3P1BA

Crystal structure of the native serine acetyltransferase 1 from entamoeba histolytica
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
266
Chain Sequence
AMDNYIYSIAHQLYEMYLQDEDAFHSKRDYPHKKVFTELQKLRKIFFPDFFMKHQKITESHIASELTKLVDYIKDSVTAYNDELFAHQCVMAILEKLPSIKRTLKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine acetyltransferase
publication title Structural and biochemical studies of serine acetyltransferase reveal why the parasite Entamoeba histolytica cannot form a cysteine synthase complex
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 102
structure length 266
sequence length 269
ec nomenclature ec 2.3.1.30: Serine O-acetyltransferase.
pdb deposition date 2010-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.10 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3p1bA01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3p1bA02
2W0VA 3C8VA 4G3SA 3VBMA 3D8VA 3BRKX 1QRFA 3OUPA 4KNRA 2V0KA 3BSSA 5DEMA 4FCEA 4EQYA 4M2BA 2GGQA 4N69A 1FXJA 3TDTA 5U2KA 2IUAA 3VBNA 2IC7A 4M2AA 3VBJA 2Q4JA 3BSYA 3ST8A 2WLFA 3OU9A 3TIOA 3PMOA 4MYOA 1Z90A 3D98A 3I3XA 3GOSA 1THJA 2QIAA 4MFGA 3BFPA 3VNPA 4HZCA 4M98A 1HM8A 3FSYA 4G3QA 4KQLA 4R7PA 3NZ2A 2IU8A 4R37A 3Q1XA 3FWWA 4IHHA 3CJ8A 1G95A 4M99A 3EH0A 3TWDA 4N27A 1G97A 3R5BA 3IXCA 3VBPA 1FWYA 1MRLA 3R5AA 4EA7A 5AFUV 1XATA 1LXAA 5DEPA 3HSQA 4EA9A 3KWCA 3F1XA 5L6VA 3OW5A 3R1WA 1YP4A 2RIJA 4MZUA 1QQ0A 2IU9A 4E6TA 3FSCA 3MQGA 1QRLA 4HURA 1KK4A 3V4EA 4IHFA 2ICYA 2OEFA 4ISXA 4HCQA 3FOQA 5ADXV 1KK5A 5E3QA 5F42A 3R2WA 1KRRA 3R8YA 3TISA 2OI7A 2V0LA 1HM9A 3R3IA 1S80A 1KRVA 4J09A 3I3AA 3T57A 4E6UA 1YP2A 1V3WA 2JF3A 2XATA 3DJ4A 4KPZA 4EA8A 4H7OA 3R5CA 1J2ZA 2WLGA 1KRUA 3MC4A 2QIVX 3BSWA 3P1BA 3BXYA 3FS8A 3SRTA 3FTTA 1T3DA 4KNXA 4DCLA 1MR9A 2V0HA 4EABA 2WLEA 2VHEA 1KQAA 2OEGA 4G3PA 3TV0A 2NPOA 4KPXA 4K6RA 3DK5A 1TDTA 3ECTA 4HZDA 5E3PA 4E1KA 3OTZA 3SPTA 2GGOA 1SSMA 2JF2A 3JQYA 3GVDA 1QREA 5AFUU 4M28A 3R3RA 2VD4A 3DHOA 1SSQA 4M9CA 4HUSA 1OCXA 1SSTA 3GUEA 1QRGA 2WLCA 1YP3A 1MR7A 4G87A 4IHGA 2OI5A 2W0WA 3TK8A 1KGTA 4E79A 2P2OA 4E75A 1QRMA 3VBIA 3VBKA 3OTMA 4AC3A 5ADXU 2AQ9A 4J18A 1XHDA 2QKXA 3KWDA 3FSXA 3EG4A 3IGJA 3MQHA 5E3RA 3KWEA 4EAAA 4EGGA 3P47A 1KGQA 2FKOA 2I5KA 2V0IA 4N6BA 2TDTA 2WLDA 3R0SA 5L6SA 4R36A 3HJJA 3FSBA 2ICXA 5DG3A 1HM0A 1V67A 4AAWA 4AA7A 3EEVA 1KK6A 3R5DA 3VBLA 2OI6A 2V0JA 1HV9A 4N6AA 1KHRA
