2A9CA

Crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
359
Chain Sequence
RVNSQKPFNAEPPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 89
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9cA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9cA01
2CA4A 3HBGA 2A99A 2BPBA 2CA3A 1SOXA 2BIHA 2BIIA 3HBQA 1XDQA 2C9XA 2A9AA 3HC2A 2A9BA 1OGPA 4PW9A 2A9DA 3R18A 2BLFA 2A9CA 2XTSA 3HBPA 3R19A 4PW3A 1XDYA
chains in the Genus database with same CATH superfamily
2DEYX 3HN5A 5FM5O 2E9BA 3HB3C 2OQJB 1CDCA 3IBEA 5F89B 4PV8B 3ZO0A 3ARFB 4YO0B 5BZDA 1IVTA 4UQEA 1ZANL 3KPTA 4UILH 3WE6A 1HSBB 4U6TA 3UTSD 2QSCH 5JR1H 5FDWA 1OAUL 4NGHH 2FT7A 2FX8L 1R17A 2AS5M 5I82A 5JNYA 4ZNCD 4U1IA 2CO4A 5CCJA 1FG2B 1I85C 4JQVA 4HJ0C 5C6TL 1AS8A 5DD1H 3D39B 3O6FD 5AB2A 1HCFX 4L8DA 1MJ7H 2WLIB 1BIHA 4PIRF 1T04A 1G9NH 1UM4H 3B9EA 3DIDA 1NCGA 1SBSH 3FRUB 3LIUA 5EU7C 5I6MA 5I9QC 4PJBE 3ARQA 1URIA 4KV5F 3H9HB 4TF4A 1QACA 1MG2C 4XNBA 5D96C 4HCRA 2FO1A 3BUYB 3ARED 4BZ2A 3NRFA 3RWDB 4WUUA 1ZHLA 3II3A 2NY5H 1WYJA 4TV3A 2H2PD 3HBPA 5AW0B 4E9XA 4EN3D 5EIIA 2WQXA 4HGKC 5AKVA 4KX8A 5INDA 3GI8H 4G8EB 3V5KA 3RFZB 3BESR 2JKTM 5MEPA 1BVZA 3FTGA 3QUGA 4MMZC 1TXKA 4JKNA 2R4SH 5I1KL 5PCYA 3TF4A 1YLBB 2N1KA 3KYNA 5JPNC 2J57A 3IFPB 3RBSA 5JTWA 3UAFA 1MREL 1K6QL 4WWKC 1IKOP 5D1QB 1J0YA 1TSRA 3A67H 4QD2E 3ZU8A 3BKJH 2GK0B 3GTTA 1UENA 5EZJA 1LO4H 3KLSA 1UWYA 3GK8H 4OCWL 4X7TB 2ZSWA 3T0BA 3L9RB 2GIXA 1S9WA 1PZBA 3NSDA 3K6SA 1RZPA 3GDBA 4FE9A 2VLJD 4K5PA 4NBZB 4CVZB 4QR7A 4NAQA 3FL7A 2KKQA 3HG2A 3L3KA 1QZ1A 1W80A 1BECA 1JI2A 1GYCA 1LMKA 2YPLA 1ETA1 4OKVA 3O2VL 1RZ8B 3GJFB 3ABGA 3V0AC 3O45A 5KN5B 1MW0A 4NQCB 4S0SD 2OTWA 1T80A 4RQQA 4AT6A 4JG0L 3FCBA 2B7DT 1S5HA 1UHVA 4LSVH 2F5BH 4G7QB 4ONOA 4KY1H 2HWZL 2DM7A 1KULA 3ELQA 6PAZA 2V2TA 2VR7A 4KKLC 3RKDC 3W38A 4X5PA 1QUNB 3FFCE 2YMTA 3VB8A 5CILH 4X8CA 1C12A 2AJYH 1HYRC 4EXPX 5F1NB 2GITB 3C5ZC 5AENA 3GS4A 2FYVA 5BCAA 1DUZA 3ULVD 4A04A 4A7QA 4Y4KB 4GUPB 3C60B 1FNGB 2E27H 3UIZA 2PCXA 5GGQH 5ABZA 2HLAA 2R0LH 4PMFA 3BJLA 3MSPA 1RSYA 1KN2L 2BP3A 4ATTA 3QISA 3LRSB 4PJIA 2FZ3A 1ZGLM 1EO8L 1MRCH 4POZC 4NPYB 2YHGA 3BP5A 2QPEB 3LRHA 4NIKB 4LVOC 3JUZA 1V27A 4MNHA 3EYQD 1DL7H 3EOAA 2WWMC 3W9DA 3D0VA 4LQFL 4QHKI 4TVPL 1AQDB 2XTJD 3N6YA 2CR0A 3SBWC 3SJVD 4PJ5A 1DJHA 1J1PL 2BNRD 2H0FA 3K0YA 2VR4A 3CVDA 4JQIH 5F7EH 3IJ9A 4NUGH 5DUMH 4YXKH 2P52A 2YD5A 3CVCA 3D51A 4GO6B 4HJGB 3SHSA 3PAYA 1Z9NA 2XOTA 3VRIB 4E41A 4ORZC 4JFYB 4IBSA 5CJ8A 1U8OA 3FB7B 3V8CA 2YO3A 3UGXA 3QR2A 4UDTA 1QQDB 1U8MA 5HYJD 1NOFA 4FFYH 1SBBA 4MD5B 3PWNA 1ERNA 2XPYA 4Q89A 4EMZA 1TSHA 4D0CB 4L1SA 4FZEL 3K72A 1WS8A 2G9HB 2HJFA 3OZ9L 5HHNB 3SSGA 3PV6A 5ENWA 3WNMA 3SBQA 2A7BA 3BGMB 3OKNA 4QWWD 4U1LB 3GPEA 1XH3B 4IDJL 3CFKA 4HSQA 4EXKA 4JFFE 1CT8A 3V55A 1AGBA 1FFRA 1H3PL 1R24B 5DRXB 3RGVA 1QI4A 4N86A 2QR0B 4KHXH 5HDOA 2D7TL 5BUPA 2Y2YA 4O58H 2DKMA 3CTTA 3TN0A 1RPKA 4GG8B 3T1FB 1T5KA 2OZ4H 3L5JA 3Q48A 4B50A 3BWUF 4LL4A 1N3NA 5IMKA 4H5SB 1NFDE 1J5OL 4HJJH 1B0RA 1BAGA 1RLBA 2YD9A 1KCBA 5K9JL 2N56A 1TMCB 2CDEB 3DTUB 5IFJA 2SEBA 2UXFA 5LVEA 1JXDA 1FYTE 3UPRB 2YZ8A 1JPTL 4GG6B 2D0GA 3TIDA 2BW4A 2FQDA 5K69A 2DWYA 2DMKA 2XWTA 3ZDWA 3GBNH 5HHPB 4H20L 3UG4A 3PXLA 1M7IA 3E7JA 1TFHA 1Y6MR 2R69A 3MRJB 4LLUA 3OJDA 1S46A 4XWGH 1A1OA 3P3SA 2BVPA 1JDCA 3MV11 3RDTD 1AO7B 4JFDE 3ZZSA 2IO5A 1HNGA 3UBXB 2VUKA 1PGRB 5CD5C 1X6LA 3C2AL 5HVHB 2A83A 3NPZB 4M48L 5C08B 3ML9A 3KPSE 5FF6A 3L5HA 4X6DE 2QZ5A 3RRQA 1SRDA 2C9QA 3DUUA 1F3DJ 2W95A 1GGIL 3L8QA 5DJ0A 4AEIH 4APQB 1N5AB 1T2QL 5F71A 4M93C 4ZFFB 4PRHE 3STZB 4IU2B 3HA0A 1BZ8A 4HUMB 4NBXB 4MGXA 1F8TL 3EBAA 3HN3A 2OMTB 3MLUL 4KI5D 1T89C 4OQ1A 1D5BB 4KK8D 1I8UA 4Z7UE 4BA0A 4IJ3C 4H40A 1VPOL 4PAZA 1ACCA 2QKSA 4XZUA 4YXHL 2FHCA 3FOLA 2W07A 3BWUC 4LPTA 1TO5A 3MNDA 3MGOB 1BQRA 5GGUA 2YXMA 1U4EA 3MJ8B 4YDMA 4ODUB 5E4EC 4UZSA 2CSPA 3FQRA 2B5IC 4JPWH 5C0ND 1JZGA 2PXYA 4Z78A 2VGLM 3G08B 3JYCA 3QNZA 4ZOCA 2FE0A 3MLWH 3VFPB 3VGEA 1AE6H 4P5TA 1AR1C 1HHJA 4R2GB 1EHAA 5IB2A 2JCCE 2Y4SA 5KYNA 4KOBA 3VNYA 4UU9A 1XH2A 2IQ9L 1QW8A 2NY0B 5F2FA 4YR6A 3T0VA 2P5ED 3GSNA 5HI3C 1HZKA 1A6ZA 2YD6A 1XGYH 2F7OA 5IQMA 4P46B 1U8CA 1AP2B 3Q06A 4NRXA 1I9RH 2W9DH 4KUCD 4X80L 2DTMH 4PJBF 4IIZA 3VWJB 5DUBA 5IHUH 2CLVA 2P8MA 3RNQA 3T0EB 5FHBL 4F37F 5I1IL 3VXRE 1MF2H 2ICCA 4PU2A 5I71B 2VL5A 4ZAKA 4LVNC 4GSDH 1GZHC 4P2QD 3VTTA 5D7KD 4YPGB 4MCNA 1IQDB 1YEGL 1HFUA 2J43A 4L5FE 4J23A 4W70A 3TBTB 4A66A 2MNJB 3LV3A 3CPUA 1LK3L 1Z5YD 3GKWL 2BNQB 3NQKA 4PJ9C 3GMLA 5CZRA 3T2OA 4UOZA 4Z3FA 7PCYA 5I30L 2AK4A 4JFEB 4P4RB 2B4CL 1U8LB 3MRPA 4X9GA 3BAIA 5DT1L 1J8HB 5E0FA 3SY0A 3ZKSD 5IW6B 3SKOB 4BXSV 4J3UA 1N7ML 2ZWKA 3CSTA 2YGVA 3I84A 3N85H 4MHHG 3IWVA 4MNQE 1V5JA 2RB8A 2EIZA 3VE0B 2JE8A 2PCFB 5I1GH 1HC1A 2HXAA 1MHCA 4FFZH 4JZJA 2HFEA 3FUDA 1P9MA 3VCLB 2EE6A 4F7EA 5KSVA 3V0IA 1MH5A 4AYFB 3CSBA 4P59H 4GRLB 4MJ5B 4Y9EA 3RNKA 2NZ1A 2F1EA 1QFWH 5KS9E 4P2CG 4LHUG 1NGXA 1QSEA 2Z7YA 3QDAA 1MCJA 2QPUA 4OJAA 5KSAB 3QUYC 4FQCL 2RACA 4MDJB 4XVTH 1W72A 5JXEC 4J3XA 4MA3A 1K4CA 3CVHA 