3Q1XA

Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
267
structure length
267
Chain Sequence
b'MDNYIYSIAHQLYEMYLQDEDAFHSKRDYPHKKVFTELQKLRKIFFPDFFMKHQKITESHIASELTKLVDYIKDSVTAYNDELFAHQCVMAILEKLPSIKRTLKTDLIAAYAGDPAAPGLSLIIRCYPGFQAVIVYRIAHVLYECGERYYCREMMESVHSYTSIDIHPGASIKGHFFIDHGVGVVIGETAIIGEWCRIYQSVTLGAMHFQEEGGVIKRGTKRHPTVGDYVTIGTGAKVLGNIIVGSHVRIGANCWIDRDVDSNQTVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine acetyltransferase
publication title Structural and biochemical studies of serine acetyltransferase reveal why the parasite Entamoeba histolytica cannot form cysteine synthase complex
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Transferase
total genus 103
structure length 267
sequence length 267
ec nomenclature ec 2.3.1.30: Serine O-acetyltransferase.
pdb deposition date 2010-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.10 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3q1xA01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3q1xA02
3OTZA 3R2WA 4E1KA 2W0VA 1LXAA 3TV0A 3R5AA 2OI7A 1T3DA 2VHEA 3BRKX 3FTTA 3MQHA 2WLFA 3SRTA 3EH0A 3IXCA 4ISXA 1QQ0A 5DEPA 3R5BA 1QRGA 2P2OA 2OI5A 3TIOA 3DHOA 1MR9A 3BSYA 3R3RA 2IUAA 3FS8A 4N27A 3IGJA 4EABA 3VBIA 3BSSA 4J09A 3KWEA 1KK6A 1YP2A 1KRRA 2OI6A 2V0LA 1S80A 4EA9A 4KPZA 3R5DA 2IU9A 4EAAA 2RIJA 4H7OA 4KPXA 2NPOA 1Z90A 2FKOA 1XATA 3VBJA 3VBKA 3TWDA 4R36A 3FSCA 2AQ9A 4N6AA 3TISA 1KRUA 1YP4A 3Q1XA 1QREA 3TK8A 1G95A 5L6SA 4AAWA 2I5KA 4J18A 1MRLA 5DG3A 1FXJA 3FWWA 5L6VA 2QIAA 3I3XA 5ADXV 3GVDA 1QRLA 3BXYA 3I3AA 4KNRA 2GGQA 2JF3A 2WLEA 4HURA 2V0HA 1KK5A 3GOSA 4MZUA 1QRMA 3MC4A 2Q4JA 2WLDA 2ICYA 4E75A 1V3WA 4MYOA 4KQLA 4DCLA 4M28A 3GUEA 5AFUV 1HM9A 4FCEA 3F1XA 1SSTA 1G97A 1FWYA 1KRVA 2QIVX 1SSQA 3ECTA 3FSYA 3R5CA 5E3PA 3VBLA 1TDTA 4AC3A 3CJ8A 3OTMA 1XHDA 2QKXA 5ADXU 1OCXA 3VBPA 5F42A 3HJJA 3FSBA 3HSQA 4HZDA 4MFGA 4IHFA 4M98A 3VBMA 1HM0A 1V67A 4IHGA 4E6UA 4G87A 1KQAA 3NZ2A 3ST8A 4AA7A 3VBNA 4HUSA 5AFUU 3KWCA 2OEFA 4IHHA 3V4EA 4M2AA 4EA7A 1HM8A 3EG4A 3D8VA 3KWDA 3R3IA 2W0WA 3BFPA 2GGOA 2IU8A 4HZCA 2WLCA 4K6RA 4EGGA 2OEGA 3R1WA 3DK5A 4N69A 3FOQA 1KGQA 5E3QA 4M2BA 5U2KA 3MQGA 