chains in the Genus database with same CATH superfamily
2W0VA 3C8VA 4G3SA 3VBMA 3OH3A 3OSJA 3D8VA 3BRKX 1QRFA 3OUPA 4KNRA 2V0KA 3BSSA 5DEMA 3GQAA 3GQ9A 4FCEA 4EQYA 4M2BA 2GGQA 4N69A 1FXJA 3TDTA 5U2KA 2IUAA 3VBNA 2IC7A 4M2AA 3VBJA 2Q4JA 3BSYA 3ST8A 2WLFA 3OU9A 3OH0A 3TIOA 3PMOA 4MYOA 1Z90A 3D98A 3I3XA 3GOSA 1THJA 2QIAA 4MFGA 3BFPA 3VNPA 4HZCA 4M98A 1HM8A 3FSYA 4G3QA 4KQLA 4R7PA 3NZ2A 2L8VA 2IU8A 4R37A 3Q1XA 3FWWA 2KY4A 4IHHA 3CJ8A 1G95A 4M99A 3EH0A 3TWDA 4N27A 1G97A 3R5BA 3IXCA 3OH1A 1FWYA 1MRLA 3R5AA 3VBPA 5AFUV 4EA7A 1XATA 1LXAA 5DEPA 3HSQA 4EA9A 3KWCA 3OGZA 3F1XA 5L6VA 3OW5A 3R1WA 1YP4A 2RIJA 4MZUA 1QQ0A 2IU9A 4E6TA 3FSCA 3MQGA 1QRLA 4HURA 1KK4A 3V4EA 4IHFA 2ICYA 2OEFA 4ISXA 4HCQA 3FOQA 5ADXV 1KK5A 5E3QA 5F42A 3R2WA 1KRRA 3R8YA 3TISA 2OI7A 2V0LA 1HM9A 3R3IA 1S80A 1KRVA 4J09A 3I3AA 3T57A 4E6UA 1YP2A 1V3WA 2JF3A 2XATA 3DJ4A 4KPZA 4EA8A 4H7OA 3R5CA 1J2ZA 2WLGA 1L0SA 1KRUA 3MC4A 2QIVX 3BSWA 3P1BA 3BXYA 3FS8A 3SRTA 3FTTA 1T3DA 4KNXA 4DCLA 3OH2A 1MR9A 2V0HA 4EABA 2WLEA 2VHEA 1KQAA 2OEGA 1N4IA 4G3PA 3TV0A 2NPOA 4KPXA 4K6RA 3NPHB 3DK5A 1TDTA 3ECTA 4HZDA 5E3PA 4E1KA 3OTZA 3SPTA 2GGOA 1M8NA 1SSMA 2JF2A 3JQYA 3GVDA 1QREA 5AFUU 3PRUA 4M28A 3GQ7A 3R3RA 2VD4A 1Z2FA 3DHOA 1SSQA 4M9CA 4HUSA 1OCXA 1SSTA 3GUEA 1QRGA 2WLCA 1YP3A 1MR7A 4G87A 4IHGA 2L06A 2OI5A 2W0WA 3TK8A 1KGTA 4E79A 2P2OA 4E75A 1QRMA 3VBIA 3OH4A 3SUCA 2L3WA 3VBKA 3OTMA 4AC3A 5ADXU 2AQ9A 4J18A 1XHDA 2QKXA 3KWDA 3FSXA 3EG4A 3IGJA 1EWWA 3MQHA 5E3RA 3KWEA 4EAAA 4EGGA 3P47A 1KGQA 2FKOA 2I5KA 2V0IA 4N6BA 2TDTA 2WLDA 3R0SA 5L6SA 4R36A 3HJJA 3FSBA 2ICXA 5DG3A 3OHWA 1HM0A 1V67A 4AAWA 4AA7A 3EEVA 1KK6A 3R5DA 3VBLA 2OI6A 2V0JA 1HV9A 4N6AA 3GQ8A 1KHRA
chains in the Genus database with same CATH topology
