B A;  1KQA A;  2IU9 A;  2TDT A;  3I3A A;  1YP4 A;  4J18 A;  3OUP A;  1KGQ A;  2WLE A;  4KQL A;  3R3R A;  4K6R A;  1HM9 A;  1QRF A;  1V67 A;  1YP3 A;  3VBI A;  3PMO A;  2WLF A;  2RIJ A;  5AFU V;  3VBL A;  4G3P A;  1TDT A;  1V3W A;  3VNP A;  3EH0 A;  1KHR A;  4M9C A;  4M28 A;  3D98 A;  1KGT A;  4E6T A;  1XAT A;  3VBN A;  3GOS A;  3T57 A;  4EAB A;  3R5A A;  3R5C A;  3F1X A;  4E6U A;  2OEF A;  3R0S A;  3FSC A;  4M2B A;  5DEM A;  3TK8 A;  4EA8 A;  4N69 A;  1QQ0 A;  5ADX U;  1Z90 A;  3JQY A;  1KK4 A;  3P1B A;  4G3S A;  4R37 A;  3EG4 A;  4H7O A;  3OU9 A;  3Q1X A;  3IXC A;  3R5D A;  4HUS A;  1MR9 A;  3TWD A;  3TDT A;  4G3Q A;  3FSX A;  1SSM A;  2NPO A;  2OI5 A;  2Q4J A;  3MQH A;  3EEV A;  2VD4 A;  3DHO A;  4G87 A;  1QRE A;  3VBP A;  1KRU A;  2V0L A;  2WLG A;  5E3Q A;  1FXJ A;  4DCL A;  3R2W A;  5L6V A;  5DG3 A;  1J2Z A;  2QIA A;  1KRV A;  4MFG A;  4EA7 A;  5U2K A;  2IC7 A;  3SPT A;  3R1W A;  2ICY A;  2I5K A;  1HV9 A;  1HM0 A;  1MRL A;  4KPZ A;  5F42 A;  4E79 A;  1HM8 A;  2V0I A;  3FS8 A;  4ISX A;  3BSY A;  4HZD A;  2IUA A;  3FOQ A;  3MQG A;  3KWC A;  4IHH A;  4R7P A;  3ST8 A;  4E1K A;  2QIV X;  4E75 A;  3HJJ A;  1YP2 A;  1MR7 A;  3TIS A;  2JF3 A;  4M99 A;  3FSB A;  1QRM A;  1G97 A;  1THJ A;  3VBJ A;  2WLD A;  2FKO A;  4HUR A;  4MYO A;  3KWE A;  3HSQ A;  3MC4 A;  2GGQ A;  4M98 A;  4KNX A;  5AFU U;  4EGG A;  2JF2 A;  4FCE A;  3TV0 A;  3D8V A;  3FTT A;  3BRK X;  3TIO A;  1KK5 A;  4EQY A;  4M2A A;  4N27 A;  3NZ2 A;  3VBM A;  2OI6 A;  4KPX A;  2P2O A;  4AAW A;  4EAA A;  2IU8 A;  4J09 A;  1LXA A;  3BFP A;  2OEG A;  1S80 A;  3BSS A;  3FWW A;  3OTZ A;  3SRT A;  3R5B A;  3V4E A;  5E3R A;  5L6S A;  2VHE A;  5ADX V;  2ICX A;  3R3I A;  4HCQ A;  1KK6 A;  3GVD A;  3OTM A;  1OCX A;  2GGO A;  3VBK A;  5DEP A;  2WLC A;  4IHG A;  2AQ9 A;  2V0H A;  2W0V A;  4IHF A;  3I3X A;  1T3D A;  3FSY A;  3C8V A;  5E3P A;  1SST A;  1QRL A;  3DJ4 A;  2V0J A;  3GUE A;  1XHD A;  3KWD A;  1SSQ A;  3BXY A;  3IGJ A;  3DK5 A;  4KNR A;  4MZU A;  4HZC A;  2W0W A;  2OI7 A;  1FWY A;  1G95 A;  3P47 A;  4AA7 A;  3ECT A;  4EA9 A;  4R36 A;  2V0K A;  2QKX A;  4AC3 A; 
#chains in the Genus database with same CATH topology