4M9CA 1SSMA 3VNPA 3DJ4A 1KK4A 3PMOA 3R0SA 1KHRA 3OUPA 2XATA 3BSWA 4R37A 4G3SA 2V0KA 4N6BA 4EA8A 3P47A 2V0IA 3JQYA 4EQYA 1MR7A 4M99A 3P1BA 2V0JA 2IC7A 4KNXA 2VD4A 4G3QA 4R7PA 5DEMA 1YP3A 1THJA 2ICXA 3SPTA 3C8VA 1KGTA 3T57A 4E6TA 2WLGA 3OW5A 1QRFA 3EEVA 5E3RA 3R8YA 4G3PA 2JF2A 1J2ZA 2TDTA 3OU9A 3TDTA 4E79A 1HV9A 3FSXA 4HCQA 3D98A
chains in the Genus database with same CATH superfamily
3OTZA 3R2WA 4E1KA 2W0VA 1LXAA 3TV0A 3R5AA 2OI7A 1T3DA 2L8VA 2VHEA 3BRKX 3FTTA 3MQHA 2WLFA 3SRTA 3EH0A 3IXCA 4ISXA 1QQ0A 5DEPA 3R5BA 1QRGA 2P2OA 2OI5A 3TIOA 3DHOA 1MR9A 3BSYA 3R3RA 2IUAA 3FS8A 4N27A 3IGJA 4EABA 3VBIA 3BSSA 4J09A 3KWEA 1N4IA 1KK6A 1YP2A 1KRRA 2OI6A 2V0LA 1S80A 4EA9A 4KPZA 3R5DA 2IU9A 4EAAA 2RIJA 4H7OA 3GQ9A 4KPXA 2NPOA 1Z90A 2FKOA 1XATA 3VBJA 3OH0A 3VBKA 3TWDA 4R36A 3FSCA 2AQ9A 4N6AA 3TISA 1KRUA 1YP4A 3GQ7A 3Q1XA 1QREA 3TK8A 1G95A 5L6SA 4AAWA 2I5KA 4J18A 1MRLA 5DG3A 1FXJA 3FWWA 1L0SA 5L6VA 2QIAA 3I3XA 5ADXV 3GVDA 1QRLA 3BXYA 3I3AA 4KNRA 2GGQA 2JF3A 2WLEA 4HURA 2V0HA 1KK5A 3GOSA 3NPHB 4MZUA 1QRMA 3MC4A 2Q4JA 2WLDA 2ICYA 4E75A 1V3WA 4MYOA 4KQLA 4DCLA 4M28A 3GUEA 5AFUV 1Z2FA 1HM9A 4FCEA 3OH2A 3F1XA 1SSTA 1G97A 1FWYA 1KRVA 2QIVX 1SSQA 3ECTA 2KY4A 3FSYA 3GQAA 3R5CA 5E3PA 1TDTA 3VBLA 4AC3A 3CJ8A 3OTMA 1XHDA 2QKXA 3OH4A 1OCXA 5ADXU 3VBPA 5F42A 3GQ8A 3FSBA 3HJJA 3HSQA 4HZDA 4MFGA 4IHFA 4M98A 3VBMA 1HM0A 1V67A 4IHGA 4E6UA 4G87A 1KQAA 3OSJA 3PRUA 2L3WA 3NZ2A 3ST8A 3VBNA 4AA7A 4HUSA 5AFUU 3KWCA 2OEFA 4IHHA 3V4EA 4M2AA 4EA7A 2L06A 1HM8A 3EG4A 3D8VA 3KWDA 3R3IA 2W0WA 3BFPA 1EWWA 2GGOA 3OGZA 3SUCA 2IU8A 4HZCA 2WLCA 4K6RA 4EGGA 2OEGA 3OH1A 3R1WA 3DK5A 4N69A 3FOQA 1KGQA 5E3QA 4M2BA 5U2KA 3MQGA 3OH3A 4M9CA 1SSMA 3VNPA 3DJ4A 3OHWA 1KK4A 3PMOA 3R0SA 1KHRA 3OUPA 2XATA 3BSWA 4R37A 4G3SA 2V0KA 4N6BA 4EA8A 3P47A 2V0IA 3JQYA 4EQYA 1MR7A 1M8NA 4M99A 3P1BA 2V0JA 2IC7A 4KNXA 2VD4A 4G3QA 4R7PA 5DEMA 1YP3A 1THJA 2ICXA 3SPTA 3C8VA 1KGTA 3T57A 4E6TA 2WLGA 3OW5A 1QRFA 3EEVA 5E3RA 3R8YA 4G3PA 2JF2A 1J2ZA 2TDTA 3OU9A 3TDTA 4E79A 1HV9A 3FSXA 4HCQA 3D98A
chains in the Genus database with same CATH topology