5DQJA 3BP7B 1GS7A 2OJZH 3GUFA 5TGBB 3GQFA 1I3RB 1LM8V 2QKIA 4U6VH 1E8ZA 3O8XB 5I75C 5B39G 2X09A 3KYAA 2XWDA 1EX0A 1TTAA 4OJFH 4PJXA 5BZZA 3IDMB 1QYGL 2V17H 1XIWC 2AITA 1IUZA 5F7BA 3MLSL 4ZMXA 2VKXA 1AXTH 3LXAA 4FQJL 2PWEA 2LVEA 3TT3L 3VD7A 4Y9GA 2WINB 5CFAA 3KLLA 1VF5C 2QVTA 4KU1A 2R2HA 3VXTA 3VXUE 5AW6B 5J3HD 5D72L 5JW4R 5F72S 1DEEB 4G9FD 5ICUA 4JGUA 1F6FB 1KB5B 2A6IB 2XRAL 3RA7L 1E5YA 4H25A 2DH3A 4P0DA 1GOHA 2CBTA 3QK0A 3MLXH 3OWEA 4M8RA 5ISZA 4KTGA 4DESA 5LB1A 4XH2B 3VXMB 1BF8A 4AEFA 5I6XB 1JTOA 1HU8A 2AK1L 2NT1A 3MLVH 1G94A 4G6FD 4UT6H 2BRQA 1KWKA 2NXYD 2F54E 4QOKA 3PJSA 4FQ2L 2R7EA 5GIRB 4S1DD 3DWTA 4HK3J 3NSFA 3PWPB 3UAJC 3GHBL 1FZKA 3F85A 2E9GA 1GXEA 1JK9B 2BJML 4Z7VB 3MNVA 3WFEL 4YL9A 4NQXA 3VXNA 1JZJA 4Z76A 3MA9H 5E8EA 2MCAA 1MFVA 3A0OA 3HPJB 3LRKA 3L16A 5F44A 3NJNA 1PSKH 3HE7C 1BM7A 4U0RC 4DZBB 1DBKH 1YEKL 3EUUA 4RIRB 4YLQT 4X2UA 5E6ID 4JPKL 2UZYA 2WXQA 4GRWE 1JVOA 3TZVD 2VERA 2CBPA 3ZVVA 2IPTL 2IPUG 5CZVL 1D9KA 1H8NA 4U05A 3RZCD 1AKPA 1QSFD 3MV8A 4XCEB 1HDMB 4PJ8A 2NXZD 4W6XB 2JKNA 3V4PH 4AIOA 3IN0A 1QEXA 5ICXB 4TNVK 5EO1B 2NZ9C 2XA8H 3SN6N 5B7FA 3CK0H 3T2NL 5DJYA 5CXPA 4IBUA 1FVCA 1IC5L 4J3OF 3SQRA 4OB5L 4N68A 1PD6A 2NSQA 4NO2A 4BCYA 3FONA 3S36L 1RUPH 3OSKA 5J1TC 3RY5A 3DTXA 3VVWA 3D87B 1HYSD 1XMEB 4RESB 2HLFD 3P9LA 3QIUB 4FJYA 4FS0A 1G43A 1NFDF 1OV8A 5MENA 3KCWA 2IANB 4OZHA 4L48A 4QYOB 1KPUA 1XCTB 1N2RA 3CDGB 5FHAL 5BRZB 2EVFA 1Q90A 4OV6F 1B0IA 2WVVA 3WIIL 3MMEB 3I9GL 5J11B 4G71B 2FB4L 4TOYL 5KBMA 1T7XA 1I1AD 3FRPB 2ZKMX 4TNGA 4Y4HA 4GAYB 1A9EA 3SGEH 1MCWW 5BW7A 2BHYA 1A8ZA 1XSIA 5IKCB 3WKML 1KG0B 4MAYD 4ODSL 4KZDH 3K5RA 3P4NB 3W81A 4QJ4B 3BSGA 3NABL 3WYRA 2KH2B 2P48B 3H9ZA 1QD0A 3UTPE 4K23H 1PLGH 2GI7A 1J5HA 2VXTL 1VFAB 1UADC 3MRBB 4OCLC 3DVGA 5CLZA 4JN2B 3MNMA 1P4IL 3APNA 2QVMA 4MA8L 2CQVA 4XC1L 4NZ8A 4DGIH 3WIHH 1PLBA 1TZGL 4AENB 1TVBA 3JWDH 4JRFA 4X6DF 1AJ7L 5EMYA 1AG0A 3EFFA 5GZOA 4ELME 4WRLA 4KNTA 2Z4QB 3GJEB 2PP9A 1LO2H 1CBJA 1KGCE 3PL6A 1CG9A 4Y19E 3V4VA 3NCXA 1KWGA 5KVFE 4UAOC 4HIXL 4PJHE 3WELA 4LEBA 2FRGP 1KXHA 3TJHC 3RGHA 4YDVB 5EC2B 1RJZB 1WO2A 2GBTA 3MJ7A 4Z7UF 1JHLL 4R4FH 1U2CA 4LLDA 2NW3B 1YHPA 4L1HA 3VWKB 3GBLA 4X7DC 2OXGB 1CQYA 3OKEB 1JZ7A 2YC1A 3I6GA 4XPGL 2X9XA 2ZWZA 2ARJB 2DIAA 3LQAC 2PKDA 5EO9B 2Z65C 2HT3D 3MOAL 3TBVB 5B3NA 2PWHA 4LCYA 4TS6A 3U7YL 32C2B 3ZK0A 4HIIB 5EF2A 3GZPA 5KJRL 5JMOC 2PYFB 2NYYD 3KGUA 4HUUA 4JRXD 4MJ6B 2JCCF 3QXUA 4PB0H 1F6AA 2CKNA 3ZYIA 3DYOA 2CGYA 1QZNA 5F9OL 2R0WH 4PJDB 1T1XA 4ANVA 4F93B 2DAVA 3RUGA 1QWUA 4OZFA 4GQQA 4UM8A 2ICEB 1I9EA 1NDTA 5J6SA 4ZZFA 1J1XH 4LCIL 1GGUA 4FTVE 2X9WA 4LDLB 4XN5A 1LEGB 4EUPA 4HWBA 3C6LA 4DTGH 1N64H 3LZFH 5AZ2L 1MCNA 3IS0X 4GIOA 1MLBB 3VG0H 5I76B 1T7WA 4C8XA 4K7PL 4Y9BA 1H5BC 3MTRA 4F8TA 3ESOA 4NQUA 4FQHA 1U91A 2I60L 3NIDB 2Y06H 3FO1B 4FZ8L 5AVWB 3TYFB 3LZPA 4K5MA 4CJ1A 2Y23A 3WUZA 3KM2A 2DOCA 3GBEA 43C9A 1CFQA 4CMHB 3EJRA 3MJ9H 1XF3B 3ARGC 3H9SE 1Y1DA 3QG6A 4HIEB 4XPHL 1ONQA 4MXVE 5LGKA 1LP9A 1QRKA 1XMWA 1R1CA 5IB4A 4JHUA 2DQEL 1MFEH 4M1DL 1N0XL 1IM3D 1DFBH 3ML8A 4S1QH 4Y19D 1OSZA 2JKXA 2FSEB 3VW3L 1FL5B 2PF6A 4RFOL 5B38A 1CBVL 4G8FB 4AIXA 2VDRB 4CA4A 2IXQB 2KYIA 3WUWA 4E9WA 3NZUA 1JCKA 4IKKA 5IBUB 1YEEH 1S5IH 3CHXA 4G11A 3PGDA 4QTIH 4QKTA 2WMPB 5KS9F 4HP5A 1KB5L 1NCAH 3GSRB 4Y2DB 4Y88A 3H85A 3KZ8A 1WT5A 3CHSA 4XNQB 1H8OA 3IETB 5DEJA 3UZEA 1BM3L 1JPGB 1UJ3B 2X10A 4BINA 4HF5L 3T77B 1E67A 2FBJH 5CJQH 2IFFL 1P53A 3L3OA 5FIEA 5CKGA 4I18B 4JFHD 3KLDA 3KR3L 4ZNEE 3POCA 1OTUC 1YEIH 4WDIB 1QLEB 4LIQH 4KJYA 4ZS7L 3FHQA 5LBSL 3SDCD 1VFBA 3NOIA 5D7JB 2NQCA 5KZCD 5FYLD 3MXVH 2X4TA 1IE5A 3HBQA 4DIXA 3WDIA 4NHUA 2CRYA 2WP3O 4U4BA 3QRGH 4PS7A 5AVZB 3MC0A 5ANHA 1CGSL 2BS8A 3IDUA 5FLUA 2HVKA 1JGUH 2X6VA 2ED8A 2YLKA 3AY2A 4FQPA 3GIVA 5TH2B 4MZIA 4XMKL 3NK3A 2A77L 4NBYB 2GY5A 5DVMA 4XAWH 3X3GL 4FNSA 4XNXL 2H32H 3QZMA 4QRRB 5DI8B 2DQIH 2BIHA 4KRPC 4C57C 1IU1A 4LEEA 4ZUSA 4D8OA 5GRZA 5AW1B 1QNZL 4X8JA 3MRRB 3F6LA 5D1XB 4JAMB 4M62H 4GSQA 3PNWA 3AAZA 4W9LC 2DBJA 4RSYA 2KDGA 4ZYKA 1O9VA 3TEZA 3WXVL 5HHME 1KXVC 1FFOB 5E6RB 3C08H 2FAUA 3DYMA 5DD5L 1XH1A 4OLXH 3TJPA 2NY2C 4L1DA 3IT8D 4G6JH 4PB9H 2EO1A 2QPSA 1UUSA 4KNQA 2EEXA 2FQEA 3MREB 4ZFZB 2P8PB 3K2UL 2MFNA 4PJ7B 1AD0A 4PJCA 5CFHA 4ZD3L 4PWGA 2MHAB 3HI5H 4ANXA 4E68A 1VGEH 5GGSY 1QFUL 2K6YA 4GRWF 5LGYA 2UXTA 3T2LA 3CSPA 4QO1B 4IBTA 1NEUA 1X5XA 2IOIA 2H45A 4LQ1A 3NZ8A 2I85A 4TTGA 4F9PC 3T3MB 1YEFH 2H3KA 4NLAA 5E4OA 1A7QH 3QWRD 3V7MA 4CVUA 1JF6A 2NDGA 2ZYSA 4XMXA 4BGLA 1KXQE 4LF3B 1EJOH 3HRZA 4G8GA 4L1BA 1AGDA 2UZIH 1O7SA 4WI8A 3DJTA 3R7QA 1CFMA 4IOFD 3SCMD 5A40E 5MI0C 1KY6A 5AWNL 1PZ3A 4HUNB 2ITFA 1E5AA 2CXGA 3AY4A 4WY7H 4YMPA 1WPCA 5C0JB 1R3JB 1T0NB 1NCUA 3BWSA 2UYLB 5DLML 3UTTB 4NKIL 1ZHKB 2EDYA 4JCMA 4R7VA 3DARA 4QRFA 4KRNA 4UQ3A 1F42A 3IB4A 1BSIA 4N6RA 4XB3A 5JDSA 5TK4A 3NPSB 1MLCB 4Z7QE 1NMAH 2EIMB 3O3BB 1E4XI 1OB0A 2PUQT 3FFOA 3HS0C 2ADIA 2D2CC 3MV7E 5GISH 3SD2A 3LCYA 4LKXB 2GCYA 3RVVD 1BFVH 2EAEA 3KPQA 5I5JA 3HE6D 1S7VB 1J5CA 4BWUA 2A9BA 1G0DA 3RIFK 2WIMA 1KELH 1RUQL 