 3R8Y A;  2XAT A;  1QRG A;  3BSW A;  3CJ8 A;  1KRR A;  3OHW A;  4N6A A;  2L8V A;  3OW5 A;  4N6B A;  1KQA A;  2IU9 A;  2TDT A;  3I3A A;  1YP4 A;  4J18 A;  3OUP A;  1KGQ A;  2WLE A;  4KQL A;  3R3R A;  4K6R A;  1HM9 A;  1QRF A;  1V67 A;  1YP3 A;  3OH0 A;  3PMO A;  2WLF A;  2RIJ A;  5AFU V;  3VBL A;  4G3P A;  1TDT A;  1V3W A;  3VNP A;  3EH0 A;  1KHR A;  4M9C A;  4M28 A;  3OH4 A;  3D98 A;  1KGT A;  4E6T A;  1XAT A;  3VBN A;  3GOS A;  1L0S A;  3T57 A;  3GQA A;  4EAB A;  3R5A A;  3R5C A;  3F1X A;  4E6U A;  3PRU A;  2OEF A;  3R0S A;  3FSC A;  1M8N A;  4M2B A;  5DEM A;  2L06 A;  3TK8 A;  4EA8 A;  1QQ0 A;  4N69 A;  5ADX U;  3OSJ A;  1Z90 A;  3JQY A;  1KK4 A;  3P1B A;  4G3S A;  4R37 A;  3EG4 A;  4H7O A;  3OU9 A;  3Q1X A;  3OH3 A;  3IXC A;  3R5D A;  4HUS A;  1MR9 A;  3TWD A;  3TDT A;  4G3Q A;  3FSX A;  1SSM A;  2NPO A;  2OI5 A;  2Q4J A;  3GQ7 A;  3MQH A;  3EEV A;  2VD4 A;  3DHO A;  1EWW A;  4G87 A;  1QRE A;  3VBP A;  1KRU A;  2V0L A;  2WLG A;  5E3Q A;  1FXJ A;  4DCL A;  3R2W A;  3GQ9 A;  5L6V A;  5DG3 A;  1J2Z A;  2QIA A;  1KRV A;  4MFG A;  4EA7 A;  5U2K A;  2IC7 A;  3VBI A;  3OH1 A;  3SPT A;  3R1W A;  2ICY A;  2I5K A;  1HV9 A;  3NPH B;  1HM0 A;  1MRL A;  1N4I A;  4KPZ A;  5F42 A;  4E79 A;  1HM8 A;  2V0I A;  2KY4 A;  3FS8 A;  4ISX A;  3BSY A;  4HZD A;  2IUA A;  3FOQ A;  3MQG A;  3KWC A;  4IHH A;  4R7P A;  3ST8 A;  4E1K A;  2QIV X;  4E75 A;  3HJJ A;  1YP2 A;  1MR7 A;  1Z2F A;  3TIS A;  2JF3 A;  4M99 A;  3OGZ A;  2L3W A;  3FSB A;  1QRM A;  1G97 A;  1THJ A;  3VBJ A;  2WLD A;  2FKO A;  4HUR A;  4MYO A;  3KWE A;  3HSQ A;  3MC4 A;  2GGQ A;  4M98 A;  4KNX A;  5AFU U;  4EGG A;  2JF2 A;  4FCE A;  3TV0 A;  3D8V A;  3FTT A;  3BRK X;  3TIO A;  1KK5 A;  4EQY A;  4M2A A;  4N27 A;  3NZ2 A;  3VBM A;  2OI6 A;  4KPX A;  2P2O A;  4AAW A;  4EAA A;  2IU8 A;  4J09 A;  1LXA A;  3BFP A;  2OEG A;  1S80 A;  3BSS A;  3FWW A;  3OTZ A;  3SRT A;  3R5B A;  3V4E A;  5E3R A;  5L6S A;  2VHE A;  5ADX V;  2ICX A;  3R3I A;  3SUC A;  4HCQ A;  1KK6 A;  3GVD A;  3OTM A;  1OCX A;  2GGO A;  3VBK A;  5DEP A;  2WLC A;  4IHG A;  2AQ9 A;  2V0H A;  2W0V A;  4IHF A;  3I3X A;  1T3D A;  3FSY A;  3C8V A;  5E3P A;  1SST A;  1QRL A;  3DJ4 A;  2V0J A;  3GUE A;  1XHD A;  3KWD A;  1SSQ A;  3BXY A;  3IGJ A;  3DK5 A;  4KNR A;  4MZU A;  4HZC A;  2W0W A;  2OI7 A;  1FWY A;  1G95 A;  3P47 A;  4AA7 A;  3ECT A;  4EA9 A;  4R36 A;  3OH2 A;  2V0K A;  2QKX A;  3GQ8 A;  4AC3 A; 
#chains in the Genus database with same CATH homology