2W0VA 3C8VA 4G3SA 3VBMA 3OSJA 3D8VA 3BRKX 1QRFA 3OUPA 4KNRA 2V0KA 3BSSA 5DEMA 4FCEA 4EQYA 4M2BA 2GGQA 4N69A 1FXJA 3TDTA 5U2KA 2IUAA 3VBNA 2IC7A 4M2AA 3VBJA 2Q4JA 3BSYA 3ST8A 2WLFA 3OU9A 3TIOA 3PMOA 4MYOA 1Z90A 3D98A 3I3XA 3GOSA 1THJA 2QIAA 4MFGA 3BFPA 3VNPA 4HZCA 4M98A 1HM8A 3FSYA 4G3QA 4KQLA 4R7PA 3NZ2A 2L8VA 2IU8A 4R37A 3Q1XA 3FWWA 2KY4A 4IHHA 3CJ8A 1G95A 4M99A 3EH0A 3TWDA 4N27A 1G97A 3R5BA 3IXCA 3VBPA 1FWYA 1MRLA 3R5AA 4EA7A 5AFUV 1XATA 1LXAA 5DEPA 3HSQA 4EA9A 3KWCA 3F1XA 5L6VA 3OW5A 3R1WA 1YP4A 2RIJA 4MZUA 1QQ0A 2IU9A 4E6TA 3FSCA 3MQGA 1QRLA 4HURA 1KK4A 3V4EA 4IHFA 2ICYA 2OEFA 4ISXA 4HCQA 3FOQA 5ADXV 1KK5A 5E3QA 5F42A 3R2WA 1KRRA 3R8YA 3TISA 2OI7A 2V0LA 1HM9A 3R3IA 1S80A 1KRVA 4J09A 3I3AA 3T57A 4E6UA 1YP2A 1V3WA 2JF3A 2XATA 3DJ4A 4KPZA 4EA8A 4H7OA 3R5CA 1J2ZA 2WLGA 1KRUA 3MC4A 2QIVX 3BSWA 3P1BA 3BXYA 3FS8A 3SRTA 3FTTA 1T3DA 4KNXA 4DCLA 1MR9A 2V0HA 4EABA 2WLEA 2VHEA 1KQAA 2OEGA 4G3PA 3TV0A 2NPOA 4KPXA 4K6RA 3NPHB 3DK5A 1TDTA 3ECTA 4HZDA 5E3PA 4E1KA 3OTZA 3SPTA 2GGOA 1SSMA 2JF2A 3JQYA 3GVDA 1QREA 5AFUU 3PRUA 4M28A 3R3RA 2VD4A 3DHOA 1SSQA 4M9CA 4HUSA 1OCXA 1SSTA 3GUEA 1QRGA 2WLCA 1YP3A 1MR7A 4G87A 4IHGA 2L06A 2OI5A 2W0WA 3TK8A 1KGTA 4E79A 2P2OA 4E75A 1QRMA 3VBIA 2L3WA 3VBKA 3OTMA 4AC3A 5ADXU 2AQ9A 4J18A 1XHDA 2QKXA 3KWDA 3FSXA 3EG4A 3IGJA 3MQHA 5E3RA 3KWEA 4EAAA 4EGGA 3P47A 1KGQA 2FKOA 2I5KA 2V0IA 4N6BA 2TDTA 2WLDA 3R0SA 5L6SA 4R36A 3HJJA 3FSBA 2ICXA 5DG3A 3OHWA 1HM0A 1V67A 4AAWA 4AA7A 3EEVA 1KK6A 3R5DA 3VBLA 2OI6A 2V0JA 1HV9A 4N6AA 1KHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0V A;  3C8V A;  4G3S A;  3VBM A;  3D8V A;  3BRK X;  1QRF A;  3OUP A;  4KNR A;  2V0K A;  3BSS A;  5DEM A;  4FCE A;  4EQY A;  4M2B A;  2GGQ A;  4N69 A;  1FXJ A;  3TDT A;  5U2K A;  2IUA A;  3VBN A;  2IC7 A;  4M2A A;  3VBJ A;  2Q4J A;  3BSY A;  3ST8 A;  2WLF A;  3OU9 A;  3TIO A;  3PMO A;  4MYO A;  1Z90 A;  3D98 A;  3I3X A;  3GOS A;  1THJ A;  2QIA A;  4MFG A;  3BFP A;  3VNP A;  4HZC A;  4M98 A;  1HM8 A;  3FSY A;  4G3Q A;  4KQL A;  4R7P A;  3NZ2 A;  2IU8 A;  4R37 A;  3Q1X A;  3FWW A;  4IHH A;  3CJ8 A;  1G95 A;  4M99 A;  3EH0 A;  3TWD A;  4N27 A;  1G97 A;  3R5B A;  3IXC A;  3VBP A;  1FWY A;  1MRL A;  3R5A A;  4EA7 A;  5AFU V;  1XAT A;  1LXA A;  5DEP A;  3HSQ A;  4EA9 A;  