4S1RH 5EN2A 2W91A 3FFDB 2E59A 3U46A 3MV01 5DHYA 3JTBA 4ERSL 3SPJA 4UB0H 5BS0A 1JWUA 5C09B 4XZ4A 2GSGA 2A6KA 3P02A 4CW1A 2EIBA 3B7UX 5C3TA 3G5XA 3F7PC 2DQCL 3RI5F 4Y2LA 3KLAB 4ELMF 4ABWA 2VDNL 4O2FB 5DC2A 4JDTL 4XNAA 1V7NL 2D73A 3VXSB 2X4SB 3P0VH 4GKSA 4PJHF 2ZCHH 1ZXQA 1B2WH 2R2BB 1IIKA 3BWZA 2VXUL 4BH8A 2J8UE 2IAMD 3OKDB 3L3IA 2YQGA 5EOTB 5IBTH 1FZMA 4E42A 4JB9H 4BFKA 4WKZB 2JJTA 1I3GL 1KB9K 5TE6H 2LTQB 2ESVD 1MQ8A 1ZLDA 3HR5A 5T3XE 4PP2A 2OBGA 5DK0B 3MRGB 5IESL 4EKXA 5IOKA 3TC9A 4HAKA 3H56A 2VDLB 2GT9A 3TA3C 1EERB 2FJUB 4HCRH 2VN7A 2NR6D 4MD0B 4BZ2H 2ICWA 1GAFL 2X0VA 3CXHK 5JXAL 5I18H 1A7PH 2YXWA 2BCMA 3O2DL 2J4WH 2CJUL 4HCIA 4MXQC 1TDQA 3BIKB 3LN5A 4XN7A 5L4JA 4GINA 4YSPA 2ERJC 4GS7C 4RWHA 4MDIA 5AB9A 2D3LA 5D2NB 3DVFA 2BP0A 1CL7H 5CP3A 3DETD 2Y5EA 5KVEL 2XUWA 5D9SA 5C07B 4WFGE 4P2RE 2ADJB 3SB3A 3QH3A 3N55A 1DBAL 3W39A 1YG9A 3T71A 1NCIA 4TQHA 3P3YA 1JN6B 3ULUL 4KTDL 3PQYA 1OD9A 2LQRA 1T1WB 2G2NA 1I8LC 4OCXL 3F7LA 1DDTA 4WJG3 4MJ4A 3WN5C 3DTDA 3OKMB 4I3SL 3FH8A 2VDRL 3HI6L 4IBZA 4Q74A 3O6FB 3N41B 4O5LH 4XNMA 4AI7A 5EIIG 4EDWH 3QJOA 4PCSA 2AF2A 1ZPUA 2CUIA 5BQ7A 4MLIA 3NFSH 3QI9C 2JLPA 1GJWA 1PNDA 1RPUA 3TP4A 5C8JB 4JY5H 1MHHB 1CL7I 1RZ7L 2A74B 2VAAA 5DRNA 3AREB 4LKCB 4ODVH 2Z34A 3H6AA 2WYZA 1UM6L 4YIQB 4EN3B 1SXNA 4MXVF 1QOKA 4K5NA 3SO5A 1SZNA 5FUOL 2ICES 2WYHA 3KXFE 4OD1H 1WUZA 3QXWA 1PBYA 2WZPA 2CO7A 2F1AA 4J2QA 5HHXH 3GB7A 1YNKL 5ITBL 3P4MA 2UWEE 4L0YA 4GH7B 4WGWB 4P2OD 1Q9LB 2WOYA 3ARBB 2YXFA 1MFMA 4DKEL 3S37X 3HVDA 3IFOA 5K93A 5DVOA 3U0PA 4ENEC 1JG9A 1CFNA 3GMRB 3L7EA 4FNLL 4OUUA 4YHYC 4A67A 2IOOA 5C0BB 1SQ2N 3GXUB 1OW0A 3M07A 1FO0B 4M5ZL 4FQXC 2Q2EB 1ZV5A 3UTSA 4FG0A 2V8LA 4QI3A 1A7RL 2VLJB 12E8H 1U8NA 3R18A 2MIZA 2CHDA 2JMRA 4HD9A 3S8WA 2IWKA 5B21A 2HPOA 4JJHA 5EU6D 4D9QE 4N0UE 2W1NA 2JQZA 3PDOB 4ZMPA 4WFHE 2DQTH 5CGBA 1K85A 1ZIAA 5E9DE 1E6OH 2BXZA 3HJ0A 3L3JA 3QZWA 1BFSA 4J3TA 1EAPA 2IV8A 3QIBB 5IFAL 1K4DA 3QJUB 3DMMB 4X5XB 4DPRA 5CEXB 5DA0B 4PRPB 3QO0B 4UOW0 5D7LA 1CE6B 2YSSA 5BRPA 5TDOB 3MX0B 4BHUI 2OK0L 3V4UL 3BSZA 1MCKA 3TV3H 4JZOA 2XVLA 3ARTA 3AXLA 5DRZA 4IRJD 3X1EA 3I2CH 1GYVA 5E6SB 2A5UA 2DZEA 3JVFC 4XPAL 5JYMA 3C5XA 4AGPA 5MHSD 1UWFA 1CLYL 2A2QT 4QXVA 5L6YL 4XNUL 1MVUA 1PNCA 4YSCA 3TCLB 3ATDA 1NAKH 2UY6B 5I8EB 2I9TB 4J3OH 1VZGA 1MFAL 2P47B 2P46B 3RIAK 1UD4A 4KDTA 2O6DA 4YSEA 5GZND 3SDDD 2XI9A 3L9BA 4IBQA 4PY7A 2W92A 5CINL 5ALBL 4KH2A 4CC0A 2EECA 3AG1B 3DOHA 2OFQA 2XTJB 5C70A 2X41A 1QWNA 3LQAH 1MW3A 3EYVB 3RURA 2HFGL 5F7UA 3SJVB 4KNSA 2BNRB 1WCBA 2QQNH 5KSUA 2Z31C 3QWOB 1BEYH 4IOIA 5CM1A 3MUJA 3AU0A 1P7QD 4G9DB 4J3OG 4W68A 1G6RH 4QDGA 1J9SA 3BRDA 4BFRA 2D4DA 4IBVA 1P7KB 1N6VA 3H2PA 3ZE0E 2D9QB 4XBPB 5D1ZD 1JWMB 1KTDA 2H26B 3QEHB 4YHIA 2BVYA 3KBFA 4DGWC 3NJIA 2V7NB 5HHOB 2WPGA 3BLKA 4RBPH 2WQWA 3GIZH 5HYJB 3BQUC 4XNZB 5B7MA 3AM8A 4LCWB 3KPNA 4PYHA 1CF8H 3CZUB 3N40P 4KRMB 4JM2D 4R84A 2BDNH 4OAWB 1DQJA 1E8XA 1X7TA 2XKNB 4X9HA 4HXAH 4H8VA 4CSSA 1RVFL 4AKQA 3W9EB 3MFFB 5IB3B 5H8DA 3BE1L 4WO4C 3DROB 1ZK9A 1R47A 1YO4A 3FUHA 2Y25A 3K80A 4ZFGH 2K4WA 3DX8A 1E9OA 3NFPA 4Z7QF 5FUZL 1QHQA 5IHHA 3B5GA 1GZQB 3CX5K 3H3PH 2FIKA 3BN9C 4Y7MA 2A6DB 5L88L 4DKFL 4KQ3L 4MKMA 1EO7A 2YPVA 2WOBA 3BD3A 1BHGA 5IR1A 3EOTH 2DJUA 4BQBA 4TN9A 2DS4A 4MXWL 2WIIB 3NCCB 4NAJA 1XF4A 4L9LB 1T5WB 2KERA 4U1MA 1DBJL 2OMUB 1A0QH 4GXUM 1AGFB 2P5WD 5T5FA 25C8L 5FO9B 5SWQB 5I8CA 1H8SA 1RHFA 2FEDC 4PJAB 1AQ8A 3NEXA 1ZGLB 3UH8A 4PEEA 1U92B 3HG1D 2YD4A 4LCCA 3F3HA 3T8VA 2VDLL 1YN6B 1NAMA 5DZLA 4DPBX 2A9CA 3RY6C 5AL0A 2MNWA 2E9WA 3HG4A 3GI9L 1XAUA 3G5YB 3ARDA 5FOBA 1LQSR 1QO3B 1UWEL 3IGAB 3OKLA 1ID2A 4FX5A 4CVWA 1GPOH 4XAKD 1TTRA 3RX9A 5BVPL 2O61A 5FA4A 1U95B 1WGOA 4X7SL 1PG7W 3K91A 2ZNXA 3ROOB 3FUIA 3DGGB 2J8UF 2NY4C 3D52A 3GRGA 4TQEH 3L3HA 5CEYA 4LRNL 5DR5H 1HIMH 1RZJH 1LWJA 4CC4A 4WUKH 5JLZB 3TEYA 1AYRA 3GSNH 3TCXA 1XCXA 2EEDA 4RAUB 3DHMA 5C0CD 3HNTL 4V33A 4P3DA 4N4YB 2DMCA 2EYRA 3QT2A 2Y1ZA 4WFED 1LXMA 5AOJA 3CD4A 4UV4L 4AMXA 2VLRD 1ES0B 1KGUA 1P6AB 1U8PA 4XO3A 3U7WH 3UL4A 1DN0A 2Z1KA 1OAKH 1NCNA 1YECH 4NQED 4ZSOB 3RVWC 3BXNA 3FU5A 1JFQH 3IJSA 4WW1A 2O72A 3ZHFA 4BUQA 4QRTA 3B8SA 1J87A 4PQXA 2DQUH 5HPMA 3IKCB 3FN9A 3MRDB 4FL4B 5H35B 3C09B 5K1NA 4DKAA 1BYNA 1IEBA 3KDMA 3Q1SL 4PBWD 3WNPA 5E2WL 1ADQA 5TJWK 1X7QA 1UYWH 4NERA 2QHRL 5J57B 5ERWA 3RWIA 5I8KH 5LAPA 5BXFB 3Q5OA 1ZHNA 5KOMC 2X9ZA 2P7TA 2PMZA 4JHWH 5IG7A 5GSRA 2CRZA 3RDTA 3CLFL 1NQBA 2ZUQC 2CUMA 3QULB 4M7LL 2BC4B 1FO0L 2NX5A 3EO9H 5I1JL 3LH2L 2GFBB 4Y16A 1GYWA 2DYSB 5AG8A 4PRDB 5HGBA 4JPQA 1IAKB 3OGCA 2YWZA 3TNNA 4WNJA 5E9AA 3DBXA 3LN4B 2D03L 4ZXBD 2AJVH 3O11B 4QXGH 4CN6A 2UWEF 2IV9A 1RURL 1PFOA 2ZWSA 3HJEA 3MHZA 4DGVL 2XQBH 1X5GA 2JTDA 4K3EL 2IVFC 3ZMRA 4DP6X 2KL6A 5FV2A 3AW5A 4HS8L 5FYJL 5L4FA 4MQ7B 4ZPTB 2YD2A 3P9MB 2EYSA 2WQUA 4UQ9A 4OLVH 1G7JA 4X6FA 3QGVA 4YBHA 1VRSA 4K2UL 4D0DA 4L0ZA 4B41A 3MGAA 4TVPE 3NESA 1HNYA 1EJFA 3EH4B 3IDGA 3ULVL 1DBML 1IGTA 3LXBA 4X42A 5DHVB 4N2CA 5J9PA 1P4BL 5ID0B 5M7QA 2YRPA 3MLZL 5L2KE 1D5ZB 2CA3A 4X5LA 1UFUA 3EJYD 4N2HA 4MJHA 