 3R8Y A;  2XAT A;  1QRG A;  3BSW A;  3CJ8 A;  1KRR A;  3OHW A;  4N6A A;  2L8V A;  3OW5 A;  4N6B A;  1KQA A;  2IU9 A;  2TDT A;  3I3A A;  1YP4 A;  4J18 A;  3OUP A;  1KGQ A;  2WLE A;  4KQL A;  3R3R A;  4K6R A;  1HM9 A;  1QRF A;  1V67 A;  1YP3 A;  3VBI A;  3PMO A;  2WLF A;  2RIJ A;  5AFU V;  3VBL A;  4G3P A;  1TDT A;  1V3W A;  3VNP A;  3EH0 A;  1KHR A;  4M9C A;  4M28 A;  3D98 A;  1KGT A;  4E6T A;  1XAT A;  3VBN A;  3GOS A;  3T57 A;  4EAB A;  3R5A A;  3R5C A;  3F1X A;  4E6U A;  3PRU A;  2OEF A;  3R0S A;  3FSC A;  4M2B A;  5DEM A;  3TK8 A;  2L06 A;  4EA8 A;  1QQ0 A;  4N69 A;  5ADX U;  3OSJ A;  1Z90 A;  3JQY A;  1KK4 A;  3P1B A;  4G3S A;  4R37 A;  3EG4 A;  4H7O A;  3OU9 A;  3Q1X A;  3IXC A;  3R5D A;  4HUS A;  1MR9 A;  3TWD A;  3TDT A;  4G3Q A;  3FSX A;  1SSM A;  2NPO A;  2OI5 A;  2Q4J A;  3MQH A;  3EEV A;  2VD4 A;  3DHO A;  4G87 A;  1QRE A;  3VBP A;  1KRU A;  2V0L A;  2WLG A;  5E3Q A;  1FXJ A;  4DCL A;  3R2W A;  5L6V A;  5DG3 A;  1J2Z A;  2QIA A;  1KRV A;  4MFG A;  4EA7 A;  5U2K A;  2IC7 A;  3SPT A;  3R1W A;  2ICY A;  2I5K A;  1HV9 A;  3NPH B;  1HM0 A;  1MRL A;  4KPZ A;  5F42 A;  4E79 A;  1HM8 A;  2V0I A;  2KY4 A;  3FS8 A;  4ISX A;  3BSY A;  4HZD A;  2IUA A;  3FOQ A;  3MQG A;  3KWC A;  4IHH A;  4R7P A;  3ST8 A;  4E1K A;  2QIV X;  4E75 A;  3HJJ A;  1YP2 A;  1MR7 A;  3TIS A;  2JF3 A;  4M99 A;  2L3W A;  3FSB A;  1QRM A;  1G97 A;  1THJ A;  3VBJ A;  2WLD A;  2FKO A;  4HUR A;  4MYO A;  3KWE A;  3HSQ A;  3MC4 A;  2GGQ A;  4M98 A;  4KNX A;  5AFU U;  4EGG A;  2JF2 A;  4FCE A;  3TV0 A;  3D8V A;  3FTT A;  3BRK X;  3TIO A;  1KK5 A;  4EQY A;  4M2A A;  4N27 A;  3NZ2 A;  3VBM A;  2OI6 A;  4KPX A;  2P2O A;  4AAW A;  4EAA A;  2IU8 A;  4J09 A;  1LXA A;  3BFP A;  2OEG A;  1S80 A;  3BSS A;  3FWW A;  3OTZ A;  3SRT A;  3R5B A;  3V4E A;  5E3R A;  5L6S A;  2VHE A;  5ADX V;  2ICX A;  3R3I A;  4HCQ A;  1KK6 A;  3GVD A;  3OTM A;  1OCX A;  2GGO A;  3VBK A;  5DEP A;  2WLC A;  4IHG A;  2AQ9 A;  2V0H A;  2W0V A;  4IHF A;  3I3X A;  1T3D A;  3FSY A;  3C8V A;  5E3P A;  1SST A;  1QRL A;  3DJ4 A;  2V0J A;  3GUE A;  1XHD A;  3KWD A;  1SSQ A;  3BXY A;  3IGJ A;  3DK5 A;  4KNR A;  4MZU A;  4HZC A;  2W0W A;  2OI7 A;  1FWY A;  1G95 A;  3P47 A;  4AA7 A;  3ECT A;  4EA9 A;  4R36 A;  2V0K A;  2QKX A;  4AC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...