The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
142
|
structure length |
142
|
Chain Sequence |
YNESRPVELRPDFSLDDAKMVIRAVYRQVLGNDYIMDSERLKGAESLLTNGSISVREFVRTVAKSELYKKKFLYNNFQTRVIELNYKHLLGRAPFSEDEVIFHLDLYENQGFDADIDSYIDSVEYQENFGENIVPYYRFNNQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Northeast Structural Genomics Consortium Target SgR182A
rcsb |
| molecule keywords |
Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-assoc
|
| molecule tags |
Photosynthesis
|
| source organism |
Synechocystis sp.
|
| total genus |
42
|
| structure length |
142
|
| sequence length |
142
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2010-11-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00427 | PBS_linker_poly | Phycobilisome Linker polypeptide |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | serine acetyltransferase, domain 1 | serine acetyltransferase, domain 1 |
#chains in the Genus database with same CATH superfamily 2KY4 A; 2L06 A; 3NPH B; 2L8V A; 2L3W A; 3PRU A; 3OSJ A; 3OHW A; #chains in the Genus database with same CATH topology 2L06 A; 1T3D A; 2L8V A; 3P47 A; 1SSM A; 3OHW A; 1S80 A; 3OSJ A; 1SSQ A; 2L3W A; 3P1B A; 4N6B A; 4H7O A; 4HZD A; 3PRU A; 1SST A; 2KY4 A; 3NPH B; 3F1X A; 3Q1X A; 3GVD A; 4N69 A; 4HZC A; 3MC4 A; 4N6A A; #chains in the Genus database with same CATH homology 2L06 A; 1T3D A; 2L8V A; 3P47 A; 1SSM A; 3OHW A; 1S80 A; 3OSJ A; 1SSQ A; 2L3W A; 3P1B A; 4N6B A; 4H7O A; 4HZD A; 3PRU A; 1SST A; 2KY4 A; 3NPH B; 3F1X A; 3Q1X A; 3GVD A; 4N69 A; 4HZC A; 3MC4 A; 4N6A A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...