2A9CA

Crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
359
Chain Sequence
b'RVNSQKPFNAEPPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 89
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9cA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9cA01
3R19A 2A9CA 2BIIA 2A99A 2XTSA 1XDQA 3HBQA 2BIHA 4PW3A 2BLFA 2BPBA 3HBPA 2CA3A 2C9XA 4PW9A 3HC2A 3R18A 3HBGA 1XDYA 2A9DA 2CA4A 1SOXA 1OGPA 2A9AA 2A9BA
chains in the Genus database with same CATH superfamily
4OI9A 1IC4L 5FF6B 1QG3A 3KPPB 3L3GB 1B2YA 3B8SA 1U2YA 4RQQA 4OB5L 1RUMH 5MEQB 5E5UB 1EVUA 4IRSC 2E8YA 2NX5A 3CXHK 4E9LA 3C12A 2AABH 1JJUA 1VFUA 2I25N 4WFFD 3SO5A 4CBPA 5TDPA 5GJSH 4ZMXA 3N40F 4NKQB 1BREA 5FDYA 3SDXF 5DJCA 2YAHA 1CFTA 5D2NE 4JY4A 3L2MA 4R7LA 1LK2B 2IBZY 4NX0A 4GXFA 5AEAA 1JK8A 3EFDH 3I2CH 1MCDA 3SKOB 1MJ7L 4JGMA 1JRHL 1ZK9A 3L1OL 3PL6C 5FO9B 4HP5A 4ALAL 1Z5HA 2CBQA 3CZEA 4WFED 5L8LB 2Q8BH 4NDMB 2Q76B 1HDMB 4PJCE 4KKZA 3PP3K 1KB5L 1G9ML 3WTYA 1KC5L 1NCHA 3WKQA 4S1QL 3WKMH 2HG5A 3B5HA 3UTSE 2IANA 2E9WA 5B3JE 4ODWA 4WEEA 1TUPA 1J9CT 5IFHH 3LH2L 3HC3L 4OGXL 3VCLB 4AGMA 1ZV2A 3DURB 1OALA 1IT9L 5E23A 5CEZL 2WXPA 4PRHA 4YDZA 4F57H 1I1AD 3WUWA 1CG9B 4UILH 3WFHB 1T7WA 2ZWZA 3QUHA 2GUOB 4AMKH 5CZVL 1CLYL 3DX8A 2XTSA 3D30A 3P2DA 4MD5A 3H53A 5H35A 1RUPL 3I85A 4YX2H 1NBVL 1D7CA 1M71A 1XIWB 2XG4A 2DTMH 4IEFB 1C1EH 2B3IA 5B1JC 3FN0L 1T1ZA 5KN5B 1UA3A 4ZFGH 3FTSA 5A2AA 1E28B 3QH3B 4XVJH 2IAMD 1AKJA 2DD8L 4Z7QF 1KXHA 1IGFH 3GS0A 1PD1A 5AL0A 1KZYA 2O61B 1E4HA 1RK1A 1TXKA 5ITBL 3HFMH 4GRMB 1N8ZB 3V6FA 3SBWA 4AJVA 3ESUF 3L9YA 4F7PA 1A4AA 1LO3H 1URZA 4QTFA 5DR5H 3ZZQA 3GIZH 3MJ9L 2VZVA 2GEEA 3JBG7 4WEMB 3BN9D 2A83A 2UY7A 2Z8WC 3B9KD 1JDAA 4HBCL 2EXYD 3L48A 3GO1H 4F7TB 2Z8RA 4LFHG 2FAUA 5J6SA 4ZW5A 4O2FB 4PJFE 3ZT7A 4KNQA 1VFAA 4ODBD 3B6SA 1SLUA 2C7UA 5F9AC 3QS3A 4GW4B 2E86A 2QMJA 3VNZA 4JGNA 5HJ3A 4AYSA 5AOLA 1HFUA 4J5VA 2C3XA 3GINA 3GI9H 4CSTA 5LWYL 3ZTEA 1BJ1J 2OMZA 1TSHA 1C16B 2MCPL 1J8KA 1NMBL 1QFPA 1KJ3H 2QSTA 4HWNA 2BSCA 1A4CA 5IJVB 1B0GB 1J9RA 4L8SC 4WU7B 3IE4A 4GEIA 1IBGH 2VGLM 3HPLB 5AW5B 2FGWH 1WK0A 4YDVA 1MWAH 3K5RA 4HD9A 2GCYB 1OE1A 3K2KA 1ZANH 3S97C 1M7DA 4QY8B 5SWZA 4UANA 2DW5A 4DESA 4FNTA 3X1BA 3MI6A 1FVDA 5AAWC 4LL1A 4RSYA 3WN5B 3U4AA 1B9KA 2OXHB 4MA7L 5BV7H 4KHTH 3ZDXB 3I9AA 3G04B 2XIIA 1JGDA 2NW2A 5EMYA 3FTUA 1YY8B 2RCSL 2DMCA 1ZLVH 5J0BA 3VI4A 1F90L 2X9YA 4X6DA 3ZTCC 3V0VA 3SQOH 1LGVA 3C6SB 2VC2L 4PV8B 1WWAX 4RVBA 2GITA 2P8MA 3BD3A 3H4HA 3IF1B 4QI3A 5E2VL 1BVNP 4C55A 3RWHA 2YAMA 2G2RB 3FO1B 4UMGA 2E76C 2XTLA 4P3WA 2EE0A 3KPTA 3RWIA 5KSBE 4XX5A 1B4JH 2AF2A 2VJ0A 1UM4H 1R19A 4UUJB 1GRWA 2VR6A 4Z7WA 2WTOA 5T1MA 2VXSH 3BWAA 2Q6WA 3E6HB 3FSVA 1QSZA 5EUOA 2R2EB 5CN3A 4D2NA 4NP4H 5C7XL 4HPYH 4IMLB 3SJVD 3WLWC 4TULH 2QHRH 1WWCA 4U31A 4UTAL 5FA3B 1KWGA 1R34A 2VIRA 3TM6A 3MGOA 1KCRH 4Z23A 4J8RA 5CJXA 4NPJA 4GH7B 3O4OB 3JTSB 3KR3H 1KZQA 1U3HB 2CGRH 3K81A 4YUEH 3T3MB 4AYID 4GRWF 4RGNB 2IXQA 1ASOA 3TJEH 4H8UA 5HHOE 1WV7T 1ED3B 1HN1A 3NIDF 4LF3B 2R29L 1GS8A 2R1YB 4MXQC 