1F3DH 4JPVH 2YAOA 5CCHE 4HU2A 3X13B 2P5EA 3D3VE 1WDAA 1FFTB 1OAJA 1RAMA 1DVFC 1UACL 4J28A 5T1KA 1K3ZA 4P4KA 5E6ZA 2YPKA 4YK4B 1A3LL 4WHTB 5EIQA 4L4VE 4OLWH 4XVJL 4G5ZH 1IMHC 1R5WA 3EXLA 3O9WD 4AITA 5HGAA 3IDYB 2GAZA 1IL1A 3HI1B 4GRWH 2J1KA 3JT2A 4HHWA 4KVCL 2G75A 4WV1B 3S8FB 1P7BA 1M1XA 3THML 2WO2B 3U7AA 5F8QC 3QDMD 4P2QA 5JW5B 4NUQA 1FGNH 2OLDA 5CLWA 5CU5A 1S78D 4LOEA 1YMMD 3L3DB 5DUPH 1JVLA 3L5XH 4HXBH 5DQ9A 1QBLH 5TE4L 3KS0H 4F8OA 4AV5A 3VQMA 1ORQA 2HG5B 1NMBH 4KUZL 3GMNB 2F5AL 4M8UA 4NRYB 5E1AA 3M1OA 1OCCB 4G9FB 1YQ2A 5EWIH 5DC9B 5CJXC 1IO4C 1H3UA 4I2XE 1UD2A 3KJ4B 2IH1B 4KGLA 3N44B 2QBWA 2YK1H 4JEGB 2AKRB 2ZOOA 4HDIA 1HQ4B 3RWJB 1MCQA 4XC3L 1A4AA 4G6FB 1U8QA 2AERT 2O6PA 3QFJA 5GGTA 4AVKA 1QTPA 3MRLA 3PYCA 3TEUA 4RSVA 1KBVA 2XKUA 2NXYB 4N0RA 4A6YB 1OCZB 5C08E 3TESA 1JNJA 5LCVH 4O51A 3HS9A 3U4BL 5T33L 5D7SH 4Z7NE 1L9RA 2ITEA 3ARFA 2GC7C 3SQOL 1KJ2H 3WJJC 2E8YA 1KYOJ 2FDBP 3ZE0F 3LZLA 5LG6A 1MJJB 5HHQA 2AGJL 5DC0A 3TS8A 3ILPA 5DMKB 4PGBB 1M1SA 5JIPA 4Z3GA 3UAAA 1SN0A 1G7HA 4WAFA 4LSUH 3UYRL 3FO2A 4LLYB 4L8SC 4MA1C 1OARH 4M7ZC 1A9BA 3CFBA 3T6ZA 1HZHH 3D39A 1FBIH 1T1YA 2HCZX 5ETUA 5IGXH 5E6IB 3B2MA 5A2BA 1EHXA 2XLLA 3RZCB 1QSFB 2YGPA 4GRMB 3F7YA 1CD1A 3LNEA 2NXZB 2V5TA 1TJMA 1S9YB 2KZ1B 4KI1A 4TNEA 3FSWA 2BINA 4I9WD 1E28B 4H2CA 2ZWYA 3I6KA 1A1MA 5EFIA 3EDKA 3L5WA 1BXUA 4R7DA 3RWDA 4ABQA 5EUOA 4NKQB 1N5YH 3EBIA 5KVFH 1VIWA 1QSVA 1WUNT 1E0OB 3PS6A 5IVZB 1O0VA 1HE7A 3KYOB 3WDHA 3RFZA 4NQTA 4AMKH 3W0WA 1B0WA 4FXGA 3ZUNC 4R97B 1CF1A 3EH1A 1CLCA 4CGTA 1BZQK 3BZ4B 3EJZD 4YBQC 4PRAB 3U6RB 5J12B 1H3XA 1N0LB 4AQAA 4MA7H 3B1TA 4NUPA 5ACZA 3C5SB 1IC4H 3QAZC 1Z32X 1S3RA 2ZSVA 5B8CC 5HDBE 3MRCB 5GS0D 4YGVA 5C0AD 4AV0A 5LBGA 2V5SA 3MYZA 3T4AA 2J7LA 3EOYG 3LRMA 4YN3A 1BMGA 4P5KB 2A0LD 1ETJA 3M1CA 4GAGL 3PU7A 1RZKL 1AY1H 1ZA3A 3BUIA 3KCPA 1B90A 1KCVL 1HHGB 4QRPD 5CGYC 4CVZA 2R1WB 3LS5L 4G43A 5D1QE 2WKOF 2KT6A 4YSSA 4Q9RH 2HT2D 4M7KL 2OMYA 1UCBH 1JV5B 4MS8D 5D7EA 3GJFA 1UZ6E 3HG0A 3DGCR 3TZVA 3UDWA 1FE8L 5F6HJ 3BUTA 4UQAA 1CDIA 3B5HA 1LWRA 3O6KH 1FFNB 5PAZA 3ISYA 3KWWB 5FGSA 2EDDA 4K3JH 2Q20A 1MUJA 4AIEA 2OPCA 2LFGA 3QXVA 3TONA 3H7BA 5IF0B 4YDZA 2VXVL 4WW2A 3V52H 1HEJC 3ILDA 2J25A 2LAGB 1B4TA 2NLJA 5I15H 1UH4A 3NA9L 4EQ3A 4E5XA 4NQCE 1JSYA 3VD3A 3ZO9A 1G9ML 1RK0B 2GITA 2WLLB 1AI1L 4UMGA 3B8YA 3Q3GB 5T3ZE 3C60A 5BJTA 2BX5A 5SWZA 1NIBA 4LGRB 4UTCA 4BE6A 1UB5A 3AITA 3QFDB 2Q8BL 2Q8AH 5D55A 4WI6A 1HXMA 2HJKA 4JO3H 1MRFL 5CJ5A 1GVIA 1MCOL 2CU9A 1A6VL 3UZQB 4HUVB 1L3NA 4OZFG 4YHNB 2GKIA 4AYDC 2FO4B 4R90H 1ZDSA 2X05A 5LWYH 3W3BA 3MRFA 1I1AA 2J73A 3B9KB 2BSSB 5JPMC 5I66A 2IIJA 4D0BA 4UT7H 1VHPA 1AQKL 2EZ0D 4GLRI 2AQQA 3FOMA 4FYSA 1QLRB 3EDDA 1DVQA 3IJEA 5EU4B 2IGTA 3VFUA 4AVIA 1B9KA 5CD3B 2QZQA 2NYKA 2X0UA 2I7SA 5CR1A 1RMFL 4NO3B 2PR4L 3D07A 4HJGA 2Q76A 2VIRA 2YRBA 3VRIA 3HB3B 4OD3H 1XF2B 3GXMA 4DGUA 4EBQL 4JFYA 3TBYB 3CPLB 4ZX6A 4ILDA 4HAFA 1Y07A 4YDIL 4HPYH 1UOWA 4PSRA 1XSKA 2HJLB 3K6DA 4W6YB 4RAHA 3ZE1B 2IALA 5FCUH 5D5MA 2GTZA 4Z95L 4OJEH 3D34A 3SKNA 5DJXB 4A1RA 1NCBH 4Y4FC 5E08H 2BS9A 3LIZH 3II1A 1EHLH 3CIAA 2DBLH 2F1BA 1TTBA 3QORC 5B38G 2Z9TA 4JM0A 2WBXA 3ALWA 4TRPL 2DEWX 4ZG1A 2QQLH 5I9QB 1R24A 2R2CA 1N12A 1NL0H 4A39A 4ZFOL 3RL2A 3BKCL 1HSAB 3FT2A 3LTVA 3BAEH 3S97C 3HLAA 3QB7C 1IAMA 1HH9B 3SE8H 3OF6A 2BS71 4DVBA 2VDKH 4ATWA 1TVDA 1IM3B 2VDQB 5I8OH 4QNPE 1JGDB 2RBLA 3MNZB 5FCSH 5B1KA 5ABAA 1EHNA 4MMZB 4MZ3A 4H5SA 4DEPC 2NZIA 5AYQA 2VRKA 1Z3GH 5B1AB 4KMTL 5JPNB 4Q97A 3ZQ9A 4BIKA 2CO6B 1L9PA 2CDEA 1OB1B 2HUHA 4QRUB 3ZTEA 3TFKD 4CU7A 4TUKL 5KSBB 3ETBJ 4IEFA 1KIQB 2WQAA 2AEQL 1SY6L 3WFDL 1R3HB 1ZV9A 2Q87A 1ZOXA 5F3FA 4GI6A 4F7CB 4E9RA 3HHSA 3MBXL 4MMYA 3BPCB 3E1ZA 1F11A 3B7YA 2ADFH 4A7TA 3L48A 5B1CA 5HHPA 1BZ7B 2AFNA 4LVHC 4NPJA 4A6YL 1SLWA 1Z9PA 4YHKH 5E94A 3DJRA 1HHKB 3QIWD 5KZCB 2N59A 1G7MB 4GG6E 1QW9A 4GXUN 4Y5VC 5IROA 4XXDB 3ZYJA 1GY1A 3QCTH 5I6NA 5C08A 3LKPB 2JIXB 1L7TL 3MNWB 3BUDA 3OG6B 5DMGD 5KG9A 3LEVH 5AVQB 4HOZA 3O6ML 3BZDA 4DP1X 4QXUL 3GJFK 3FSZA 3LN9A 4JDEB 1DEDA 3TNMB 3ES6B 4F33B 2VAJA 1IAOA 1IC0A 1TZOA 3MRMB 4OLYH 1AO7E 2G60L 1JF1B 3BAJA 3QQDA 3UEQA 1F18A 3V0WH 1BMZA 3U9WA 3REVB 1ACZA 3G5ZB 1D5BA 1KCSH 4CDGC 1MHEA 3SOBH 1S9XB 4XMUA 5JHDD 2QT6A 1P5UC 2EINB 3HMXH 4M5SA 1WZMA 2AABH 2FEEL 4GQ9L 3ZKXC 3O81A 2Q86B 3L6FB 1LLAA 3VXPB 3ARYA 4OFYD 3JYBA 1XGTB 2X2JA 1ET8A 4Z7NF 4YFEA 4LEXH 4ZMQA 3QXAB 3V0JA 2B1AH 1MJUL 3VI4A 1EVTC 3QR0A 4LVOB 2Q6WA 1WEJH 3OHXA 3PHOA 4P9MH 4N5UA 1T0MB 2VXQH 3IPFA 1U6AH 1AGEA 2VR3A 3FO0L 2CALA 4URTB 3V6BR 1QRNB 3CZLA 2LE9A 2QSVA 1T1ZA 4XGZB 3SDCA 3FPXA 3P77B 1EEUA 4A7VA 1AP2A 2VE6A 4C56B 3HCVB 4HPHA 3Q6GL 3QJZA 4ANKA 1I7UA 1NGQL 4OF0A 1TKWA 2IWFA 1IFHL 2HH0H 4R8WH 4G59C 4JPIA 1I4FB 3BPLC 1H6EA 4XBEH 4JQVC 2HRHA 2MRYA 1O75A 3ARXA 3HNVL 3QAQA 3ECBA 2B20A 3SCMB 4NENB 1MRDH 3FQNB 3ECUA 5HYSA 5IB1B 3QUXA 2WUCL 1EEYB 5KYWB 4IJTA 4UZGA 3FT0A 2BIOA 4P4RA 3T0EE 1GSKA 3ABKB 2N4IA 3PWUB 4AXWA 5I6PA 3GXPA 3QVAA 2Y7OA 5T3XH 2PYED 2WBJD 4FQIH 5DJAB 4DK3A 5C0DB 5HDBF 4FHBD 2E74C 3V6OE 3QJRB 