The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
32
|
sequence length |
141
|
structure length |
139
|
Chain Sequence |
IEFSEFTVKIKNKNNNWADLGDLVVRKEEDGIETGLNVGKGDSDTFAGYTATFFSLEESEVNNFIKAMTEGGSFKTSLYYGYKDEQSNANGIQNKEIITKIEKIDDFEYITFLGDKIKDSGDKVVEYAILLEDLKKNLK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structures of the Erp Protein Family Members Erpp and Erpc from Borrelia Burgdorferi Reveal the Reason for Different Affinities for Complement Regulator Factor H.
pubmed doi rcsb |
molecule tags |
Cell adhesion
|
source organism |
Borrelia burgdorferi
|
molecule keywords |
ERPC
|
total genus |
32
|
structure length |
139
|
sequence length |
141
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-07-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02471 | OspE | Borrelia outer surface protein E |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | Transcriptional Co-activator pc4; Chain A | Transcriptional Co-activator pc4; Chain A |
#chains in the Genus database with same CATH superfamily 2M4F A; 4BXM A; 4BOB A; 4BOD A; 4J38 A; 4BF3 A; #chains in the Genus database with same CATH topology 2GJE A; 2GIA A; 5FGP A; 2M4F A; 2PHE A; 4AGH A; 4BG7 A; 4KOQ A; 4BHM A; 2GJE D; 2GIA B; 3R9Z A; 4BOD A; 1L3A A; 3N1L A; 3R9Y A; 3N1K A; 3CM1 A; 1PCF A; 3K44 A; 4USG A; 2C62 A; 4J38 A; 2GID A; 3N1H A; 2GID B; 3N1I A; 4KOO A; 4BF3 A; 4BXM A; 4BOB A; 3MTV A; 2IT9 A; 3OBH A; 4KOP A; 3N1J A; 3RA0 A; 2NVN A; #chains in the Genus database with same CATH homology 2GJE A; 2GIA A; 2GID A; 5FGP A; 2M4F A; 4BXM A; 2GID B; 3CM1 A; 3K44 A; 2GJE D; 4BOB A; 2GIA B; 3MTV A; 3OBH A; 4BOD A; 4J38 A; 4BF3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...