4OZIB 1Q9WA 1FFOA 1MWAB 1MKFA 1OO2A 2FYYA 1D6VH 1ETA1 4P2QD 4PJAA 4D7PA 2AJZB 4YSRA 1L7IH 2FT6A 2Z92B 4ELMB 3GJFH 2Y36H 1NC2D 4GIAA 5IREA 3N41F 4U1HA 5BV7B 1E9QA 1Z3GL 4NZTH 4FYRA 3VTMA 1CD8A 5GGVL 1ZHKA 2QVKA 3NEEA 2VL5A 4OD3L 2G2PA 4KTGA 5ESAA 4KTDL 5GZNC 4PI2A 1WFMA 3NSJA 5DRWA 4D9RD 1M7UA 4JRYE 2CUHA 5JPNA 4QRQB 5HYJA 3T4AC 1FL3B 2R0KL 1IAOA 3HE7D 3A4AA 5CD3A 2XWTB 5E08H 2VLRD 1FCCA 4C4UA 1RZKH 3VFMA 5GRWA 3N1GC 5F3FA 4NFBA 1NINA 1YEIH 4WDIB 5D93C 1GZQA 4FFWC 4N2LA 5ANME 4JG0L 2FHBA 5C0AE 4A67A 5E0QA 1H8OA 4LHUA 4RZCA 1XEUA 1AGEA 1SHSA 4YXLL 4RGMC 1ZPUA 1IVTA 2VUOA 1KCUL 3NCJH 1Q0XL 4JFQB 3FB6B 4I87A 1Z9SB 5DLMH 3PWVA 4B9JA 4OF7A 4XBEL 4I5BB 1NGQL 1HQ4A 2ICWI 4PHXA 4U6VL 1FYTA 4A66A 2Z93B 4KDTC 2DM2A 4GRLA 3WIIL 4GW1A 2IPKB 4K5LA 3TYGH 5HVWA 2BHFA 1KXTA 1LDPL 3MROA 4LFHD 4XHJC 5CEXA 1N64H 1P0SE 2DOCA 1QFWM 1R3KB 1BOYA 1M7XA 1AMYA 2HTKC 2D7QA 2M2DA 3MGTB 4JFSA 4PJAF 1V3KA 3VD0A 3GJFB 3D4YA 3OWRA 4UOZA 3L5HA 3BCFA 4WK0B 4EI6B 5L8KB 3DJRA 4H1LG 1OXYA 1KLUA 2KDYA 4DP0X 1RY7B 4GB9A 5B1BB 1BMWA 4H8WL 2C4FU 5FW8A 3QO1B 1V5JA 3TWCL 5K9KA 2XN9B 2AEOA 2BOCA 3KCPB 4DVBA 4MHHG 3HRPA 5D7SH 5DHVA 1CD9B 1MH5B 3FUDA 4NRYB 1MHHB 3VI3B 4NYLA 3UAFA 3FU7A 4HIEB 4W9EC 5G5DA 3MYZA 5ETUA 4XNAA 1RVFH 2XFXB 3GRWH 1JF1B 4U33A 2P80A 4BFKA 3ARWA 1CU4H 4B53A 3D05A 3ZIMA 1XIWD 3ATFA 4N0FB 1BD2A 2UWEA 3LQMA 5IVXF 1A4BA 5HPMB 3N91A 5J1AB 1OPOA 1E4KA 3QG7L 5LBSH 1KELL 2C9UA 3HE6D 5DEGA 2XETA 2E56A 1DJYA 3HNSL 4ACPA 2EP6A 4P2OC 1AYOA 5IMMA 5CGMA 1OEZW 5HHME 4IKJA 2PUQT 3MBWA 5FUZH 5SWSA 1WO2A 2WIIA 1QAWA 5FA4B 2F9BT 3KDMA 2FECI 1JHKL 2X70B 3IDMB 3I3BA 2VN5A 5E5RB 1T0MB 2FUTA 3LEYH 4HH8A 2WWNA 4PJ7F 4RFEB 4KROC 2OK0H 5HGDB 5I23A 1JDCA 2EIJB 1DJZA 2PW1A 4GI9A 4PUBH 4LQFH 4XBPB 1S9XA 3OB8A 3IDYB 1K3ZA 2OCJA 3VXUB 4Z18A 4QAWA 4OSUH 2F61A 4U0RC 5AZEL 2G5BB 3PE9A 1SLWA 1HOEA 3U4EA 2OSLB 4XODA 4ZTOL 5E4OA 3BPLC 1H5BA 1SFHA 3K72A 3MV01 1M2VA 2WLLB 4GP5B 3FUEA 3CDZB 1SN0A 3ARDC 5SV3A 1U58A 4CN6A 5F0LB 3S6CA 1N10A 3ZYIA 4H88H 1CGXA 3ELQA 2W94A 4W1TA 2BERA 3P3UA 3Q6GH 3CJJA 3AU0A 4PRAB 5ILTH 3SDCC 1AQKH 2DQHH 1KT2B 3MRIB 2F1BA 3PP4H 3QZLA 4QHPA 1WITA 4OF0A 1VCAA 3NACL 1KYUA 5ITFA 3UZVB 3QI9B 2MNWA 2YJLA 3KLHD 2JJSA 3JV0A 4YHNB 5L2KE 4ONHA 1D5RA 3BPCA 3O8XC 3QG6B 1FLRH 1RUQH 3S96A 3U7AA 3QXAB 3BAEL 4ZX6A 2DQCL 4FADA 3OAUL 3PGDB 3VFWA 4AXWB 1BAGA 2IDCA 2EDOA 2V3DA 4GIPD 5EC2A 3CFUA 4I3SH 4LASH 3V95A 1YN6A 3QORC 4G9DA 1RPUA 3HNVL 5C08E 3WNMA 1UB6B 2D2CC 3QIBC 3MRLA 5F0MB 3V52L 3ZZ1A 4P9HL 1N7ML 3VXRE 1NKRA 1GYWA 1CGVA 2C34A 5DEZA 2HT2D 4LCUA 4RMWA 5DJ2B 1RXLA 4GJTB 4G7RB 4WWKC 5E6IA 2A9NL 2VLKB 2ARJB 2HT3D 3HVDA 1WFIA 2EDFA 2XFGB 4GAJH 4HPOH 3BP5A 5JIQA 5KSAC 4NZDA 1U3HD 1RPKA 4BA8A 4PGEA 5C0EA 1CD0A 4LVOC 1LDSA 1N68A 3GF8A 5EU5B 5LGJB 4RGND 2O6CA 4AGQA 3ULUF 3O2VH 3RB7A 2BNUB 4FKKA 2L4OA 2B1AH 4NT6B 4HBQA 3P4NA 4LIQH 2R9HC 2WP3T 3IYLW 3GK8L 2N7SA 2YBRB 3KXFE 4G7VH 3QPQD 4KJQD 2V8MA 2BINA 1ZY9A 1KXQE 4K71B 4F8QA 4JO4H 5C8JB 4JRXE 2IEPA 4UTCA 1VAHA 4JRLA 3G7TA 3KEDA 1TKWA 2OI9C 