The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLIQVEAVFSDGSRLVSLHNPIT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of Urease subunit gamma 2 from Brucella melitensis biovar Abortus 2308
rcsb |
| molecule tags |
Hydrolase
|
| source organism |
Brucella melitensis biovar abortus
|
| molecule keywords |
Urease subunit gamma 2
|
| total genus |
29
|
| structure length |
100
|
| sequence length |
100
|
| chains with identical sequence |
B, C, D, E, F
|
| ec nomenclature |
ec
3.5.1.5: Urease. |
| pdb deposition date | 2012-06-28 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00547 | Urease_gamma | Urease, gamma subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Urease; subunit A | Urease, gamma-like subunit |
#chains in the Genus database with same CATH superfamily 1EJR A; 1A5K A; 3QGK A; 4G7E A; 4CEX A; 1EJS A; 1EJX A; 5A6T A; 1FWA A; 5FSE A; 1KRA A; 4EPE A; 1FWH A; 1FWJ A; 1IE7 A; 4Z42 A; 4AC7 A; 1FWI A; 3UBP A; 1KRC A; 2UBP A; 1E9Y A; 3QGA A; 1A5O A; 1KRB A; 1FWE A; 1E9Z A; 2KAU A; 1UBP A; 1A5L A; 1FWD A; 5FSD A; 4GOA A; 4G7E B; 1EJT A; 1A5N A; 4EP8 A; 1FWF A; 1FWC A; 4GY7 A; 4EPB A; 2FVH A; 4EPD A; 4H9M A; 1FWB A; 1S3T A; 1EF2 C; 4FUR A; 1EJV A; 3LA4 A; 1A5M A; 1FWG A; 4CEU A; 5G4H A; 1EJU A; 4UBP A; 1EJW A; #chains in the Genus database with same CATH topology 1EJR A; 1A5K A; 3QGK A; 4G7E A; 4CEX A; 1EJS A; 1EJX A; 5A6T A; 1FWA A; 5FSE A; 1KRA A; 4EPE A; 1FWH A; 1FWJ A; 1IE7 A; 4Z42 A; 4AC7 A; 1FWI A; 3UBP A; 1KRC A; 2UBP A; 1E9Y A; 3QGA A; 1A5O A; 1KRB A; 1FWE A; 1E9Z A; 2KAU A; 1UBP A; 1A5L A; 1FWD A; 5FSD A; 4GOA A; 4G7E B; 1EJT A; 1A5N A; 4EP8 A; 1FWF A; 1FWC A; 4GY7 A; 4EPB A; 2FVH A; 4EPD A; 4H9M A; 1FWB A; 1S3T A; 1EF2 C; 4FUR A; 1EJV A; 3LA4 A; 1A5M A; 1FWG A; 4CEU A; 5G4H A; 1EJU A; 4UBP A; 1EJW A; #chains in the Genus database with same CATH homology 1EJR A; 1A5K A; 3QGK A; 4G7E A; 4CEX A; 1EJS A; 1EJX A; 5A6T A; 1FWA A; 5FSE A; 1KRA A; 4EPE A; 1FWH A; 1FWJ A; 1IE7 A; 4Z42 A; 4AC7 A; 1FWI A; 3UBP A; 1KRC A; 2UBP A; 1E9Y A; 3QGA A; 1A5O A; 1KRB A; 1FWE A; 1E9Z A; 2KAU A; 1UBP A; 1A5L A; 1FWD A; 5FSD A; 4GOA A; 4G7E B; 1EJT A; 1A5N A; 4EP8 A; 1FWF A; 1FWC A; 4GY7 A; 4EPB A; 2FVH A; 4EPD A; 4H9M A; 1FWB A; 1S3T A; 1EF2 C; 4FUR A; 1EJV A; 3LA4 A; 1A5M A; 1FWG A; 4CEU A; 5G4H A; 1EJU A; 4UBP A; 1EJW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