3DSNB 3H42L 5TK2A 1I8MB 4LZKA 5IVOA 1DQMH 4NZTL 4H8UA 2IEPA 1OALA 1OAQH 2BNQE 3PP3H 4IOSD 1DJSA 5TPWL 5CS7A 1GCFA 5LJYH 4JFEE 4GKZB 2G3ZA 4EJ1C 5DJ2B 3AS2A 4Y5XC 2DW5A 2XT1B 3ARPA 2MMXA 2Y07H 1J8HE 4OF7A 4MJ5A 1WBYA 1OGSA 6FABL 1ECZA 4F9LA 1C08B 2D7OA 1UZ6F 1M2VA 4DAGH 3FU6A 3Q8BA 3RHWK 4BK8A 1ZLVK 4NSKB 3VFGL 4MRBA 4FNUA 5T8IA 2WCSA 5DRWA 3ZQXA 4NUJB 4KAQL 2XQYA 4X4XA 5FR3A 5AOKA 3CH1B 1V7MH 2RQ8A 3HHMA 3IU4L 4P23A 3KYMA 4HWEH 3MUUA 2DD8H 3PFUA 2DQJL 1Y0LB 2YRLA 3QNXB 1KJ3L 3IDJA 3MROB 1ZV2A 2ILLA 5F9JA 3IDMA 3I02A 4GO8A 1UT2A 4K73A 1T6BX 4WU7B 1NBYA 2IAMB 4G7SB 4DZ8B 4YS4A 3S9DB 3IGLA 3L4XA 4HUKB 1TO4A 1WIUA 1JZ8A 4PRNA 3B3IB 5HDWA 1OOWA 2BLFA 3GMOA 4M4RB 5SWSD 3KE0A 4GMTH 3P11H 4KO9A 3C8KB 4M6MH 4FXKA 3LKNA 4CN1A 3NCJL 2KZKA 2GJZA 2VN3A 4KWUA 4WEUD 1DR9A 3WLBB 1QVOA 3MRIB 3O4LA 4G7VL 4NO0A 4F91B 4LHUD 4H88L 4XH2A 1LEIB 3OKYA 3L1OH 4U1SA 5DJZB 5ANMB 2VR6A 3K6FA 3RTQA 3V5DA 4OD2B 3BVXA 1IFRA 3LKQA 4IRSD 1JUFA 5E99L 4YXLL 1JD9A 4HUCA 2UXGA 3BVUA 1OGAA 3GO1L 4U2YA 2B5IB 2DQDL 3VXME 2XICA 4KJQD 5F1IB 3TBCA 4EI5D 2VDQL 4ZMOA 3EGXB 3VD2A 2ZJSL 3UJIH 4J6IA 1SLVA 4UM9D 3ALPA 4J4PA 4DW2L 4UQDA 5HBBA 1AR1B 2DWXA 3PWPE 2BOCA 3F12A 4KC3B 5AAMA 3W11C 3QJXA 4KH9A 4ONFL 4BQ8A 4Z7VE 4EIGB 5FB8A 2NNCA 1U3HA 4WWNA 4B9PA 2MCPL 4OZIA 4X4YB 5DHXB 1BCIA 1TQUA 3OAYK 5ICXA 5EO1A 1CDHA 4X99B 1T0PB 2B4CC 1DE4A 3ARRA 3QARA 4DKTA 3AG2B 2GBAA 3VH8A 5E8PA 2X28A 4OBRA 3MOBL 3RE0A 2AJXL 1S7SB 3ZDZB 5DVPA 3P9WB 2PETA 1T7YA 4BK4A 4KTYA 4LVNB 1SEBB 4GFXA 2RCSH 5FYLL 3CVIL 2WXIA 4ZJ9A 4QNPF 1UCTA 1YYMH 1HXKA 1F97A 2NY3D 1OAXH 1CTOA 5K9KA 4Y4KC 5EEWA 1I8IB 3GXIA 2V37A 4PJ9B 3B43A 3VD9A 4X6CB 3JV6A 4RWYH 1XCTA 4ZS6C 4RGOH 2X89A 1CYWA 2ENSA 3QCUH 2BIQA 4AJ0A 3QUML 1S7QA 5HP5A 4YX2L 2GB2A 2LHAA 3WGVB 3QZWG 3SE9H 4KKZA 1QMUA 1BVLA 1RIVH 3FRPA 1J0JA 1KV7A 5GRUH 5K9OA 1DO6A 3G6AB 1BAFL 1THCA 3V6ZA 5T5NF 4ZTPL 5CN2A 1NCCL 3VYNA 3PGCB 1JPSL 2IANE 2J2ZA 4YHML 2B14A 4GMSL 5FW6A 5BRZE 2WGNB 4JFWA 5EEYA 2R1XB 5EU6B 2HLEB 4FGMA 3P4NA 4UTAH 2DN7A 5CIPB 4P57A 3FBKA 5ESVB 2UY7B 4HKZA 5KYUA 2RH0A 4H0IA 4GG6F 4N90E 3OM3B 1HKLL 1Y6KR 2E7DA 3DV6B 4ZMZA 2OTUA 4C4KT 2ODHA 4KRLB 1QLFA 4IS6B 2EVHA 4PBDA 2YQ3A 2V2XA 3IMUA 4AW7A 3VRJA 2Z4QA 3GJEA 4NM4H 3NCMA 2Z91B 3GHEH 2XV3A 1EVUA 5BQDA 4JO2L 2AI0H 3IKKA 1NZRA 4F7MB 5E6YA 3CN1A 3DVNA 5I75B 2H4EA 1IIIA 3DXAD 1CU4H 3DIVA 2XQYK 4ZPVB 3FMGH 3I9AA 4RA3A 4XP4H 4YQXH 1IBFA 3P2TA 4RMSA 5J1AA 1E42A 2NW3A 3B2XA 4P2OA 3GSUB 4MASA 2D7MA 4U6YB 3US9A 3QDGD 2MCMA 3P69A 4QMEA 4N2MA 3RAJL 4UBDD 1VESA 2X9YA 1W0WA 1TQCC 1DFXA 3P30L 3SDDB 4A2GA 3Q43A 3AROA 4G6AC 1AMXA 3IK2A 1F4YL 1N59A 4MLSA 5HSFA 2WJ7A 4JFZL 2BIIA 3KJ6L 2PYFA 3LZQA 5F70A 5EC1A 4MJ6A 2X4PB 4PRID 3VDCA 1ZANH 5CGTA 1SDDA 1QA9A 2H9GB 1FH5L 4WEBL 3WS3A 1OAUH 5MEOB 4L4TA 1CLZL 2FX8H 4AGOA 1P7QB 4I1PA 4OIFA 4ZUWB 3ZTJH 1KFGA 2X4RA 2OMNA 5ACLA 2Y9RT 2JELL 3HFFA 1GR7A 2ZX7A 1E4WL 2DIBA 1B9ZA 4ZUTA 2YZ1A 5T5FH 4Q4EA 2UV3A 1XGZA 4P5TC 3OC5A 4F3FA 1YEHL 4KHTL 1BD2B 4PJDE 5F9AC 1MLBA 3ASNB 4I8DA 4NQDD 5ILTH 2DIJA 4QGTA 1T3FA 5HGHA 5GRVK 3LH8A 1ZK5A 3M17B 3QEQB 1WD9A 4XMLL 5GRVL 2OL3A 4OTXH 1H15A 5HVHC 1E5UI 2DM4A 4JKMA 2EXYD 5D7IA 1R3KB 5TE7L 1GKOA 2H1XA 1JYWA 3HUJA 2Z92A 4APQC 5LNDA 1T21B 4ZAKC 5K39A 5IFHH 3WEBA 1CR9L 2ZE0A 3AABA 3IJYB 1VERA 3KPRD 3NIDE 1OTSC 1MREH 1K6QH 4HK3N 2WCGA 2BOBB 1RZIB 2NQ3A 3IMWA 3MUHL 4NT6A 4FJ6A 4ZFQA 1MI5D 1FAIL 1S9VA 3RLSA 4YSRA 3EYUL 1YNLL 2Y69B 1U93A 3CFUA 3S3BB 3X12A 2P5WB 4OCWH 3GMPB 4PW4A 4YBQD 5HYEA 3CC1A 5KVEE 5C92A 5H37A 4V1DD 3IEAA 1B4LA 4LLWA 1R3IL 1IRAY 4Y2DA 2B9AA 1SHWA 4PJFE 4LE8A 1HJCA 3CLWA 3HG1B 3CZKA 3ULUE 2FX9H 1BJ8A 1S3KL 1C16B 1NJ9A 4JZJC 5D1ZA 4KPHL 1GOFA 1MQKL 1P9MC 3T77A 1VEOA 4AM0A 5IEKB 4N0CC 3Q6FB 2OXHB 3PPSA 4X0NA 1SUHA 3U36B 4N2BA 4JG0H 1XF5B 3UYPA 5JQ6H 5GJSL 4WNQB 1VFOA 2E5EA 4Z3EA 2HWZH 2NY0C 4XX1G 3VMOA 1YDPB 1F4XL 4WNSA 5FYKU 1SJXA 4P46C 3PV7A 5C86A 3WG7B 3ETBF 3QO1A 3VWJC 3UFIA 3AS1A 3SEPA 1RU9L 4JJ5B 3HN8A 5HGGS 3I9IA 3T0EC 4WTWA 1NEZB 1XTMA 4H8PA 4IDLA 5I71C 5I2IA 1L6PA 1C5BL 2Y7LA 2B1HL 3KPPA 2VLKD 1KN2H 4ZUVA 5SX5H 3RJOA 2C4FU 3U2JA 3OAZH 2IF7A 4QRRA 3OXRA 4F2MB 4ISVA 4RFNC 4BJLA 4ONHA 2VLRB 1AACA 5F7YC 1E3ZA 3MPCA 4HLJA 4K7FA 4BDVB 4KROD 4NYLB 2B15A 1RZQA 4Y8AA 1UXSA 4NQEB 5LXGL 1HX0A 1KBGL 3REWA 5ESQB 4KTEL 5HVFB 4C58B 4LQFH 1W8NA 4TVPH 4GW4A 4AV4A 3ME0B 3IDXH 3A4DA 1JNHA 2CCVA 4ETYA 1M57B 1CICD 1X9UA 1CI3M 1XWVA 2HG0A 3F83A 4MB5A 4WLCA 1GGYA 1IGCL 1HI6A 3TGXA 5E1IA 4Y9FA 5KVGE 4OGXL 3IRZA 4IKJA 2N7BA 1N67A 3A24A 5EPMB 4HKJB 1TZAA 1JV2B 2CO2A 1KIPB 4PHZA 2IFGA 4QGYA 5D1XE 2P8PA 3RWHB 4ELKA 5KYYB 2F7QA 4WF7A 3ARWA 3I6LD 5J6HB 1ASOA 4GRLC 2ZAHA 1XVSA 4Z7VF 3D2UD 4KQ0A 2WLKA 2XDHA 4RMTA 1CD0A 3FYEB 3QJHB 4TVUA 4BYHA 5KSAC 3X1NA 1IFGA 4MKTA 3TYGH 2TSAA 3BKMH 4JR9H 4PJ7E 4FZEH 5I1EL 4K9JA 4JFDB 5C2BL 2ZUUA 4AYBA 3U2IA 5C0CA 1E9PA 4Y1AD 5JW4N 4WJKB 3DX7B 1X5LA 3LJ3A 3O8XC 4IDJH 1H5BB 4S2SB 4Y4FD 4Q9QH 3EADA 1Z3RA 4PJ8C 4R83A 1HQRB 2D7TH 3K4ZA 3NRPA 1MXGA 4NUMA 3V6FB 4L8CB 3DRTB 4LPVA 4FG6D 2WSDA 2ZCLL 