5K33A 1W72H 3FU5A 4LRIC 4MNHA 2AK1H 4HEPA 3WD5L 1TVBA 4IKIA 1PIFA 2DWYA 2W8CA 3QXUA 3A67H 1DL7L 2PETA 1ZGLB 2CBOA 2BW5A 2GIXA 1CIUA 1GGBL 1HXMB 2WYZA 3C8HA 1XF3A 2NOYA 4HUUA 2NR6D 2YWYA 4NOBA 4D0BA 4X99A 1IGCL 1OARL 2JB5L 1TCMA 2LLNA 2VT0A 4I9WE 1U8KB 4MAUH 3AS0A 3R06B 2PWDA 1LO0L 3VA6A 2V4LA 5DHYB 4PRDB 3W9EA 4OM1H 3T0EE 1IC7L 1J8RA 4X4YB 3BGMA 4FXGB 2TSBA 3EJZC 5FYKE 1PCXA 2GJZA 3EDJA 2WMPA 1VF5C 4M5SA 3SDAA 1K8IB 3DBSA 1B3IA 1UWGL 4KBPA 2JJTC 1FG2B 3IJ7A 4NHUB 2DQFA 3BRDA 2GYSA 3AQZA 5DS1A 2AK4E 5DJAB 4DKEH 2NW3A 3BUBA 4CMHB 4QRPB 3NESA 3QEUA 2WLYA 4JN1L 2YXVA 1UXSA 3MO1A 5AWNL 3UFIA 5BS0E 3VGAB 5AKTA 3S5YA 1CXFA 4AWJC 5E6UB 2PPEA 2YEQA 3ARBB 3C5ZC 4OZGF 2Y7LA 4X6EA 4NP9A 5I8EB 3MUGB 3RNKB 3Q8AA 1QEWA 3I02A 5CXPA 2IV8A 4I48A 1MRDH 2GTWB 5E2UL 1KTKE 3TNNB 2HN7B 3VWJC 4GKZA 5F1OB 1VZHA 1Z9PA 5E56A 1HH9A 2PYFA 3CH1B 4MJ2A 1XF1A 4AENB 4AM0Q 1DVFD 6PCYA 1S5IL 4Y2LA 5IEKB 3OJMB 2DJMA 1W72B 5ABAA 3M8OH 4ZAKB 1MAMH 4JY5L 4GG8B 3QEGH 4U6YB 2GTZA 2XN9D 3QJTB 4AW7A 2I9TB 2WXKA 4ABWA 3WS6C 4UQ2A 2R56L 4WK2B 1QW8A 3JXAA 4XWGH 2PWGA 2R23A 4W9DC 5EZIL 5T1DH 5L4MA 3Q3GB 4R4FH 4WU5A 1MI5E 1WIUA 2VXVH 4OLEA 3FYIB 1NMCC 1ZLVK 1T5XB 2ZOTA 2XN2A 3ECWA 3NJFA 5E2WH 2OYLA 4M00A 4YHML 1UJTA 1T83C 5TFSL 1Y1DA 5FC9A 5JMOC 4Z7VB 4M6OH 4NBXB 1ETB1 2DWDA 5D7JA 3TA3B 3N55A 4S0HA 4J39A 1S3RA 3O9WC 4KPHL 1BBDL 4E5XA 1N0LA 4BFBD 5D9SA 4DO5A 2OW7A 3FT1A 3FTXA 4X80L 4XP9H 5ESQA 4N2IA 4PJXB 4JB9L 3FCTA 5AYUL 1VGKA 1J11A 5B3NA 3IDXL 3LQAH 1T04B 1BVLA 3RHWF 5B8CA 3WTUA 4MB3A 3FTZA 4M7JL 3GEWB 2VITB 4OKDA 3SE3A 2JIXA 1CYGA 4PP2B 4PY7B 1SJVA 4M7LT 3JWDC 1OAYH 2BNQE 3R7QA 4G82A 5E6YA 3NIFF 3RIKA 2OX5B 5LN4A 3HMWL 4QXGL 4HKXB 1SOXA 1D6EA 1T6WA 2EC9U 4YSEA 5EZOH 1EJOL 4JREB 5E8DH 1LEKA 3VXUD 1ZT7A 3S4SG 3VFRB 4OF5A 4XZUA 2Z31B 4YDKL 2QPSA 3FFCE 1SJEA 1DBJH 1MCCA 2DTSA 3G6DH 3HZKA 3I75A 3UZEA 5B7FA 4Z0BL 5AW0B 4IRJC 1Q38A 4EZMA 3MLXL 3B3IA 4FQIL 4BD4A 3KLQA 4J4PA 3SE8H 1ETZB 5CMAB 4F9PA 4N86A 1QFUL 3H3PL 4ZW7A 4U3SB 2ALWA 5I74B 4PS7A 2UYLA 3PWNB 5DUPL 4Y4KB 2A9MH 4Y5VB 5AVQB 2MTPA 3G08B 4UCFA 1ADQH 5B4MC 3PIQB 2OYMA 5AG8A 2F53B 2NX5E 1CFBA 4F2MA 3RP1A 1F1GA 4B95C 1F0LA 3AG3B 2Z4QA 2I5YH 5EBGA 2I7OA 3QI9D 2CJSA 4IBLT 1S7VB 4XVSH 5DO2C 4HULB 2MOVA 2DIAA 1T6BX 1X4ZA 4W9CC 1UT9A 2AJYH 5EU3A 3FZUC 2ESVB 3QJOA 1TQCC 3HC2A 3FW6A 2J55A 5I1KL 3JTTB 4GG6B 5FYJL 1HYSD 1UACL 1DDTA 1UATA 2H26A 2K78A 3CFBB 3BMWA 4FXKB 4ZUVB 1YMHA 4HIIA 5IWLC 2R7EA 4NKDB 4DO6A 5AKVA 4MA3A 4E36A 1AD9A 3CFJA 1WZ1H 2CDGA 1XB3A 4GLRI 2HFEA 3WY4A 1DE4B 4I3GA 4M5YH 5CKAA 2WUBL 1K4DA 1MAKA 2WBJA 2Q2LA 1IIKA 1JXJA 4DJMA 1KG0B 1OB1B 2IANE 5C07A 2L7JA 2VRQA 4AYFB 1RIUH 3SN6N 2K1MA 1U8QB 1WCQA 3PDOA 4XRCB 3DIFB 3NSCA 2J8UF 2VLKD 2EJ1A 1OSPL 2H3NB 4YDNA 4N6QA 2B2XH 4R7DB 3QJHA 3HAEA 3SYAA 1IMHC 3I3EA 5CBAB 1HWHB 5E5LA 3UXFA 4DN3H 3Q2NA 1TR7A 3WAJA 3BGAA 3CHOA 1X44A 4PFEA 4F80A 3SE4C 5AQ0A 2KL6A 2XACC 5LXGH 4X6CB 4J1UA 3OMIB 4FFTA 2FBJL 2IJ0C 4KK9D 4XAWL 43CAB 2VW7A 3CSPA 1HCZA 2DQUL 1RU9H 1BLIA 3CN0A 3F7RA 4P4KC 2ARWA 