3KWC A;  3F1X A;  5L6V A;  3OW5 A;  3R1W A;  1YP4 A;  2RIJ A;  4MZU A;  1QQ0 A;  2IU9 A;  4E6T A;  3FSC A;  3MQG A;  1QRL A;  4HUR A;  1KK4 A;  3V4E A;  4IHF A;  2ICY A;  2OEF A;  4ISX A;  4HCQ A;  3FOQ A;  5ADX V;  1KK5 A;  5E3Q A;  5F42 A;  3R2W A;  1KRR A;  3R8Y A;  3TIS A;  2OI7 A;  2V0L A;  1HM9 A;  3R3I A;  1S80 A;  1KRV A;  4J09 A;  3I3A A;  3T57 A;  4E6U A;  1YP2 A;  1V3W A;  2JF3 A;  2XAT A;  3DJ4 A;  4KPZ A;  4EA8 A;  4H7O A;  3R5C A;  1J2Z A;  2WLG A;  1KRU A;  3MC4 A;  2QIV X;  3BSW A;  3P1B A;  3BXY A;  3FS8 A;  3SRT A;  3FTT A;  1T3D A;  4KNX A;  4DCL A;  1MR9 A;  2V0H A;  4EAB A;  2WLE A;  2VHE A;  1KQA A;  2OEG A;  4G3P A;  3TV0 A;  2NPO A;  4KPX A;  4K6R A;  3DK5 A;  1TDT A;  3ECT A;  4HZD A;  5E3P A;  4E1K A;  3OTZ A;  3SPT A;  2GGO A;  1SSM A;  2JF2 A;  3JQY A;  3GVD A;  1QRE A;  5AFU U;  4M28 A;  3R3R A;  2VD4 A;  3DHO A;  1SSQ A;  4M9C A;  4HUS A;  1OCX A;  1SST A;  3GUE A;  1QRG A;  2WLC A;  1YP3 A;  1MR7 A;  4G87 A;  4IHG A;  2OI5 A;  2W0W A;  3TK8 A;  1KGT A;  4E79 A;  2P2O A;  4E75 A;  1QRM A;  3VBI A;  3VBK A;  3OTM A;  4AC3 A;  5ADX U;  2AQ9 A;  4J18 A;  1XHD A;  2QKX A;  3KWD A;  3FSX A;  3EG4 A;  3IGJ A;  3MQH A;  5E3R A;  3KWE A;  4EAA A;  4EGG A;  3P47 A;  1KGQ A;  2FKO A;  2I5K A;  2V0I A;  4N6B A;  2TDT A;  2WLD A;  3R0S A;  5L6S A;  4R36 A;  3HJJ A;  3FSB A;  2ICX A;  5DG3 A;  1HM0 A;  1V67 A;  4AAW A;  4AA7 A;  3EEV A;  1KK6 A;  3R5D A;  3VBL A;  2OI6 A;  2V0J A;  1HV9 A;  4N6A A;  1KHR A; 
#chains in the Genus database with same CATH topology
 2W0V A;  3C8V A;  4G3S A;  3VBM A;  3OH3 A;  3OSJ A;  3D8V A;  3BRK X;  1QRF A;  3OUP A;  4KNR A;  2V0K A;  3BSS A;  5DEM A;  3GQA A;  3GQ9 A;  4FCE A;  4EQY A;  4M2B A;  2GGQ A;  4N69 A;  1FXJ A;  3TDT A;  5U2K A;  2IUA A;  3VBN A;  2IC7 A;  4M2A A;  3VBJ A;  2Q4J A;  3BSY A;  3ST8 A;  2WLF A;  3OU9 A;  3OH0 A;  3TIO A;  3PMO A;  4MYO A;  1Z90 A;  3D98 A;  3I3X A;  3GOS A;  1THJ A;  2QIA A;  4MFG A;  3BFP A;  3VNP A;  4HZC A;  4M98 A;  1HM8 A;  3FSY A;  4G3Q A;  4KQL A;  4R7P A;  3NZ2 A;  2L8V A;  2IU8 A;  4R37 A;  3Q1X A;  3FWW A;  2KY4 