3OTZA 3R2WA 4E1KA 2W0VA 1LXAA 3TV0A 3R5AA 2OI7A 1T3DA 2L8VA 2VHEA 3BRKX 3FTTA 3MQHA 2WLFA 3SRTA 3EH0A 3IXCA 4ISXA 1QQ0A 5DEPA 3R5BA 1QRGA 2P2OA 2OI5A 3TIOA 3DHOA 1MR9A 3BSYA 3R3RA 2IUAA 3FS8A 4N27A 3IGJA 4EABA 3VBIA 3BSSA 4J09A 3KWEA 1KK6A 1YP2A 1KRRA 2OI6A 2V0LA 1S80A 4EA9A 4KPZA 3R5DA 2IU9A 4EAAA 2RIJA 4H7OA 4KPXA 2NPOA 1Z90A 2FKOA 1XATA 3VBJA 3VBKA 3TWDA 4R36A 3FSCA 2AQ9A 4N6AA 3TISA 1KRUA 1YP4A 3Q1XA 1QREA 3TK8A 1G95A 5L6SA 4AAWA 2I5KA 4J18A 1MRLA 5DG3A 1FXJA 3FWWA 5L6VA 2QIAA 3I3XA 5ADXV 3GVDA 1QRLA 3BXYA 3I3AA 4KNRA 2GGQA 2JF3A 2WLEA 4HURA 2V0HA 1KK5A 3GOSA 3NPHB 4MZUA 1QRMA 3MC4A 2Q4JA 2WLDA 2ICYA 4E75A 1V3WA 4MYOA 4KQLA 4DCLA 4M28A 3GUEA 5AFUV 1HM9A 4FCEA 3F1XA 1SSTA 1G97A 1FWYA 1KRVA 2QIVX 1SSQA 3ECTA 2KY4A 3FSYA 3R5CA 5E3PA 3VBLA 1TDTA 4AC3A 3CJ8A 3OTMA 1XHDA 2QKXA 5ADXU 1OCXA 3VBPA 5F42A 3HJJA 3FSBA 3HSQA 4HZDA 4MFGA 4IHFA 4M98A 3VBMA 1HM0A 1V67A 4IHGA 4E6UA 4G87A 1KQAA 3OSJA 3PRUA 2L3WA 3NZ2A 3ST8A 3VBNA 4AA7A 4HUSA 5AFUU 3KWCA 2OEFA 4IHHA 3V4EA 4M2AA 4EA7A 2L06A 1HM8A 3EG4A 3D8VA 3KWDA 3R3IA 2W0WA 3BFPA 2GGOA 2IU8A 4HZCA 2WLCA 4K6RA 4EGGA 2OEGA 3R1WA 3DK5A 4N69A 3FOQA 1KGQA 5E3QA 4M2BA 5U2KA 3MQGA 4M9CA 1SSMA 3VNPA 3DJ4A 3OHWA 1KK4A 3PMOA 3R0SA 1KHRA 3OUPA 2XATA 3BSWA 4R37A 4G3SA 2V0KA 4N6BA 4EA8A 3P47A 2V0IA 3JQYA 4EQYA 1MR7A 4M99A 3P1BA 2V0JA 2IC7A 4KNXA 2VD4A 4G3QA 4R7PA 5DEMA 1YP3A 1THJA 2ICXA 3SPTA 3C8VA 1KGTA 3T57A 4E6TA 2WLGA 3OW5A 1QRFA 3EEVA 5E3RA 3R8YA 4G3PA 2JF2A 1J2ZA 2TDTA 3OU9A 3TDTA 4E79A 1HV9A 3FSXA 4HCQA 3D98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTZ A;  3R2W A;  4E1K A;  2W0V A;  1LXA A;  3TV0 A;  3R5A A;  2OI7 A;  1T3D A;  2VHE A;  3BRK X;  3FTT A;  3MQH A;  2WLF A;  3SRT A;  3EH0 A;  3IXC A;  4ISX A;  1QQ0 A;  5DEP A;  3R5B A;  1QRG A;  2P2O A;  2OI5 A;  3TIO A;  3DHO A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  3FS8 A;  4N27 A;  3IGJ A;  4EAB A;  3VBI A;  3BSS A;  4J09 A;  3KWE A;  1KK6 A;  1YP2 A;  1KRR A;  2OI6 A;  2V0L A;  1S80 A;  4EA9 A;  4KPZ A;  3R5D A;  2IU9 A;  4EAA A;  2RIJ A;  4H7O A;  4KPX A;  2NPO A;  1Z90 A;  2FKO A;  1XAT A;  3VBJ A;  3VBK A;  3TWD A;  4R36 A;  3FSC A;  2AQ9 A;  4N6A A;  3TIS A;  1KRU A;  1YP4 A;  3Q1X A;  1QRE A;  3TK8 A;  1G95 A;  