5A6MA 3E6HA 1L9TA 4HHAA 4IIQA 4BH7A 1MLCA 3T6VA 1RK7A 4LARL 5D7HA 4JRYE 1J5OH 4PP1D 1P4LB 1HH6A 2LU5A 5CAYB 1BEXA 4D9RD 3B83A 3II2A 5K9JH 1U8HB 2EE0A 1ID5I 3UTTE 2JXMB 2P24B 4WWID 2A73A 2XFXA 1LMIA 2ZKYA 3BZFB 3K74B 4U1JB 1KUMA 1OPGH 5L8JB 4QUOA 5I6XC 1AKJD 1Y18B 3SE4A 1V3MA 3EHBD 4O02A 1ROCA 3SKJL 2R15A 4XRCB 2VZOA 3VQLA 3WY2A 4F5CA 2AV1B 4H20H 4HKXA 2JCCB 1BWMA 4OLUL 2VWEE 1N6UA 2PO6D 5JHLL 4QRAA 3UABA 4LBEB 3O9WB 4O2FA 1BMWA 2GHZA 5I16A 4HETA 3U0WH 1AZNA 3C2AH 1ICTA 1HL5A 4M48H 5C09E 3JWOH 5ICYA 3FU7A 3UTOA 3FQTA 2E9IA 1ZT4B 3P3UA 1YMMB 3GBML 3EO0B 4ZXBA 2G9KA 5EOTA 1T2QH 4NCC2 3RL1A 4U3SB 3L1FA 3UG5A 4PHXA 2HMID 2BSRB 3CBKB 3LKSB 5EOCH 2ENPA 1NGZA 1OHZA 1R34A 5EA0L 3VXSE 5KTEL 4QXTA 3WXWH 1F8TH 1OCRB 2KMWA 2XN9D 3MLUH 1VPOH 5H94B 5JOFA 4FF9A 4PRBB 2WZAA 1GZPB 4N25A 2JH2A 2GJ6A 2I9LB 1K3IA 4LEOA 4EZMA 3B6SA 3TO4D 2H2SD 3BKYL 5TQ0L 1W9XA 1SMOA 2G3XA 1FL6B 2AJ3B 2VM4A 4MNQB 2EDNA 1G5GA 2FJHB 2AQ3A 2F7IA 2FSDA 1TUPA 1G4RA 3EG9B 5D2NA 1XGRB 4J8RA 1KENL 3JV4B 2C1OB 5J11C 5DD3L 3ZJAA 4LSDA 3MVSA 4S1SL 3CCHB 2IQ9H 2WUBL 2I07B 2AVFA 2BWIA 5C0FB 1T1WA 2WXHA 3FHAA 4KO6A 4X83A 3SGKA 1D5MB 3OKMA 4O4YL 4PJDF 1R5VA 5KOVC 5EOQH 2IDSA 2X4NA 3NH7L 4X80H 3TV8A 5C07E 3S88L 3HBGA 2Y7SA 4F24A 3SYAA 2Y0SA 3QDMA 4KK9D 5FHBH 5I1IH 2GIYA 5C8JA 2YRZA 2YJLA 3EYSH 4FN0A 1MHHA 2IGFH 1PIGA 1H3GA 4N2NA 1SMAA 2ZAIA 1K5WA 1YEGH 1VSCA 3C6LC 3GJFH 4ZX5A 1T4WA 1LK3H 3MFGB 3B2PA 3GKWH 2ZCKH 5EZLB 1A4KA 1JDAA 2ZX6A 2CIIB 4TSAL 1QHOA 2XN1A 1FG9C 3ESPA 4PJ6A 3TU6A 5CLYA 5T3ZH 5D6DC 3UBHA 3NIDF 4GKOA 3DX6A 1QR1B 4PD4J 5MI0B 1OHQA 2PR9A 2WWKT 3A6BH 1UGKA 1YEDA 5DT1H 2QADD 3IDNA 2AV7A 1WLHA 2H0JA 3X11B 4EDXB 1N7MH 1HILA 3ARBA 5MERA 3MO1A 2HT4C 2ED7A 5GS1A 1NANI 3VWKC 1RZGB 1QX1A 3PABB 3G04A 2O5ZH 4WI7A 1VEPA 5C0AB 3WEMA 3G5VA 4WUUD 5C0BA 4IRZA 4PJFF 1EZSA 3BVVA 3C75A 1J1OL 1JZDC 3ULUF 3OMIB 2F19L 4UDUB 2WYTA 4QRPB 4FA8A 1VCBC 1NFIB 1HXYB 3MRKB 5E23A 3PDOA 4WCYH 4IGBC 3SY6A 3WJMB 2D7QA 4FQCH 1SOXA 1UEMA 4E5XG 1ZEAL 4QHKJ 4HC1L 1GGCL 3QIBA 1OAYL 2NCEA 3DMMA 3H7LA 4PRPA 1PD0A 3QO0A 2VLJE 3SPGA 4I87A 1REIA 3T3PB 2JB5L 1VJSA 2HRLA 2CDFA 3UC2A 2V8MA 3L3OC 1QYGH 1NC4A 2OJ1A 4OZGA 2OMVA 1TTGA 2J6EL 4G1EA 2Q3AA 3WMPA 1FVEB 3MLSH 4K9EH 2EDLA 4FQJH 4OF8A 3FFCD 2YPLD 1OVZA 4GJTB 3SYCA 3CFIC 5FK9B 1UB6A 4WO0A 2EVIA 5DD6A 1PX4A 2E4TA 1NC2B 2ORBL 5FYJE 5E5LA 4OQTA 1BF5A 3S3CB 1P0SE 5FGBC 3BVDB 4Y8DC 2E6PA 2GHWB 2XRAH 3RA7H 5J13B 1OP3H 1BBJB 3ROLB 4CMHC 2E75C 1OSPL 1L7IL 4UTBA 2WLZA 3ULVE 1I7TB 3FQUA 2AK1H 3MJWA 1L0PA 3F2LA 3B9VA 5CBAB 1FCCA 4OLEA 1H6TA 1KNOA 3E6FB 5TDPB 2YAQA 1J12A 4ORGB 1CFBA 3AQZA 4OJYA 2J1XA 3VD1A 2R29H 2BH0A 1IGFH 3ULUC 1PQZB 4UZUA 4ZO9A 2VM9A 2XKSA 1LNUA 5L2JB 2H1LM 2C3VB 4LU5L 1RCYA 4N0FB 1CXKA 1OQOA 1XR8B 2ERJB 4GS7B 3S37L 3QZNA 1F41A 1FYHB 1M6OA 3MKKA 1X5KA 2XTJE 3QEHA 4MCYA 5ADOL 1YEKH 3SJVE 1WH0A 2BNRE 2YUZA 3BFQG 4JPKH 4XP1L 5HHOA 3QDJA 3FTWA 4PJ7F 2BVTA 2IPTH 1UJ3C 1KMGA 4I1RA 4U6HA 3QSKB 4B9FA 4DJMA 3L95A 1AHWA 4PJ5D 1YNTB 2KZBA 2CK0H 4I18C 3A6CL 3VDBA 1A6AA 2HTLD 3WMQA 3WN5B 4E9QA 5HD8D 2GSIB 4LK4A 3K8KA 3WFHB 2H3NA 1SYVA 1Z66A 5AZEL 2WNGA 3ZE2B 3NSYA 2VT0A 2WQ8A 4IU3B 4E41D 1IC5H 4OB5H 1JOIA 3AG3B 2RJMA 5AKSA 5T5NG 5HYJE 3OLGA 1VADB 2NUPB 2XA3A 4H1LB 4PJHB 4RETB 5E00A 3S36H 2HTKC 3FCTB 3ZDYB 4LCWE 5JORA 4OGYL 1W91A 2AW2A 1XR9B 2R9HD 4Z77B 4PV9B 3MBEC 2XYCA 1MZYA 3MCKA 4KBPA 5CMAA 1IZKA 2VZ3A 2WAHA 4JFXB 5FHAH 2VISB 1UWGH 1BQSA 4YDJA 3WIIH 1FNEB 2QLYA 4V11A 4L3EA 1KFAL 2WLYA 1T5XA 3ECWA 4HOXA 3I9GH 1VEMA 3QEUA 2FB4H 1T83A 5EBLB 2KUTA 4TOYH 1XFPA 4JM4L 2AJSL 1ZLSH 5EV7A 5D1XC 4DFHA 4EEEA 3GNMH 3UTZA 3RGVD 1LEKB 3BX7C 2UXVA 4YHYB 2NW2B 4FNTA 4ODSH 3TN0D 1YN6A 4PGCB 1WS7A 3BP4B 3NABH 2XG4A 5A1AA 3UBXI 4HIJB 1U4FA 1WFOA 4FQXB 1ESOA 5D2LE 2WN2A 3UO1L 2VXTH 2L04A 1TF4A 1RLWA 4MA8H 4PJAE 4XC1H 1CGTA 4TXVB 4PJGB 3DPBB 3QIWB 5F6HI 2C1PB 1TZGH 4IMKC 4DP4X 1AJ7H 2FTAA 4OSUL 5GHWL 3BH9B 4K94H 2CRMA 1TVHA 2P8LA 2WM0A 1ORSB 4NZRL 4JANB 5HVWA 1DVTA 4N2EA 4HWZA 2XN2A 1HEHC 2JSFA 3UZVB 1UKTA 5DS2A 1VKXB 5KBDA 4FLRA 2ZKXA 3OR6B 1FN4B 4XPGH 3OZKA 4Y5YB 3ZHKA 5JHDB 1JJUA 2FATL 1WICA 3B9AA 1J0HA 1DO5A 3MOAH 1HINL 1S7WA 1CN4A 1MG3C 2R0KH 2ZP9A 4TLUA 3U7YH 4TUJA 5KJRH 4MMXB 2EDXA 2QGEA 4PR5B 1JGVH 2QMKA 5CCGE 4KI5E 3FH5A 3NSJA 2YOCA 3MZGB 4J3BA 3BMWA 1FQ9C 1RHHA 5H35A 5F96L 1M71A 2FGWH 2RHEA 2DLFH 3I50H 3GGWB 4AK1A 5F9OH 2R1YB 4ZSOE 4J27A 1K72A 1JWSA 1Q94B 2VWEC 5CWSB 4F27A 4ENZA 3BISA 3BJ91 3FT4B 1DZ0A 1PCSA 4LCIH 4CL7A 4I9XA 3CFTA 1KPVB 5GS0L 4FYRA 1TEYA 4XO8A 4Q0XL 3ZMNA 4XCNB 5HYSG 1XHHA 3L54A 4RZCA 2D31A 1J9CT 4LNRA 5I1LA 3DX2A 4APXB 3BVTA 4N1HB 4FFYA 4DT2A 1AIFA 1L6XA 1RFDL 1U33A 2PXYD 3VDAA 4P99A 4K8RC 3LX9A 5IM7A 2PTTA 1HHIA 5HI5D 2D8KA 4PRDA 1E3XA 2I60H 1FFPB 4FZ8H 5IOPA 1A4CA 4Q2ZB 2DKSA 2QSCL 4DSYA 4NGHL 4X4ME 3LNHA 4AQ1B 1WBXB 3VXRD 3U79A 3O11A 2H3XC 5IWLA 4CDHA 1ZAGA 2X7LB 3HIZA 1MCLA 2OSYA 5CLXA 4P04A 2GTWA 3KL0A 3MYJB 3DX9B 1IKFL 1MJ7L 2DQEH 4Q4IA 4MQ7A 1XDYA 3G6JA 1G9NL 2OZ4A 4WO4B 2MKWA 2NNRA 4WK0B 5D7KE 5AAPA 1B0GA 