A;  4IHH A;  3CJ8 A;  1G95 A;  4M99 A;  3EH0 A;  3TWD A;  4N27 A;  1G97 A;  3R5B A;  3IXC A;  3OH1 A;  1FWY A;  1MRL A;  3R5A A;  3VBP A;  5AFU V;  4EA7 A;  1XAT A;  1LXA A;  5DEP A;  3HSQ A;  4EA9 A;  3KWC A;  3OGZ A;  3F1X A;  5L6V A;  3OW5 A;  3R1W A;  1YP4 A;  2RIJ A;  4MZU A;  1QQ0 A;  2IU9 A;  4E6T A;  3FSC A;  3MQG A;  1QRL A;  4HUR A;  1KK4 A;  3V4E A;  4IHF A;  2ICY A;  2OEF A;  4ISX A;  4HCQ A;  3FOQ A;  5ADX V;  1KK5 A;  5E3Q A;  5F42 A;  3R2W A;  1KRR A;  3R8Y A;  3TIS A;  2OI7 A;  2V0L A;  1HM9 A;  3R3I A;  1S80 A;  1KRV A;  4J09 A;  3I3A A;  3T57 A;  4E6U A;  1YP2 A;  1V3W A;  2JF3 A;  2XAT A;  3DJ4 A;  4KPZ A;  4EA8 A;  4H7O A;  3R5C A;  1J2Z A;  2WLG A;  1L0S A;  1KRU A;  3MC4 A;  2QIV X;  3BSW A;  3P1B A;  3BXY A;  3FS8 A;  3SRT A;  3FTT A;  1T3D A;  4KNX A;  4DCL A;  3OH2 A;  1MR9 A;  2V0H A;  4EAB A;  2WLE A;  2VHE A;  1KQA A;  2OEG A;  1N4I A;  4G3P A;  3TV0 A;  2NPO A;  4KPX A;  4K6R A;  3NPH B;  3DK5 A;  1TDT A;  3ECT A;  4HZD A;  5E3P A;  4E1K A;  3OTZ A;  3SPT A;  2GGO A;  1M8N A;  1SSM A;  2JF2 A;  3JQY A;  3GVD A;  1QRE A;  5AFU U;  3PRU A;  4M28 A;  3GQ7 A;  3R3R A;  2VD4 A;  1Z2F A;  3DHO A;  1SSQ A;  4M9C A;  4HUS A;  1OCX A;  1SST A;  3GUE A;  1QRG A;  2WLC A;  1YP3 A;  1MR7 A;  4G87 A;  4IHG A;  2L06 A;  2OI5 A;  2W0W A;  3TK8 A;  1KGT A;  4E79 A;  2P2O A;  4E75 A;  1QRM A;  3VBI A;  3OH4 A;  3SUC A;  2L3W A;  3VBK A;  3OTM A;  4AC3 A;  5ADX U;  2AQ9 A;  4J18 A;  1XHD A;  2QKX A;  3KWD A;  3FSX A;  3EG4 A;  3IGJ A;  1EWW A;  3MQH A;  5E3R A;  3KWE A;  4EAA A;  4EGG A;  3P47 A;  1KGQ A;  2FKO A;  2I5K A;  2V0I A;  4N6B A;  2TDT A;  2WLD A;  3R0S A;  5L6S A;  4R36 A;  3HJJ A;  3FSB A;  2ICX A;  5DG3 A;  3OHW A;  1HM0 A;  1V67 A;  4AAW A;  4AA7 A;  3EEV A;  1KK6 A;  3R5D A;  3VBL A;  2OI6 A;  2V0J A;  1HV9 A;  4N6A A;  3GQ8 A;  1KHR A; 
#chains in the Genus database with same CATH homology
