The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
143
|
structure length |
143
|
Chain Sequence |
MPVELRANWSEEDLETVIRAVYRQVLGNDYVMASERLVSAESLLRNGKITVREFVRAVAKSELYKEKFLYGNFQTRVIELNYKHLLGRAPYDESEVIFHLDLYENEGFDADIDSYIDSPEYTNSFGDWVVPYYRGLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution NMR structure of the phycobilisome linker polypeptide domain of CpcC
(20-153) from Thermosynechococcus elongatus, Northeast Structural Genomics
Consortium Target TeR219A
rcsb |
molecule tags |
Photosynthesis
|
source organism |
Thermosynechococcus elongatus
|
molecule keywords |
Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-assoc
|
total genus |
38
|
structure length |
143
|
sequence length |
143
|
ec nomenclature | |
pdb deposition date | 2011-01-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00427 | PBS_linker_poly | Phycobilisome Linker polypeptide |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | serine acetyltransferase, domain 1 | serine acetyltransferase, domain 1 |
#chains in the Genus database with same CATH superfamily 3OHW A; 2L8V A; 2L06 A; 3PRU A; 2L3W A; 2KY4 A; 3OSJ A; 3NPH B; #chains in the Genus database with same CATH topology 4N6A A; 2L06 A; 2L3W A; 2KY4 A; 1S80 A; 3Q1X A; 3NPH B; 3GVD A; 3F1X A; 3OHW A; 1SSQ A; 3P1B A; 2L8V A; 3P47 A; 4HZC A; 4N6B A; 1SSM A; 3MC4 A; 3PRU A; 4H7O A; 1T3D A; 4N69 A; 4HZD A; 1SST A; 3OSJ A; #chains in the Genus database with same CATH homology 4N6A A; 2L06 A; 2L3W A; 2KY4 A; 1S80 A; 3Q1X A; 3NPH B; 3GVD A; 3F1X A; 3OHW A; 1SSQ A; 3P1B A; 2L8V A; 3P47 A; 4HZC A; 4N6B A; 1SSM A; 3MC4 A; 3PRU A; 4H7O A; 1T3D A; 4N69 A; 4HZD A; 1SST A; 3OSJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...