5K5YA 1NGYA 2PCPA 1CBVH 4JMXA 1R5IB 4JY4B 5H4ZA 5IVXB 3PPEA 1O9WA 1CJYA 1NBZB 1NICA 2GG1A 1DQKA 1FJ1B 1T20A 3ESUF 4WHYG 2P42B 2OX5A 5F3BB 1WA1X 1UZGA 2WXOA 1KB5H 4YSAA 5EHFA 5DURD 43CAB 1TJGL 5G5DB 2AK4D 4AYEC 1UVQB 2ZF9A 4H0HB 3F62A 4FLHA 1BM3H 1A3RL 1LQBC 4HF5H 5F7WC 1YN7B 2Y5QA 4L2LA 3VJ6A 4XN2A 4ZS7H 5LBSH 5JOPD 3U6XS 4MJ2A 3O3EA 1M7DB 4O9HL 5EBWB 4CKQA 5JHAA 2CBQA 3IPEA 3GC3A 4I48B 1EIBA 4MZRA 3P0YL 3O0RH 4NKMB 3BDYL 3O6FC 3WFBL 3K71B 4PW3A 1ZHBB 3P3RA 4Z3IA 3PAVA 3N2JA 5T1DL 5I17B 3U0TB 2C7UA 2B77A 2CG9X 2WKGA 4P5MA 5I1DA 3GSQB 2WBKA 2Z93A 2A77H 2FLMA 4NQVA 5AVXB 2A74C 3X3GH 1E4JA 4RFEA 2PYEA 2WBJA 3HZMB 2Y72A 3V0DA 3ZDXB 4PS8A 1LYQA 3JTTB 3MRNA 1KPRB 3F05A 4LSVL 2OMZB 4PWIA 5JUEL 2H2PC 4EN3C 3ULVF 3DX1A 4KY1L 1QNZH 1I9JH 4TPRH 1TLMA 4HK0A 2IBZX 1LE9B 1MELA 4LHUB 2C26A 5FKAA 4JNXA 1EJ8A 3LXUX 3I3EA 1XGQA 4Z7QB 1L5GA 4OFDA 1B6DA 2CKBB 4HEPA 4HJIA 1ZWIB 4OCSL 4GBXA 3T0XA 4BFFA 1KTBA 3MV7B 2H8PA 3WXVH 2BY0A 3V0HA 4G9FE 4IRSB 5DD5H 5HTSA 1RXLA 4WSGA 4Z7OE 4OZ4A 2R0LL 3QUZA 1LO5A 2AJZB 2RFXB 1MNNA 4JG5A 4EI5B 1NKGA 2YD0A 4GP5B 4G82A 3T6XA 1QFUH 4HMCA 5KYXA 1IAIM 4L23A 4UM9B 5ISZD 4LLYA 1G7IA 4JKLA 2X3CA 2FNWA 1UQSB 2ODIA 2X4UB 1H8LA 4NO5A 4QOKD 5E2TH 2XZAH 2XV6B 4TNWF 2F18A 5ID1B 2CDGA 1KYUA 2NQDA 1A6WL 2G2RB 3HFML 4BZ1H 4QAWA 4JQIL 1SQMA 5CJBA 1DQIA 2D0FA 3BP6A 1W2KT 3GSWB 4HV8B 2W0FB 3ZKND 3X14B 2A9AA 5AWNH 1KT2A 1MY5A 3B37A 3KEDA 4GB9A 5E8DL 1IM9B 3WENA 5SWSA 1OSYA 4AUYA 1S7RB 4X6EB 2V9TA 1QSFE 3R19A 4NKIH 4JN1L 2ZUYA 2EDKA 3DHUA 4IBLT 3FRPG 5GGRY 4YSTA 1L9OA 3ULVC 1D9KD 5B3JE 3LYRA 5JZ7D 3U6RA 3WS6A 2I24N 3UPCA 3KMDA 3SPVA 1M05B 5CBEB 1H0DA 2X70B 1ZSDB 2Q7AA 4J8QA 3MRCA 2F9BT 4E0RB 5B1BB 1MVYA 3FF7A 1NGWB 3EIFA 4HW6A 4FFZA 4GKNA 3U83A 4ZW6A 3PUUA 2WXNA 3LS4L 1ACXA 1Q0YL 1AGCB 1F90L 3KHQA 4RNRB 3V9CA 1RUQH 1O7VA 5B39A 1TZHA 1JRHH 3TF7C 3EYQC 2CLRA 2XX0A 4R96A 1HHGA 3QWNA 1U8JA 4ERSH 3GEFA 1N26A 2IDQA 2XTJC 3BFOA 2DIEA 3CFEB 3DURB 3NJVA 5D2LF 4AGLA 3CC5B 4PJEB 4TLKA 1LE5B 5EU5A 1P1VA 4AZ8A 2OZ4L 1AD9A 3PY9A 1IGYB 2JJSA 2J1ZA 4PJAF 3VX1A 5MEND 2DQCH 2VDOB 2RR3A 3OB0H 4BKLA 1WAAA 5KAQF 1DJYA 4UYPA 5B7EA 1AZZC 1SN2A 3WSQL 2XTLA 4HJJL 1V7NH 4PGEB 1DVFB 2W0LA 4NKOA 1U8KB 4Y4HD 3ZIMA 4F7PB 1NDGA 5LQBL 4FRWA 2VXUH 1A4JB 1KGYE 2K8MA 1BX2B 3EDJA 4XNZC 2Y2WA 2WLLA 3TBSA 3C9NA 5DZ9A 1DSWA 2J5WA 4NJAL 4FI6A 1OL0A 2X4QA 4ZMLA 3QZOA 2MOQA 1Z9MA 3IXAA 5BO1L 2X6UA 1GY2A 4QCIB 5IESH 2TSBA 1INEL 1IILE 2HN7A 3I75B 1IV8A 1NLBL 1FHGA 3KXFB 3QFDA 4CC4C 3QDGB 4QWWC 2BZ7A 4GT0A 3R06B 4N8VB 3AU1A 5GZOD 2YA0A 5F3HB 1GAFH 3D33A 5JXAH 1KLGA 1OZUA 3PL6D 1GCYA 4JHZA 2VXSL 3O2DH 4KI5F 3KPLA 2CJUH 2B08A 2GUYA 3T8XA 2O5YH 5AW7B 2N01B 4XVSH 3HAEH 5EU4A 4ODWA 4PRIB 3CDZA 5KVEH 1LD9B 2KPWA 5CD3A 4JJOA 4XP5L 4B7LA 3VFTA 1K5NB 1YYLL 2YBRB 1TQBC 1YPZE 5DO2D 3IGKA 3LVEA 3U4EB 4Y9CA 1XF2A 3U1SL 1NPJA 4FJZA 4OCXH 3TBYA 3EO1B 3PWJB 2Q7YA 1ZLUK 2VDRH 3HI6H 2ZX9A 4YNYB 4JRXE 4FKEA 5TD4A 1U3ZA 1KOAA 1TU2B 3FB8B 3AWEA 2MPVA 5HJ3B 4YLBA 3EYFA 1TITA 3OV6A 5K1JA 3LHPL 3SBRA 1EA9C 2NSXA 1NDMB 1I85A 5HJDA 1CI5A 3ZHNA 1T2JA 2BMKB 1RZ7H 2PTUA 2F8OA 3HZVA 3V4PA 1WIPA 3VFMB 5IW1A 4XODA 4KUCF 1T4KB 3RDTC 3DXAA 5DMIL 1UM6H 3EOBB 3EFOA 1QLEH 1DVSA 1UD8A 2QVFB 5C0RL 5CN3A 1SXCA 3ZE1E 3CSYB 4R7NA 3H9YA 3FQWB 4WVRA 1YNKH 3QHTC 5D6CB 5ITBH 3C6LD 1ZE3H 2MJWA 2Z7UA 5IBUG 5HY9B 5H37G 1RJYA 5IMMB 1I9RL 2W9DL 1TQWA 4N1CA 4DKEH 1SYSB 1JGDA 3HZYA 5DJ6A 3IE9A 2CPUA 2HP4A 3HZKB 1EGJL 1RZKC 1MI5B 4KI5C 5EU7E 4KK8C 1MF2L 5JQIB 1QEWB 4HIHB 1V3JA 4GSDL 4FADA 3FCSB 3TPUA 4M5ZH 4WWKA 2Z1PA 2CO3A 4V1DB 5EO0B 5MP6L 1PKQE 1A7RH 3VGDA 1KIQA 3ULSB 3PNRB 2DRUA 5KVGH 3MN8A 4F7CA 4KKQA 3HC4L 3MLTA 5FO7B 5C0NC 1ZVSA 3WHXA 3QXTA 3QRFM 3BPCA 3C09C 2CM6A 2VJ8A 4F2EA 2BM3A 3ZTCC 3JZ7A 1HL4A 3NSXA 2QV4A 2CKBL 5IFAH 5LGJA 1JZ2A 1FV1B 4B9JA 5I1GL 3NFNA 3FT9A 1JGEB 5KSBE 1HHKA 2EKSA 1VENA 2VABB 4Q8BA 4FQQB 1G9MC 4QAMB 3VXOA 4AM0Q 2OK0H 3WIHA 3U48A 3V4UH 5DUJA 1QATA 2J1YA 2AXWA 1I7RA 4YSQA 1WTGT 3MNWA 4KFMA 3L4YA 5AW9B 3U2SA 4JFHE 1KJVB 3CHOA 5IHZB 3TJEH 2LR4A 3MRMA 5FYLE 3OSVA 1HHHB 2AQNA 2I5YL 5CP7B 4AJWA 2EADA 3HG3A 5L6YH 4XNUH 3BEWB 3DHPA 3QQ3B 3NMEA 5IUCA 2RALA 2G0LA 4HX1A 1WFIA 4UNVA 3KPRA 3C5ZA 1MFAH 2GABA 4UUJA 5IB5A 4QJ5B 3CDYA 4G2AA 1S7UA 1JZ6A 2EDOA 2GUOA 4KROB 2P9RA 3BCFA 3L6FA 1MCDA 3FQXB 4O2EB 2V17L 3WNIA 3FUEA 2HFGH 2F53A 3N44F 1AXTL 2CHNA 4Z7OF 4R4BA 2JKLA 2RAMA 3N1GC 4G8AC 4YVNA 1M42A 1EH9A 1M56B 1X5YA 2EE3A 4I5BB 1O9ZA 4M61B 1BXAA 1I1YB 1PY4A 3N43F 2TRHA 1T0MA 4FEMA 5JPMB 2F61A 3SBWA 4IK7A 2YEQA 3QNYB 4HG4K 5G4OA 4LMQE 2VSDA 3MLXL 4JGNA 3P77A 1WITA 3D2UB 1YMHA 3MV9B 2L7JA 4QYAA 1WA0X 4Z5RB 1E9QB 4Y2NA 4UT6L 1O6TA 1GSMA 4DQAA 5IQ9B 1J10A 3GSOB 3KBPA 4YK4C 4HGWA 2C8NA 1P5VA 1UFGA 3KH4A 3N04A 4PN6A 2X1WL 3WTSA 2X44D 1U36A 1QRNE 2R2EB 1C5DA 3IDYC 2BVQB 1XZ0B 3QRBA 3L7FA 1RVFH 2BSDA 4TM9A 4C56E 2YAEA 4ZQKA 3MA9L 2VDOL 3SKMB 3UX9B 3BE1H 3NEEA 4WTXA 4Y4FB 1R33A 1E2VA 1FWXA 3GZKA 5CU9A 3MJ9A 3DK2A 4X7EC 5B3JF 3CQPA 3NACH 4N2GA 5FUZH 1SXAA 2ICWI 1DBKL 4OUOA 1ASPA 1TTUA 