1K5WA 1SZNA 1D9KC 3UBXI 1AY1L 1UOWA 3SO3C 3TBVB 2VUKA 1RZGA 4KK6D 4PWGA 4JQIH 4PB9L 5B1KA 2QPDB 1R5IA 4MZIA 4HV8B 2CKNA 4K8RH 1BFVH 4OLWH 4XPBH 2HJFB 3FQRA 1YDPA 3MXVL 4KI5E 4NNYA 2OMYB 4K3JL 5C70A 3RVXD 3JYCA 3W82A 4JDEA 2R15A 4F8LA 3EGDB 3VXQB 3X11A 2O6PA 5CD5D 3SPHA 3N85L 4CGUB 4MB4A 1YRKA 3KM1A 4LOEA 4HLJA 4KMQA 4P23A 1QUPA 2L8AA 3BVUA 2UV3A 3JTBA 2ZOOA 4WY7H 2CRMA 4IBSA 3S2AA 3GTVA 4C83A 1XCTB 5FFGA 5FR3A 5F93C 4ZI8A 3QPXH 4WQOA 1IGTA 2B5IB 4GRWE 3VRIA 5T1JA 3FTVA 5IQ7H 1XDTT 2IQAA 3DVNA 5HBBA 1GHFH 2LABA 1LO4H 3EGXB 3VVVA 2YPKA 4N85A 4R7NB 1MUJA 4RMRA 1OAQH 4E68A 1ZHLA 5KVEE 1NAMH 1NANI 1KGUA 3AWGA 4PYGA 5JLZB 4E0RA 2GK2A 1OZTG 2HSIA 4LMQE 2FX9L 4QRPD 1Q1JL 2VW4A 5LNEA 4NXSA 4LCCA 1JWSA 3EFOB 4DVRL 4Y2OB 2BOBA 4BGDA 3ARBD 2OMUA 4PJCB 3VI4E 1S7QA 4CC1A 5ABDE 4X6DE 3BPOC 3HKZA 1IILE 2J2ZB 3NRFA 3H7BA 2FDBP 3VQLA 2KH2B 4ZSOA 3UTSB 2X12A 3MJ6A 1E8XA 4ZXBB 1QBLH 2ZG1A 2WQRA 2FEEI 3QQDB 4PJEF 4AKPA 5I17B 2XQYK 3FONA 5I1AB 5K69A 3NP3A 3DI2B 4ZPVB 2J8OA 2Q0ZX 4ZAKD 1YUHB 5H94B 4JL2A 4BQBA 4KX8A 4QHMB 3RVUD 3LD8B 4QRBA 5EUOE 3WTVA 3FT3A 4JZOB 3GHBH 4MS6A 3O2WH 1J48A 4RWHA 3FOMB 4QXUH 3IWVA 3X1EA 5INCA 3O4LE 5GSVA 5DURD 1YEJH 5D1QA 4S0TD 5FKPB 4IHOA 1RZQA 5IG7B 5JIHA 4CJ0A 4CN1A 4WJ5A 2V3EA 4KUZH 3WKML 4X42A 1JNLH 3DO7A 5DD1L 3TA3D 3V0EA 3FCUB 3RUGA 3GBEA 3OHXC 3DIVA 5KSVA 1ORQA 4FDWA 1I7TA 1G7IA 4FFYL 1EHKB 2BNRA 1P1ZA 2LQRA 3FJTA 5SWQA 1NAMB 4C56A 1EFXB 3EBGA 3EO1B 4PJAE 2NPLX 4PJFB 2ZSWB 1UT2A 4AMKL 2ICWB 1A14L 1X5YA 5DJ8A 5IROD 2XZCL 1CICB 3ABKB 4ZZKA 2PXYB 3AGWA 3GQFA 1GTFA 4G6FB 1ZRUA 2X41A 1AHKA 3U46A 4X7SH 1OSYA 1RJZB 5F7AA 3I9PA 4K7PX 1HKFA 3MNZB 4Q4EA 1NDMA 3M1BA 1WFTA 4QRAA 4NC0B 1B4LA 1JN6B 4NUQA 3LZFH 4G6KH 5HYJE 4FA6A 2NZIA 1HH6B 1NMAH 2Z31D 4XCEA 3WYRA 1I1FB 2H1PL 4J3BA 3GIZL 5D70H 2OMNA 3RGHA 2AQ1A 4QHNA 2BXZA 5TDOB 4BUHA 1A9BB 5CSZA 3LMJL 4K7PL 3QO0B 1ZDSA 3EG9A 5EOCH 1N12A 1J5IA 1L3WA 4LE8A 2QTVA 2EEFA 1IAMA 2DQEL 2HLAB 3OKNB 3OKLA 3PQYA 2W81C 4JN2A 4MBOA 5J3HD 3BP4B 3CXHJ 3KWTA 5GGTA 3QFJD 1OHZA 3Q5TA 2D73A 4Y4KD 4HPHA 3KS0J 1XZ0A 3QS2A 1E43A 4H4NA 4WUKH 4B7LA 1CDUA 1TVHA 4ESKA 1ZVSA 1AD0B 2F53D 2XKNA 1QSVA 1XTMA 1OAXL 1E4WL 4UV7L 1VGEH 3DRTB 4LLMA 2HX7A 1DBAL 4OQTA 1FYTE 1FI8C 2IIJA 2KS0A 3SY0B 1I3RA 2ESVD 1T2XA 2FL5B 2EKSB 3KLAA 3N50A 2HZHA 1UCTA 3FQNB 5F0PB 3F6IA 4ZMYA 3FRUB 5KSBB 4K2UH 2Z7WA 1A1OB 1Z9MA 2AAAA 4TNVK 1BVKB 4MQXD 3NRPA 1P6FA 2CG9X 4RX4D 1E5UI 4KXZH 5IMOB 3QYNA 3PWLA 5EO1A 1OT2A 2XA3A 3ABZA 1PDKA 2L7EA 3SKJL 2YN5A 5JXED 5M7QA 5C0BA 4JM4L 1QO3B 4LCWA 3ZKMC 2ADFL 3ZY7A 4KO6A 1W16A 5I0ZA 4M1CD 4BIKA 4ZFOB 3SBRA 1A64A 1TQBC 4K94H 4W81A 4CVZA 1CI3M 3OL2A 3TC9A 2ATPB 4U1MB 4YHPB 3S36L 2QSCH 1HWGB 3TESA 1D5MB 4MMYA 5TQ2H 1G6RH 1CD1B 3P73B 4NQXB 4X0KA 3OX8A 3UTQA 4A7UA 25C8L 2BHUA 2XVKA 4ALAC 4BZ2H 5C0FB 1REIA 4ELKB 1UM4L 1RZIA 3B1UA 3MX0B 4TVSa 1MVUB 3NPSB 4CU7A 1BD2E 2CBPA 1KBBA 3L5XL 4JKKA 3VGDA 2JK5B 1G9MC 4FOMA 4XO4A 3CGTA 5T5NG 2XC8A 1SYVB 3GDCA 3V79C 4QT5B 1OM3H 1T1YB 2CMRH 4DQAA 4PY8I 4BFRA 2NY7L 1AI1H 