 2W0V A;  3C8V A;  4G3S A;  3VBM A;  3OSJ A;  3D8V A;  3BRK X;  1QRF A;  3OUP A;  4KNR A;  2V0K A;  3BSS A;  5DEM A;  4FCE A;  4EQY A;  4M2B A;  2GGQ A;  4N69 A;  1FXJ A;  3TDT A;  5U2K A;  2IUA A;  3VBN A;  2IC7 A;  4M2A A;  3VBJ A;  2Q4J A;  3BSY A;  3ST8 A;  2WLF A;  3OU9 A;  3TIO A;  3PMO A;  4MYO A;  1Z90 A;  3D98 A;  3I3X A;  3GOS A;  1THJ A;  2QIA A;  4MFG A;  3BFP A;  3VNP A;  4HZC A;  4M98 A;  1HM8 A;  3FSY A;  4G3Q A;  4KQL A;  4R7P A;  3NZ2 A;  2L8V A;  2IU8 A;  4R37 A;  3Q1X A;  3FWW A;  2KY4 A;  4IHH A;  3CJ8 A;  1G95 A;  4M99 A;  3EH0 A;  3TWD A;  4N27 A;  1G97 A;  3R5B A;  3IXC A;  3VBP A;  1FWY A;  1MRL A;  3R5A A;  4EA7 A;  5AFU V;  1XAT A;  1LXA A;  5DEP A;  3HSQ A;  4EA9 A;  3KWC A;  3F1X A;  5L6V A;  3OW5 A;  3R1W A;  1YP4 A;  2RIJ A;  4MZU A;  1QQ0 A;  2IU9 A;  4E6T A;  3FSC A;  3MQG A;  1QRL A;  4HUR A;  1KK4 A;  3V4E A;  4IHF A;  2ICY A;  2OEF A;  4ISX A;  4HCQ A;  3FOQ A;  5ADX V;  1KK5 A;  5E3Q A;  5F42 A;  3R2W A;  1KRR A;  3R8Y A;  3TIS A;  2OI7 A;  2V0L A;  1HM9 A;  3R3I A;  1S80 A;  1KRV A;  4J09 A;  3I3A A;  3T57 A;  4E6U A;  1YP2 A;  1V3W A;  2JF3 A;  2XAT A;  3DJ4 A;  4KPZ A;  4EA8 A;  4H7O A;  3R5C A;  1J2Z A;  2WLG A;  1KRU A;  3MC4 A;  2QIV X;  3BSW A;  3P1B A;  3BXY A;  3FS8 A;  3SRT A;  3FTT A;  1T3D A;  4KNX A;  4DCL A;  1MR9 A;  2V0H A;  4EAB A;  2WLE A;  2VHE A;  1KQA A;  2OEG A;  4G3P A;  3TV0 A;  2NPO A;  4KPX A;  4K6R A;  3NPH B;  3DK5 A;  1TDT A;  3ECT A;  4HZD A;  5E3P A;  4E1K A;  3OTZ A;  3SPT A;  2GGO A;  1SSM A;  2JF2 A;  3JQY A;  3GVD A;  1QRE A;  5AFU U;  3PRU A;  4M28 A;  3R3R A;  2VD4 A;  3DHO A;  1SSQ A;  4M9C A;  4HUS A;  1OCX A;  1SST A;  3GUE A;  1QRG A;  2WLC A;  1YP3 A;  1MR7 A;  4G87 A;  4IHG A;  2L06 A;  2OI5 A;  2W0W A;  3TK8 A;  1KGT A;  4E79 A;  2P2O A;  4E75 A;  1QRM A;  3VBI A;  2L3W A;  3VBK A;  3OTM A;  4AC3 A;  5ADX U;  2AQ9 A;  4J18 A;  1XHD A;  2QKX A;  3KWD A;  3FSX A;  3EG4 A;  3IGJ A;  3MQH A;  5E3R A;  3KWE A;  4EAA A;  4EGG A;  3P47 A;  1KGQ A;  2FKO A;  2I5K A;  2V0I A;  4N6B A;  2TDT A;  2WLD A;  3R0S A;  5L6S A;  4R36 A;  3HJJ A;  3FSB A;  2ICX A;  5DG3 A;  3OHW A;  1HM0 A;  1V67 A;  4AAW A;  4AA7 A;  3EEV A;  1KK6 A;  3R5D A;  3VBL A;  2OI6 A;  2V0J A;  1HV9 A;  4N6A A;  1KHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...