3KH3A 3DX3A 5L88H 4DKFH 4KQ3H 1DN2A 2DQMA 5DJAA 3EJQA 3WFCH 7CGTA 4BFOA 3GMQB 1W8OA 2A6JB 4WFFD 4MXWH 4OV5A 4X98B 2OZNA 5KJ4A 6TAAA 5J3HC 1I8MA 4G8GD 1NWPA 1GYUA 2ZOWA 4QRQA 2WXLA 4XCYB 4KFZC 2FT8A 2VW6A 5EEVA 1CICA 3CK0L 5AL8A 3TURA 25C8H 4MJIA 1CYGA 5FM8A 4WI5A 3LZOA 1AKJB 4DEPB 1UXWA 1RUPL 4JFSA 2P4AB 3EHBB 3PIQA 3SDXB 2NXYC 3M1BB 2VDLH 2WTRB 1SJEA 1X5ZA 5DEFA 4B60A 2KHAA 1KCRL 3DIFA 4S1DC 1BOGA 1BLNA 2FJFB 2H6PB 5L0QC 5I0WA 4NZUL 1WZKA 3GI9H 5I6OA 5IIEA 5IV2A 1EEQA 3HKZA 1A22B 2PO6B 1UWEH 3FU0A 2V5RA 2QFRA 2IQAA 4PREA 3G5WA 5DJ8A 5A3ID 4X5RA 3TL5A 4GYBA 5BVPH 4X5WB 2OI9B 4X7SH 4X9BA 5ITFB 3QNXA 2BNUB 2NT0A 3EFDH 1TCRB 4IMLB 4LVHB 4YBLC 3UACA 1BZ9B 3C8HA 4HPOL 1UWXH 3BWAA 4LRNH 1EJ6A 4PLJD 5E6IC 4C55A 3TZVC 3GHPA 3IF1B 4Y1AA 3MA7A 3I74A 4PTTB 1DJWA 1GC1H 4WU5B 4XPTL 5EZOL 1RPQA 3RZCC 4DZ8A 5BS0D 4U1KB 1JK8B 1DQLL 3HNTH 2NXZC 2W88A 4B9KC 4WTZA 3ZXAC 2CLZB 1MWAB 2XBZA 5E2JA 3RPIB 3AADB 4OVUA 3KGSA 4ZW7A 1X4XA 4UV4H 2H32A 5LDSA 2DMGA 3U9UB 4L8BA 4G8IB 3JWDL 3WLBA 2IMNA 3APCA 5T3XD 1TJHL 1ETZB 3K2IA 3DRQA 5AYTA 1HYSC 1LEIA 4R97C 4L3CB 1IGJB 2HLFC 2YD3A 1KYFA 2ESVE 2EH8L 4NRZB 1J9RA 5JIQA 1B4RA 3WFZA 1P5UB 5J12C 5CGMA 2P43B 2G3MA 1YPZF 2B16A 2IJ0C 3W57A 2ADGB 3Q1SH 1J18A 4WQOA 5E2WH 5F7LB 1U2HA 2W60A 1HEZB 2QHRH 3MACH 1WBZB 3VI3B 2R23B 1I1AC 1HWGB 2AQ2A 3KNBB 2R51A 3NT0A 5ANME 3UXFA 5B3SB 2ATPB 2WWOA 3FC8A 5I0DA 1C5CH 3D3VB 5BW7C 1TQSA 2XX1A 3QCVH 3CLFH 4MAYC 4W81A 2DI7A 4L4VB 1FO0H 5I1JH 3LH2H 5CJOH 4L1LA 3LB6D 4I1NB 3WTUA 1BVNP 4X4YA 2ZX8A 4FNQA 4ZW3A 3ELAT 5BZDB 4OI8A 3VGBA 3WE6B 4FMFA 3DO7B 5I73C 5FDWB 2EIKB 3L3GB 2D03H 1P69B 1P2CA 2NOYA 4K8RD 4HFWA 3QJQB 5JNYB 3LDBB 2BFVH 5SX4I 4Z3HA 1RURH 4DGVH 1X6NA 2FGZA 3FZUD 1EHKB 4K3EH 4FLQA 3T0DA 4HS8H 5FYJH 2Y6TE 4XMTA 1PVHA 4N87A 1YQVH 3R4RA 1T04B 4DTGL 1HL8A 4HZ1A 3PRZA 3VUAA 4LAQL 3DNKA 4K2UH 2AQTA 4PGDA 1PJ9A 1Z9SB 4I2XB 1FL3A 4LSRL 3ULAB 3UERA 1LK2B 4MCMA 3ZDZE 1VZIA 2EYTA 1DBMH 3A21A 4XMPL 2FR4B 1EMTH 4MCZB 2Y06L 1UOVA 3CVBA 4WUUB 1ZHLB 2J56A 4NNXA 4LLQA 1PZAA 1S7XA 4W9HC 3L2LA 4Z9KB 2EDEA 4M56A 3S4SB 3MGTA 3V5KB 4GEIA 4F2FA 3AMKA 2HT3C 3VFSB 2WZPD 3FTGB 4ETQB 4X6CE 5J89A 2R1XA 1KIUA 3KYNB 3M8OH 2W65A 2NYYC 3UEZA 1UACH 4LFHD 1OLZA 4XNYL 4PG2C 4KNUA 2UY7A 5KSBF 4B6ZA 4XVJH 1D5RA 1XAKA 4ZBJA 5EZJB 2ZX5A 5GRXG 5J1SC 1D5XA 4M02A 3QUYA 1FUNA 2ZSWB 4NX0A 2D7PA 3MQIA 5EU6E 3THMH 1YEEL 4XXWC 2VO5A 3K6SB 1S9WB 2CHZA 4XBMA 5JXEA 3FNKA 3H0TA 2Z91A 4J3WA 3L3KB 4PJBA 3CU7A 2EKJA 4I85A 2YPLB 3U4KA 4UV7L 2APXA 3OPZL 4KUZH 2F5AH 2Z35A 2XVGA 3O45B 3FUKA 4R4ND 2OTWB 3HG5A 1XIWA 4LIQL 4MBOA 2UZXA 4U6YA 3OKKA 5JDJA 5D7LD 2Y36L 1U3JA 4AEEA 1KJMA 3DX4A 1OGTA 4BQ9A 5CCKH 3S8GB 1RERA 2V2TB 1D6VH 1CS6A 3EJSA 4XC3H 2Y7QB 4B9YA 4HCFA 4YDNA 4DO6A 3US1A 5DYOB 2OSLA 4UT9L 5MHSE 1JGLL 1EDYA 2B59A 1X7SA 1DUZB 1JGUL 5HDBB 3U4BH 4XXCA 3BCDA 1X9QA 4XP6L 3SQOH 2X4PA 3MR9B 3Q44A 5GRYA 2RMNA 2C3HA 2HLAB 4BRJA 2AGJH 4XAWL 4X9FA 3TIEA 4PJIB 2FZ3B 1W8EA 5DHMC 3KL3A 3UYRH 1NPNA 3UAJA 1SF3A 3BP5B 2VUOA 3T4YA 1Y1UA 3VD5A 1IC7H 4W1TA 2V7HA 2AXJA 2Y5TA 3CHQA 1W0VA 4MNHB 1WF5A 4ZUUA 3EOAB 4RMWA 5LAXA 3D0VB 2G4EA 3NJKA 4G42A 4HH9A 4HUWA 2XNAB 2VLMD 3ZYOA 1DDHA 4ODXA 4PJ5B 3HE7A 4OGAD 5ICZA 4XO4A 4BV1A 4OLZL 3SDCC 4NN6B 1GGBL 5AVUB 3FFCA 3ZQWA 1QAWA 2Y24A 3BRGC 4K15A 2BCKA 4U2ZA 2ZXQA 4JPSA 3ILEA 3LZRA 3S3SA 4HAGA 4OGZA 1F4AA 1U8OB 1VGEL 1BD2E 2EIDA 2JF1A 3VSQA 1D7BA 2IADB 2M1KA 5F7HA 5C6WH 3ZSTA 1ETB1 1TTCA 4UDTB 3VG9C 4JL1A 2XPGB 4P9HL 4JDVA 1JYXA 3AS0A 3IJYA 3GT6A 1CTMA 3PWNB 3QEQE 4PWHA 1KYAA 5HDQL 3NIFB 2ITDA 3CUPA 4M1CC 5KBPA 5IQNA 4AWJC 3K72B 2HJFB 3ASWA 1EJOL 1MNUL 1EAJA 5ENWB 4ZRGA 5H2BA 5TDNA 3HC3H 4NB7A 2VN5A 4EOWL 3O6LH 3HNSL 4XCCL 3OKNB 2X3BA 1MWAL 1PU0A 4GAGH 2PP8A 3RY4A 4BQ6A 1RZKH 3CFKB 1CT8B 4W9EC 1AGBB 1KCVH 1N70A 4AK2A 3LS5H 3BT2H 2PW2A 3RVXD 1IGIL 2YKKA 1MFCH 1O6SA 4RGND 3TN0B 2VN6A 1RUML 5DFVD 5L9DL 2X4OA 1HOCB 3D0AA 2P5WE 3KBHE 1N3NB 3QPXL 2OXHA 1NMAL 1FE8H 3U36A 4DP0X 2OYPA 1MXDA 5AOMA 5IMKB 1FFQA 3FTZA 1P84K 2OYKA 1B0RB 1X4ZA 3V0EA 3S35L 1NBVH 2X1XR 3HG1E 1BZOA 2VXVH 1YDPA 1B4JL 3TASA 2SEBB 2WB1A 3NA9H 4NI6A 4B53A 2XWRA 5DK3A 5KW9H 4EN2A 4JFQA 5L8LB 1J8RA 1QSZA 4JJ5A 4PI0A 2OSWA 3OJMB 3B7TA 3PAUA 4NKDA 1JZHA 4FKKA 5DWUH 2ALWA 4XAKE 1U8IA 4XN9A 1M7IB 1R19A 2JVUA 4TULL 3ARDD 4IOFC 4LLUB 3SCMC 3OJDB 5L8KB 2V4LA 1WAPA 1A1OB 5CEZE 2LFEA 2Q8BH 4JFFA 3TVMD 2EVGA 5T1LA 1GGTA 2YGNA 2EO9A 3GM8A 1MCOH 1PLAA 1A6VH 5CSGA 1D7FA 2JQAA 4EF3A 1UASA 2YKLL 3N5AA 4NYLA 2A83B 1JZ3A 4OCYL 2GTQA 1ZVNA 3P0VL 4J1UA 5LXVA 3UAEA 1JHTB 1JF5A 4JG1L 3HC0A 5BMFL 4FXKC 3CLEL 4EAEA 4J3SA 3ME0A 4WFEE 1T03L 1NFDA 2VZTA 5IBTL 1OK0A 1AQKH 2NY1D 4F2ME 1AXSA 3NVQA 1TQCB 3IN2A 2VLRE 1KCKA 4BFGA 2P45B 1RMFH 5AVVB 4HKJA 1JV2A 4NQEE 1BGXL 1FYTA 1HAWA 3RVVC 3HE6C 3I3BA 4XZUB 3FN0L 4EBQH 5C0IB 1G6RA 5KYYA 4M6OH 3FOLB 2W07B 1WSST 4X9YA 1JMXA 4HCRL 5DHVH 4BZ2L 3LSOA 4YDIH 1N10A 2G5BA 4DN4L 2FWOA 1FIGL 1H19A 2J4WL 4GW5B 4Z95H 2V3FA 1A6TA 4KJWD 4NXKA 2PXYB 4Z78B 2D4FA 3DGDA 3QNZB 5J6GA 4JFDA 5FECA 1UZ8A 4P5TB