3BVNA 3MMEA 1ZVHA 3KWWA 4KQ4H 4OCRL 4P0DA 5GS1A 5E00B 1JGIA 2H45A 2YSTA 4FXLA 1AXIB 5FO8B 4D8OA 4JL1A 1N5YL 4PJDF 4IOSD 4YUEL 1ZGLP 2OMVA 1HHIA 4JRYB 4R3SB 4YSTA 5I9QB 2GT9B 5SWSE 2DQJH 5T3XL 4AT6A 4CMMB 1F2XK 1MDTA 5BOJA 4NS0A 1KBVA 2KZWA 2ZKHL 4U1SB 3QRBA 2KZKA 4A2HA 3AXIA 3R1GH 1PKQA 4GQPH 3MRRA 1RP9A 2Y72A 3IFLH 1U95A 2WXGA 2XV3A 4ZW8A 5FV2A 2O5YL 2CO6A 2Z7UA 4V1DE 1UYWH 2UZIH 2HJKA 3C9NB 4Z7UA 2BY3A 1UQSB 5E95B 4KX9A 3A6OA 4I13B 5ANMB 5C0AB 2P7TB 3FQXB 5B39G 5CO1A 2XXCB 5GS0H 1CWVA 3QUZB 4EZKA 5T1LB 1E27B 3U36A 5JOPE 2OTPA 3KEHA 1G9NL 3ULUE 4K5OA 4JK0D 3VE0A 3VXPB 4YL4A 2IALB 4UQ3B 3GUTB 2X4SA 3UDWA 2Z4TA 3ARGB 4D8PB 3GBNL 4LEBA 1P2CB 2ROXA 1RZPA 5E51A 1DSFH 5JO5A 1G6RB 4NUGH 1SY6H 4CRPA 2Y4SA 1RZKL 2HH0L 35C8L 1DQQA 4EEEA 1FZOB 4WWPA 4DEPB 4EF3A 1KTLA 5CJQH 1QBBA 5F6HJ 4MJHA 3WIFB 5DFAA 3Q13A 2YXFA 4LCIH 2VMFA 4Z9KB 3T04D 4RSVA 1A6ZA 5FCSH 1J88A 1HCVA 3G5XA 3L5WB 3IRCA 4XP4H 3CN2A 1SUJA 1E7VA 3UTSD 5AW4B 2Q5BA 4LLQA 1RIVH 3MLZH 4AKQA 1IJ9A 4YSCA 3IE9A 1IFRA 4K8RD 2WVUA 3VD7A 1JNHB 1EEYA 2A74A 1P7QB 4Y2DB 5CGYC 2FK9A 2QQLL 4ZXBD 4EXKA 2H9GB 3EYQD 4FQ1H 2E9IA 2VSCA 2XTJC 4MAYA 4ZUSB 4TUKL 2BHYA 1BZ9A 1OK0A 2VQ1B 4NRZB 3BXNA 3TYGL 5D96B 4L18A 1I53A 3HZYB 1RUKH 5L88H 3B2VL 4IS6B 4TOYH 3C6LA 3D87B 5JW5B 1N64L 4NM4H 5HXMA 5HY9B 2NXZC 2Q7YB 2XICA 4Q8BA 3U2JA 3IPEA 1S9YB 3S7GA 1AH1A 1I9RH 5J13C 4NBYB 4GINA 3U79A 3F7PC 4EN3B 1SOSA 4IIQA 4Z7IA 3ARRA 1UA6L 4AYGA 3BMVA 4ZFZA 4ZS6C 1FWXA 5E03A 4NNXB 5HHMB 4KX7A 1NSNH 5A2LH 4AQ1A 4F91B 5IUCA 4P8QA 4GW5B 1UXWA 3ZDWA 4RAUA 1YEFH 1OW0C 1A7PL 1FDLH 1SQ2N 1CS6A 2AJUL 4ZPTB 1LO5B 1DQLL 1LEGA 2J5LB 3C8DA 3BKML 1U91B 3MRDA 3QAZB 4XWOD 5JHAA 4LP8A 2A6KA 3GSQB 1CICD 2DWTA 3KPSA 4Q2ZB 2PXYD 2HVJA 4I88A 1IGJA 1AG6A 4G6FD 4GSUA 4YHYC 2JKSA 3GXMA 1FH5H 3BVXA 3CFDA 5ICYB 5L9DL 3QCUL 3GRBA 3IXAB 1ETJA 1TSRA 3L5IA 5IB4B 4UV4H 2W65A 3MGAA 3MOAL 3VXTA 4PGBB 4R26H 2TRHA 2X6VA 4B5EA 2ZX7A 4Z0XA 4N2HA 4WV1C 1QZ1A 3V8CA 2LT9A 2WBXA 3DHUA 2VDLL 1KB3A 4IRSA 1E2ZA 3ZXAC 2R1XA 3D2UA 4OLZL 5E0FA 2W59A 3LKPA 4JG1H 1HEZB 1Y07A 4TXVB 5IJCC 3BIKB 3O41A 4J6RH 4PUBL 3OGOE 3N04A 2GAZA 3BT0A 2CR6A 5CCHE 1PZSA 4WKXA 3CUPA 1DUYA 2YZ8A 5L2KB 1NCAL 2ZF9A 4LLAA 5HHNA 5J4MA 4AYEC 1CFQA 2EABA 2Y2YA 3PL6A 3IT8D 3S3PA 3LKQB 3OXRB 2TSAA 2ZUQB 1PYWA 3H6JA 3EYSL 1JYWA 4LRNL 3EYVB 2C7FA 4B6ZA 2NY0C 4KZEH 1JPTH 2IH1B 3TO4B 3NIFE 5DD0L 1FGVH 1IBDA 1N5AA 3B2XA 4YO0A 5C08B 4EBQL 3GSWA 5MHSD 3ZHLA 4CA4A 3VXRB 3LSOB 3MRGA 2WVVA 2HFFA 3KMDA 3QZWA 1THAA 3X14B 1S9KC 5IHUL 4OCYH 5FYKH 3FHEA 1FNAA 4KOCA 3T4YB 3PLYA 3CFKA 2BVPA 4U1IA 4XGZB 5IVOA 4AVHA 4JM2F 2MPAH 1AE6H 5E99H 1LK3H 1RZJH 2Y5TB 1XSIA 1FG9C 5E4EC 1AC6A 3D07A 3THML 1RUQL 4Z3FA 1D5XA 5C2BH 32C2A 5B1JA 1BFOB 4LLUA 4P99A 4U1NB 5C97A 4MMZB 3WG7B 1KN4H 5AL8A 4AL8C 5HHOD 5E1GA 5BXFB 2WD0A 1BOGA 2K6WA 1EXHA 1XSOA 3ZYZA 5DQ9A 1FO0L 1FNSL 1C7SA 3JV4A 1FBIH 3VRJB 3KXFB 2AXJA 2EYRA 1JUFA 4F8TA 4Q52A 2CO7B 5LQBH 3MRBB 4BQCA 5FW6A 3CNKA 3IVKB 4WW2B 3CDCA 2PCPB 1INQB 3ZW3A 4X8JA 3WELA 4Z3HA 2B20A 2AI0L 