5L6S A;  4AAW A;  2I5K A;  4J18 A;  1MRL A;  5DG3 A;  1FXJ A;  3FWW A;  5L6V A;  2QIA A;  3I3X A;  5ADX V;  3GVD A;  1QRL A;  3BXY A;  3I3A A;  4KNR A;  2GGQ A;  2JF3 A;  2WLE A;  4HUR A;  2V0H A;  1KK5 A;  3GOS A;  4MZU A;  1QRM A;  3MC4 A;  2Q4J A;  2WLD A;  2ICY A;  4E75 A;  1V3W A;  4MYO A;  4KQL A;  4DCL A;  4M28 A;  3GUE A;  5AFU V;  1HM9 A;  4FCE A;  3F1X A;  1SST A;  1G97 A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  3ECT A;  3FSY A;  3R5C A;  5E3P A;  3VBL A;  1TDT A;  4AC3 A;  3CJ8 A;  3OTM A;  1XHD A;  2QKX A;  5ADX U;  1OCX A;  3VBP A;  5F42 A;  3HJJ A;  3FSB A;  3HSQ A;  4HZD A;  4MFG A;  4IHF A;  4M98 A;  3VBM A;  1HM0 A;  1V67 A;  4IHG A;  4E6U A;  4G87 A;  1KQA A;  3NZ2 A;  3ST8 A;  4AA7 A;  3VBN A;  4HUS A;  5AFU U;  3KWC A;  2OEF A;  4IHH A;  3V4E A;  4M2A A;  4EA7 A;  1HM8 A;  3EG4 A;  3D8V A;  3KWD A;  3R3I A;  2W0W A;  3BFP A;  2GGO A;  2IU8 A;  4HZC A;  2WLC A;  4K6R A;  4EGG A;  2OEG A;  3R1W A;  3DK5 A;  4N69 A;  3FOQ A;  1KGQ A;  5E3Q A;  4M2B A;  5U2K A;  3MQG A;  4M9C A;  1SSM A;  3VNP A;  3DJ4 A;  1KK4 A;  3PMO A;  3R0S A;  1KHR A;  3OUP A;  2XAT A;  3BSW A;  4R37 A;  4G3S A;  2V0K A;  4N6B A;  4EA8 A;  3P47 A;  2V0I A;  3JQY A;  4EQY A;  1MR7 A;  4M99 A;  3P1B A;  2V0J A;  2IC7 A;  4KNX A;  2VD4 A;  4G3Q A;  4R7P A;  5DEM A;  1YP3 A;  1THJ A;  2ICX A;  3SPT A;  3C8V A;  1KGT A;  3T57 A;  4E6T A;  2WLG A;  3OW5 A;  1QRF A;  3EEV A;  5E3R A;  3R8Y A;  4G3P A;  2JF2 A;  1J2Z A;  2TDT A;  3OU9 A;  3TDT A;  4E79 A;  1HV9 A;  3FSX A;  4HCQ A;  3D98 A; 
#chains in the Genus database with same CATH topology
 3OTZ A;  3R2W A;  4E1K A;  2W0V A;  1LXA A;  3TV0 A;  3R5A A;  2OI7 A;  1T3D A;  2L8V A;  2VHE A;  3BRK X;  3FTT A;  3MQH A;  2WLF A;  3SRT A;  3EH0 A;  3IXC A;  4ISX A;  1QQ0 A;  5DEP A;  3R5B A;  1QRG A;  2P2O A;  2OI5 A;  3TIO A;  3DHO A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  3FS8 A;  4N27 A;  3IGJ A;  4EAB A;  3VBI A;  3BSS A;  4J09 A;  3KWE A;  1N4I A;  1KK6 A;  1YP2 A;  1KRR A;  2OI6 A;  2V0L A;  1S80 A;  4EA9 A;  4KPZ A;  3R5D A;  2IU9 A;  4EAA A;  2RIJ A;  4H7O A;  3GQ9 A;  4KPX A;  2NPO