1XDQ | Genus

Total Genus 85

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus	85
sequence length	267
structure length	262
Chain Sequence	ALEFSKPAAWQNNLPLTPADKVSGYNNFYEFGLDKADPAANAGSLKTDPWTLKISGEVAKPLTLDHDDLTRRFPLEERIYRMRCVEAWSMVVPWIGFPLHKLLALAEPTSNAKYVAFETIYAPEQMPGQQDRFIGGGLKYPYVEGLRLDEAMHPLTLMTVGVYGKALPPQNGAPVRLIVPWKYGFKGIKSIVSIKLTRERPPTTWNLAAPDEYGFYANVNPYVDHPRWSQATERFIGSGQRQPTLLFNGYADQVASLYRGLD

Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet0 start applet null

Jmol JavaScript applet jmolApplet0__103916898220159__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet0__103916898220159__)

vwrOptions:

{ "name":"jmolApplet0","applet":true,"documentBase":"https://genus.fuw.edu.pl/view/1XDQ/A/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet0__103916898220159__","codePath":"https:/static/js/j2s/","display":"jmolApplet0_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"103916898220159","bgcolor":"white" }

setting document base to "https://genus.fuw.edu.pl/view/1XDQ/A/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet0 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet0__103916898220159__ ready

script 1 started

platformSpeed = 8

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Genus data interpretation

Chord Diagram

molecule tags	Oxidoreductase
source organism	Escherichia coli
publication title	Structural and biochemical identification of a novel bacterial oxidoreductase. pubmed doi rcsb
molecule keywords	Bacterial Sulfite Oxidase
total genus	85
structure length	262
sequence length	267
chains with identical sequence	B, C, D, E
ec nomenclature
pdb deposition date	2004-09-07

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
A	PF00174	Oxidored_molyb	Oxidoreductase molybdopterin binding domain

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
3.90.420.10	Alpha Beta	Alpha-Beta Complex	Sulfite Oxidase; Chain A, domain 2	Oxidoreductase, molybdopterin-binding domain	1xdqA00

2A9CA 2A9AA 4PW9A 2CA4A 2A9DA 2BIHA 4PW3A 1XDYA 1OGPA 1XDQA 1SOXA 2BLFA 2BIIA 2A99A 2A9BA 2BPBA 2CA3A 3HBPA 2C9XA 2XTSA 3R18A 3HBQA 3HBGA 3HC2A 3R19A
chains in the Genus database with same CATH superfamily

#chains in the Genus database with same CATH superfamily
 2A9C A;  2A9A A;  4PW9 A;  2CA4 A;  2A9D A;  2BIH A;  4PW3 A;  1XDY A;  1OGP A;  1XDQ A;  1SOX A;  2BLF A;  2BII A;  2A99 A;  2A9B A;  2BPB A;  2CA3 A;  3HBP A;  2C9X A;  2XTS A;  3R18 A;  3HBQ A;  3HBG A;  3HC2 A;  3R19 A; 
#chains in the Genus database with same CATH topology
 2A9C A;  2A9A A;  4PW9 A;  2CA4 A;  2A9D A;  2BIH A;  4PW3 A;  1XDY A;  1OGP A;  1XDQ A;  1SOX A;  2BLF A;  2BII A;  2A99 A;  2A9B A;  2BPB A;  2CA3 A;  3HBP A;  2C9X A;  2XTS A;  3R18 A;  3HBQ A;  3HBG A;  3HC2 A;  3R19 A; 
#chains in the Genus database with same CATH homology
 2A9C A;  2A9A A;  4PW9 A;  2CA4 A;  2A9D A;  2BIH A;  4PW3 A;  1XDY A;  1OGP A;  1XDQ A;  1SOX A;  2BLF A;  2BII A;  2A99 A;  2A9B A;  2BPB A;  2CA3 A;  3HBP A;  2C9X A;  2XTS A;  3R18 A;  3HBQ A;  3HBG A;  3HC2 A;  3R19 A;

...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

1XDQA

Total Genus

sequence length

structure length

Chain Sequence

Structure visualization

Chord Diagram

connected with : NaN

pfam database annotations