4H8WC 4I3RL 2VABA 4PRNA 1HSBA 4AIEA 5DK2A 2J57A 4QGYA 3DV4B 2C4FT 4QWWC 3TLRA 3BKYH 2CNYA 5K5YA 1B0WA 1QWHA 4JRYD 1S8DA 1Y18A 5IFAH 3TYFB 3DX1A 4IYKA 5MEPB 1RCYA 3Q7JA 1WP6A 4L8SA 3GBML 3AVEA 3O3AA 1PZDA 1KIQB 3WSQL 3S35X 2P24B 3E38A 4S10A 2IBBA 2J8UE 5EO9B 4OLYL 4L4VA 4F5CA 3OXSA 3T0EB 1BPLB 5T33H 4AJ0A 4N8VA 4LL9A 5C0AD 3PWUB 1A6VL 1CTMA 1IBHA 3ARFB 3QUZD 3TIDA 5AAWA 3VFOA 3ES6B 5T1LD 4FYQA 2QDWA 3CMOH 1WH0A 1TTFA 2VDPL 4W4OA 2UXVA 3S35L 2AK4B 4JZJB 2JJWA 4ANUA 1FVCB 4FFZA 3ARGD 4MVBC 2XT1B 5C0CA 4IRZL 3GTTA 5BS0B 4A04A 3BJ91 3ECUA 5TDNB 5EEXA 2JI1A 4ES8A 4KRPB 1FZMB 5HYQA 2NY6C 1FFPB 4P9ML 4F2ME 1DJWA 4LCVA 2B1HH 2ZWSA 1TJGL 1U3NA 1QLEH 4RDBA 4OUUA 3UJIH 1PW3A 5I6XC 1V3MA 4UU9B 1M1XA 2G9HB 4P5TB 4E9WA 3FOLB 3UBXB 4JVUA 4WO0A 2IVFC 3B1TA 4FF9A 5DI8B 4JFUA 1HU8A 3NTCH 3RNQB 4FMVA 3BT2H 1A1NA 1WICA 4HH9A 4FG6C 2F8IA 1P7QD 4Y2DD 4B9FA 2CDFA 1BQLL 4PJ8B 4PV1C 1H3TA 1ROWA 5HVGB 3QBTB 1EO5A 4PS4L 4ZMAT 3LKOB 1MI5B 1HL5A 3W39B 5C07E 3ZUCA 5B3SB 2EICA 3OQ3B 4KK5D 5CBEA 5DJ6A 5IBLC 4A1RA 2XBTA 1ID5I 1PCSA 3V6ZA 2DMGA 4YK4B 1N3NA 4M1DH 3WNNA 4Z77A 2D4FA 2DKUA 5GRJH 3TF7C 3PGFL 4EN3D 1NJ9B 1IIIA 4QO1A 3O2DL 1SMAA 3BWUC 3AG1B 4GKSA 3BHBA 4AVJA 4M93B 1SQMA 2VDQL 1BZ8A 5EOTB 2P1YA 5HHMD 2DQDH 2Y22A 4YFLF 4P9HC 1PZ5B 4MMXB 5GZNA 4EE2A 4RNRA 5K9JL 2HAZA 3TBTB 4FMKA 3O6FC 1TYEB 5I0YA 1EJ6A 1USQA 1SXCA 2BNQB 1R0AH 1KN2L 1OAZH 2E27H 5CZKA 1XSJA 5DJXB 5TPWH 3T4AA 3M46A 3UGEA 3LVEA 5J11B 7CGTA 1J18A 3EDEA 5D7HA 5KTEH 4LNRA 3NH7L 3EYUH 4J23A 1QLEB 4ONOA 2OJZL 4KKCC 1LMKA 3WO3B 4NZUH 2F5BL 2AEPL 3FCSB 1OAUH 4X5PA 3WFZA 5E8NB 5KAQF 4Q4IA 2X4OA 1T0PB 4XP9L 3SPVA 5I76A 3RAJL 4M1GL 4IBWA 1ONQA 2WO3B 4PRIE 5I1CH 5J06A 3TVMB 3CX5K 4O02L 4FJYA 5HD8D 5IW1B 3AMLA 3D5OF 4AQAA 1KEGL 1S7TA 4GKOA 4ZOAA 3BFOA 1MDAA 5BRZA 5GGRA 4M8UA 3NIGF 4F7KA 4RQQB 4CAGA 3PJLA 1O6SA 2XWBA 4TVUA 4KDTA 4HOWA 4UDTA 5CU9A 5I8KH 2NX5B 1KENL 3U1SH 1E6JH 2VDML 2IBZX 3CFMA 5TDPB 1GXEA 4PW3A 4RH4A 4UB0H 1V27A 2LGNA 2JH2A 3COOA 1INEL 3G5YA 3TZVC 3V2AR 5L2KD 5DJCB 5B38A 1CFTB 2V3FA 4HJTA 3P9MA 4JY4B 4KZ0A 3T0XA 2HFGL 3OSKA 4NLAA 4YHIA 4DZ8A 4Z7OF 2DLTA 2M83A 3OSVA 5F96L 1JK8B 4QNPF 1R3IH 1AZUA 5FYLE 3TO2A 4CNIA 1UA7A 2J71A 3WO4C 1RIHL 4KMTL 3FT9A 3MLUH 3TO4D 4F1ZA 2VDRH 1N8OE 3IRZA 3OC5A 4PRBA 4OLUH 5C08D 1Q0YH 1F11A 2EH7H 3SE6A 1X5AA 4A7VA 4A55A 4XP5H 3Q8FA 4GRWH 1UCBL 4N2CA 3VXRD 1XCQA 2HG5B 2W9LA 1CXEA 2IANB 3IDIA 4RDQF 4ZSOE 4MZRA 1LM8V 5T8IA 4ODWB 3U0TB 2DH3A 2UZPA 4N2BA 2DIJA 3D9AL 5AW1B 2AVGA 3TCLA 3W38A 1A3QA 1OGAA 1KJVA 3HJ0A 4PRHB 1T66D 2X2UA 4RA3A 5I6KA 5KBMA 4MJ4A 5KVEH 4GUQA 4H8HA 3IGUA 1KJ2L 3AITA 2AANA 1JWMA 5JHLL 1XR9A 1GOGA 1NCDH 4P59H 3CK0L 4AC4A 1YN7A 2R8SH 2BSRA 3DX8B 2JQAA 4GP8B 4OZHA 4E9SA 4MD5B 3L4ZA 2HRPL 3MRQA 4UBDD 3LIZL 5KVGE 3IJEA 4UIKH 3RL2A 1M71B 1VLXA 3L3JA 4UTBA 1KSRA 5AOIA 2IC2A 4G59C 1Q9KA 2IG2H 2LTQC 1LEIA 3KLDA 2G60H 1NCBH 4W9FC 3ZR5A 1T1ZB 4M5YL 2OBGA 4HCGA 1HE7A 4P2OA 4QGTA 5D1QE 1ZS2A 1OE2A 1BBJA 1AKJB 3KXFD 1NL0L 1CE6A 4LK4A 2YD4A 3RJQB 1RK1B 5TE7H 3V6FB 