A;  1Z90 A;  2FKO A;  1XAT A;  3VBJ A;  3OH0 A;  3VBK A;  3TWD A;  4R36 A;  3FSC A;  2AQ9 A;  4N6A A;  3TIS A;  1KRU A;  1YP4 A;  3GQ7 A;  3Q1X A;  1QRE A;  3TK8 A;  1G95 A;  5L6S A;  4AAW A;  2I5K A;  4J18 A;  1MRL A;  5DG3 A;  1FXJ A;  3FWW A;  1L0S A;  5L6V A;  2QIA A;  3I3X A;  5ADX V;  3GVD A;  1QRL A;  3BXY A;  3I3A A;  4KNR A;  2GGQ A;  2JF3 A;  2WLE A;  4HUR A;  2V0H A;  1KK5 A;  3GOS A;  3NPH B;  4MZU A;  1QRM A;  3MC4 A;  2Q4J A;  2WLD A;  2ICY A;  4E75 A;  1V3W A;  4MYO A;  4KQL A;  4DCL A;  4M28 A;  3GUE A;  5AFU V;  1Z2F A;  1HM9 A;  4FCE A;  3OH2 A;  3F1X A;  1SST A;  1G97 A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  3ECT A;  2KY4 A;  3FSY A;  3GQA A;  3R5C A;  5E3P A;  1TDT A;  3VBL A;  4AC3 A;  3CJ8 A;  3OTM A;  1XHD A;  2QKX A;  3OH4 A;  1OCX A;  5ADX U;  3VBP A;  5F42 A;  3GQ8 A;  3FSB A;  3HJJ A;  3HSQ A;  4HZD A;  4MFG A;  4IHF A;  4M98 A;  3VBM A;  1HM0 A;  1V67 A;  4IHG A;  4E6U A;  4G87 A;  1KQA A;  3OSJ A;  3PRU A;  2L3W A;  3NZ2 A;  3ST8 A;  3VBN A;  4AA7 A;  4HUS A;  5AFU U;  3KWC A;  2OEF A;  4IHH A;  3V4E A;  4M2A A;  4EA7 A;  2L06 A;  1HM8 A;  3EG4 A;  3D8V A;  3KWD A;  3R3I A;  2W0W A;  3BFP A;  1EWW A;  2GGO A;  3OGZ A;  3SUC A;  2IU8 A;  4HZC A;  2WLC A;  4K6R A;  4EGG A;  2OEG A;  3OH1 A;  3R1W A;  3DK5 A;  4N69 A;  3FOQ A;  1KGQ A;  5E3Q A;  4M2B A;  5U2K A;  3MQG A;  3OH3 A;  4M9C A;  1SSM A;  3VNP A;  3DJ4 A;  3OHW A;  1KK4 A;  3PMO A;  3R0S A;  1KHR A;  3OUP A;  2XAT A;  3BSW A;  4R37 A;  4G3S A;  2V0K A;  4N6B A;  4EA8 A;  3P47 A;  2V0I A;  3JQY A;  4EQY A;  1MR7 A;  1M8N A;  4M99 A;  3P1B A;  2V0J A;  2IC7 A;  4KNX A;  2VD4 A;  4G3Q A;  4R7P A;  5DEM A;  1YP3 A;  1THJ A;  2ICX A;  3SPT A;  3C8V A;  1KGT A;  3T57 A;  4E6T A;  2WLG A;  3OW5 A;  1QRF A;  3EEV A;  5E3R A;  3R8Y A;  4G3P A;  2JF2 A;  1J2Z A;  2TDT A;  3OU9 A;  3TDT A;  4E79 A;  1HV9 A;  3FSX A;  4HCQ A;  3D98 A; 
#chains in the Genus database with same CATH homology
 3OTZ A;  3R2W A;  4E1K A;  2W0V A;  1LXA A;  3TV0 A;  3R5A A;  2OI7 A;  1T3D A;  2L8V A;  2VHE A;  3BRK X;  3FTT A;  3MQH A;  2WLF A;  3SRT A;  3EH0 A;  3IXC A;  4ISX A;  1QQ0 A;  5DEP A;  3R5B A;  1QRG A;  2P2O A;  2OI5 A;  3TIO A;  3DHO A;  1MR9 A;  3BSY A;  3R3R A;  2IUA A;  3FS8 A;  4N27 A;  3IGJ A;  4EAB A;  3VBI A;  3BSS A;  4J09 A;  3KWE A;  1KK6 A;  1YP2 A;  1KRR A;  2OI6 A;  2V0L A;  1S80 A;  4EA9 A;  4KPZ A;  3R5D A;  2IU9 A;  4EAA A;  2RIJ A;  4H7O A;  4KPX A;  2NPO A;  1Z90 A;  2FKO A;  1XAT A;  3VBJ A;  3VBK A;  3TWD A;  4R36 A;  3FSC A;  2AQ9 A;  4N6A A;  3TIS A;  1KRU A;  1YP4 A;  3Q1X A;  1QRE A;  3TK8 A;  1G95 A;  5L6S A;  4AAW A;  2I5K A;  4J18 A;  1MRL A;  5DG3 A;  1FXJ A;  3FWW A;  5L6V A;  2QIA A;  3I3X A;  5ADX V;  3GVD A;  1QRL A;  3BXY A;  3I3A A;  4KNR A;  2GGQ A;  2JF3 A;  2WLE A;  4HUR A;  2V0H A;  1KK5 A;  3GOS A;  3NPH B;  4MZU A;  1QRM A;  3MC4 A;  2Q4J A;  2WLD A;  2ICY A;  4E75 A;  1V3W A;  4MYO A;  4KQL A;  4DCL A;  4M28 A;  3GUE A;  5AFU V;  1HM9 A;  4FCE A;  3F1X A;  1SST A;  1G97 A;  1FWY A;  1KRV A;  2QIV X;  1SSQ A;  3ECT A;  2KY4 A;  3FSY A;  3R5C A;  5E3P A;  3VBL A;  1TDT A;  4AC3 A;  3CJ8 A;  3OTM A;  1XHD A;  2QKX A;  5ADX U;  1OCX A;  3VBP A;  5F42 A;  3HJJ A;  3FSB A;  3HSQ A;  4HZD A;  4MFG A;  4IHF A;  4M98 A;  3VBM A;  1HM0 A;  1V67 A;  4IHG A;  4E6U A;  4G87 A;  1KQA A;  3OSJ A;  3PRU A;  2L3W A;  3NZ2 A;  3ST8 A;  3VBN A;  4AA7 A;  4HUS A;  5AFU U;  3KWC A;  2OEF A;  4IHH A;  3V4E A;  4M2A A;  4EA7 A;  2L06 A;  1HM8 A;  3EG4 A;  3D8V A;  3KWD A;  3R3I A;  2W0W A;  3BFP A;  2GGO A;  2IU8 A;  4HZC A;  2WLC A;  4K6R A;  4EGG A;  2OEG A;  3R1W A;  3DK5 A;  4N69 A;  3FOQ A;  1KGQ A;  5E3Q A;  4M2B A;  5U2K A;  3MQG A;  4M9C A;  1SSM A;  3VNP A;  3DJ4 A;  3OHW A;  1KK4 A;  3PMO A;  3R0S A;  1KHR A;  3OUP A;  2XAT A;  3BSW A;  4R37 A;  4G3S A;  2V0K A;  4N6B A;  4EA8 A;  3P47 A;  2V0I A;  3JQY A;  4EQY A;  1MR7 A;  4M99 A;  3P1B A;  2V0J A;  2IC7 A;  4KNX A;  2VD4 A;  4G3Q A;  4R7P A;  5DEM A;  1YP3 A;  1THJ A;  2ICX A;  3SPT A;  3C8V A;  1KGT A;  3T57 A;  4E6T A;  2WLG A;  3OW5 A;  1QRF A;  3EEV A;  5E3R A;  3R8Y A;  4G3P A;  2JF2 A;  1J2Z A;  2TDT A;  3OU9 A;  3TDT A;  4E79 A;  1HV9 A;  3FSX A;  4HCQ A;  3D98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...