3RVWC 2TAAA 1UEYA 4F7PB 3CZFA 3RUGE 1TO5A 4NOFA 5L0QC 4HHGA 3TV3L 2BNRE 1GVIA 2A83B 4OGAC 2B2XL 2DMHA 2UY7B 4C56E 1GSMA 4WCYL 1WCBA 4YDLC 1G0XA 1VFAB 4FL4C 4A6YA 2X0WA 1RH8A 3A0OA 2D3JA 4NN5C 3B6SB 5FHAL 4OIIH 1UWEL 2C7UB 2ZAHA 4HQQL 5CSBA 5HJ3B 1C5CL 2E7HA 1TTRA 2VDRB 3ARDA 4I9WD 5I5IA 3AFLA 4FP8L 4A7QA 1EEUA 4I4WA 1ACZA 1DEDA 1QNIA 4YBLB 1E67A 1QHOA 1TEGA 2ZWNA 5F9OH 5HYEA 4XMTA 3VVWA 3T0ED 1PG7L 2XUWA 4H0GA 3SDCA 4XPBL 1T6VN 3TT3L 2FH6A 4K15A 5AAMC 5FUCC 1LQSR 3ARFD 4YDJA 1TLKA 4YGAB 4YDVB 2DLGA 1M7DB 5C71A 4KHXL 2AK4D 2F1AA 3L1GA 5SWZB 3SOBH 1AXTH 3ZPDA 1FVDB 1CDHA 3PQYE 3G5WA 1YG9A 2I60L 3O8XA 4Q9RL 4GAGL 3SGEI 1I1RA 5BS0D 5J6HA 1QNZH 2YAEA 1A21A 1JGDB 2NW2B 5DS2A 4HVBA 3RJOA 4KRPD 1IE4A 1XF2A 1PPIA 3VI4B 4X6DB 5EOQH 3APFA 1P5UA 3V0VB 4ZS7H 2EC9T 1G1KA 5DC9B 3QORA 2GITB 2P8MB 4PR5A 4FEMA 2YD7A 4DKFL 1HC1A 4UF7C 2AJSL 1EO7A 4D9QD 4P5TD 3QIBA 3I6GA 3RWHB 1IAIM 4K23H 1LO4L 5LCVL 2ID5A 3WFCL 4HIHA 3CBJB 1N67A 4A2FA 3RWIB 1L9RA 2OL3L 1TF4A 2WJ7A 3KLLA 4J3OF 3T0DA 4WWKA 1LHZA 2NSMA 1EXGA 4Z7WB 4GQ9L 5T1MB 3FPXA 3BWAB 4MJIA 2ICEC 3O6MH 2K6YA 1KPUA 4M8RA 4WGKA 5EUOB 1JI1A 1ZLUH 5DD3L 4PJ8D 5I1GH 5KSAA 4M7ZC 1ACYL 3GM0A 5CUSL 4FQHA 4Z5RA 2VIRB 5D5MA 5F7DA 1BXAA 5C0BE 4BHUA 4J8RB 1MI5D 4LCWE 4RMTA 1IARB 5EWIL 1CGWA 2F7OA 4OV6F 3LS5L 3BW9A 1SPDA 5MEOA 3ZL1A 4N2OA 4O9HH 3PABA 2IXQB 3NFPA 3PAVA 3QK0A 4NPYA 5B7EA 1BQRA 1ZA6A 4ENEC 5EIVA 1N26A 3NBNA 1FA4A 1JHTA 5CZRA 1IKFH 4DGVL 1Q9WB 3GXNA 1FFOB 3V6OC 2B08A 2FYYB 2YUWA 4URKA 4PJAB 3MDJA 4W9HC 4FABL 2AZUA 2FUQA 3PYCA 4HXAL 4LRIA 3BX7C 3EF7A 1TZGH 5FM8A 4EQ2A 2WW8A 4M62H 4U1HB 1KFAH 1E9QB 5AOMA 4DK5A 4LSDA 2YEZA 4OF6A 3BAKA 1ZHKB 2BNQD 5AKSA 3P0VL 1RUAL 4W6WB 2VL5B 3CAFA 3BAWA 5ESAB 2X4QB 1NLBH 3RRQA 1F5WA 4NO2A 4NFDA 5DRWB 4NZFA 2V5TA 4ZOEA 4OTXL 2BMKA 1J0IA 5JPNB 2ZE0A 5HYJB 2GHZA 5DHVH 4LARL 2EUWA 1IAOB 2V6HA 1AC0A 5DJYA 5DZOA 5CD3B 1YO4A 2Q76A 3S3SA 5D2LA 5DJDA 4IBVA 5I2IA 3KJ4B 3FFCD 2CJUL 3LEVL 5D7IA 1TMQA 2EC8A 1YA5A 1PKQE 2WVSA 4B9CA 2OR9H 2OZ4L 4XCCL 2WN3A 5KSUA 3VFMB 1T89C 1NPJA 4LLYA 2W1NA 3DGCR 4Z7UE 4FAAB 1GZQB 2JJTA 3TVMD 2PR4L 4M9OA 4NWUH 1NFIA 4AKOA 3LN5A 1T4WA 2WK2A 4YXKH 2FECL 1OF2A 4Y5YB 4LHUB 4RZCB 4FULA 2WLNA 1AGEB 4JFVA 5D5MF 3RVVC 3KL3A 2VDOL 1FZJA 1V10A 4GO8A 2J4WH 5IBUB 1CFVL 2NX5D 3PWVB 3DNKA 3OHMB 2PTVA 4LQ1A 4M3JA 4RFNB 1HQ4B 2CR0A 3IDNA 1IGIH 2BCMA 1FYTB 1IC0A 3C5ZA 4NKMA 5I24A 3TCTA 1LJMA 3VMNA 4LESA 3HN5A 5C6WH 4GW1B 1QASA 1UM5L 3AAZA 4N2GA 4RMUA 1KXTB 2YOAA 1LLAA 3MROB 3BKCL 2X1QA 5CILH 3S37H 4DN4L 3V6BR 4PV9A 5CEXB 1OCZB 1PF3A 6FABH 4UOQA 3RIAK 4TL5A 4F2EA 5DHMC 2BWDA 3M7FB 4KI1A 4L4TE 3GLDA 3WNJA 4ERSH 3ZL4L 3KGSA 2K9FB 3ZE2E 1KLUB 1OVZA 4KO5A 4U0QB 5A7EA 2IAND 3TFBA 2E0PA 2P43B 2YN3A 3ULUH 4JPVH 3FQUA 1BXUA 5K9KB 3ZYJA 3QCTH 4BSJA 4DK3A 1U8OB 2BOCB 1RMFH 3L4CA 4F15C 4DVBB 3MUZ1 3LNIA 5DHVB 2RHEA 4X7EC 4XNUL 3VFPA 4PRHD 3BGFB 2BDNH 3D4GA 3CZLA 5IK3B 3MQIA 2X4TA 5IM7A 1QKZH 3C60C 4NYLB 3FU7B 2VO8A 1K2DA 3FK3A 1T83A 2LW3A 4U1GB 5G5DB 1J0KA 5ETUB 3MV9A 5LNDA 1XL4A 3W3BA 1ZLEA 5FW7A 1CPUA 1GKOA 3O9WA 2ENJA 3IAQA 1BWWA 1BD2B 2UWEB 4PJ6A 3HE6C 4BSWA 1IAKB 2VR9A 1YAZA 2C9SA 2CU9A 3FUNA 2NY4B 4LHUG 2YPLA 1AKJD 2WV3A 4JO3H 2N59A 4K7FA 5IBUG 4DPCX 2FEDD 3FTYA 1L6ZA 3FSAA 2NXYB 5IMMB 1TJIH 5AW7B 3MBWB 5SWSB 3EYFA 4KI5D 5D4JA 3KDMB 3AY2A 4ONFH 3KBPA 3U2IA 4CILA 1R5WA 4U7KA 3TJHD 4FJ6A 1Y7VA 2A77H 4TPRH 1KIUB 4K3DL 2JKIS 1LWJA 4I2XA 4B9GA 1GMEA 3CN1A 4OVVA 1SLXA 4LBAA 3SGKC 4NNPL 1J12A 1HOCA 2I85A 2PW1B 3MUJA 3V0DA 4A2EA 3KPSE 1S9XB 1A4JA 1GMIA 2D0GA 4TM9A 5KG9A 4FS0A 1P5VA 3OZ9H 2IPTL 4MZ2A 3PV6B 2HB0A 4IRJA 3U4EB 2QV4A 3GFUA 2CMRL 2DWSA 5CU5A 3VFGH 1H5BB 3K72B 1A5FL 1M2VB 1O7VA 1WGVA 1QYGL 4XMPH 5DVPA 1U58B 3P11L 2FH8A 1BM3H 1PZUB 4HIJA 3L4TA 4YHOL 2EXWC 3ASNB 5B1CA 3HRZC 4TVPE 5CHNA 1ULVA 2HPOA 4FX5A 3UTZA 2LU4A 2FJHA 4MXVF 3V10A 2WBKA 3EAKA 5LB1A 2HMIC 2YSSA 5SWZD 4AG4H 1DVSA 1Q9LA 2NZ9D 2XXGA 3R1GL 3EO9H 2MSPA 3MV8A 1WE5A 1BJ1H 1GY1A 4ZNEA 4A2GA 4LKCA 2QT6A 1CE1H 2O26U 1G1OA 2X28A 4QTHA 4BSVA 1J1PH 3OB0H 5ITFB 4ZO8A 5ANHA 1AFVL 4FQ2H 4LF3A 4ONHB 2H2SC 5AVUB 2R0ZL 1JL8A 5K9OA 4M6AA 3BPCB 4AE1A 3B34A 5GS0L 4GAAA 1E8ZA 1S4IA 5FGRA 3U4BH 3X12A 3S96B 4G8GA 3P4OA 1NCCL 4M6NL 2EDBA 3BVWA 3VFWB 1EK3A 3I6SA 3V0GA 4P57A 5FOBA 3TL5A 3MTXA 1NM4A 5DQDH 5EC2B 5BVPL 4TNWK 1YN6B 4N90E 4G9DB 1DJXA 4H1LA 3QWQB 4LO9A 1BDYA 4FQJL 2HT2C 3MRLB 2PP9A 3P0YL 1YPZA 4MA1B 1I9JH 3U25A 2C26A 4OI8A 5C3LD 4LCUB 4EI0A 1CZ8L 5AZ2L 3N40P 5E6IB 4DEWA 3CHXA 5FYJU 1S7XA 4BH8A 1M3IA 1FSKB 3SE4A 3ILPA 3BP5B 5AB2A 4QKTA 2VZOA 4XP4L 2PWFA 4LPXA 2JLPA 2OSXA 4ZD3H 4PGEB 4WTZG 5C0EB 1HIML 4HIXL 4NKOA 4P4KA 1D9KA 1S78C 1KLGA 4FG0A 4MQ7A 3ALWA 3CQQA 3AXHA 3QPQC 4F33B 1FIGL 3CHPA 2DDQL 1FPTH 3P4NB 3K2UH 4M03A 5BRPA 2VM9A 2WQWA 2WWKO 4FG4A 5BUAA 1MOEA 3VX1A 4BV1A 4JY6A 5L88L 1OB0A 1XEDA 2DY2A 3B2UC 3T3MF 1RD6A 4FZEL 4PJIA 3MU3A 5IGXL 1CDIA 3E6FA 1VFMA 1FNEA 1TKWB 3PREA 3BH8A 4OZIF 3NJVA 4MNHB 3UACA 1QTYT 2JCCA 1ORSA 1TVBB 4PJ9B 2VXQL 4GSDL 4A7GF 4A2DA 2XNAB 3W81A 4B50A 4HFUH 1PZBA 2NR6C 1XB6A 3HBQA 3TFKC 5HYJD 5L7XH 2A1WH 2DQIH 2VDKH 1BAFH 4ELMF 4HFWA 4NN7B 1XF3B 1NSNL 2QFRA 4HUUB 4XO9A 1ASPA 4X99B 4NQUA 5IW3A 4D0BB 4NAMA 3GZKA 3SY6A 3W11C 2CXGA 4MNQA 2JKTM 1H6TA 4HWBL 4KKLD 1HZHL 3D3VA 4L4VE 3W9EB 4F5CE 1FAIH 3UJJL 2P47B 4AOFA 2WXOA 5KS9B 3U0WH 4AEHH 4PS8A 1GS7A 4GUPA 2WMPB 3JV5A 5JOFA 3KBFA 3SDAB 4LHUD 4BCZA 2FO4A 5ABZA 1XB8A 1MFDH 5HHVH 2NTSP 3FRPG 4B41A 4BUQA 2BJMH 2DQFB 3K6FA 5IIEA 4JGJA 4WW1A 5E8OA 1TFHA 3GXTA 4R0LC 3BPNB 2NW3B 1MFEH 3L3HA 3VU1A 4B9ZA 3IU4L 1FYTD 3BQUC 2ZCKL 3O11A 3QEUB 1X5FA 3MO1B 1UXSB 5C0CE 4GRLD 3HN8A 4XMLL 4D9LL 3G9AB 3UG3A 5JR1H 4XMXA 5MI0C 1JPST 2DLFH 4X6EB 3FO2A 2KC0A 3DX4A 1I3GL 2GY7B 4OIFA 1QEWB 4GBXC 3MRFA 4I48B 4MD4A 3IMTA 4BWWA 4LGRB 4MYWB 1DVFC 2UXGA 4GKZB 2XV2A 2CJ3A 1HH9B 4LZKA 2PYFB 2H2PD 5HI4D 5L8JB 4W6XB 1NC4A 3L7FA 1V7MH 5FIEA 3RWEA 4XX1E 3WKPA 5IB2A 1G9NC 3MNMA 2H0EA 5C3TA 3OTTA 1FJ1A 3QB7C 4EPSA 1NAKL 2QPUA 2W9DL 4YH6A 3ML8A 5LJYH 2GTZB 4UQ2B 2Y2WA 1SVBA 2YKLH 1ND0A 3D0AA 1HXKA 1MCHA 1RZKC 4PB0L 3T3PE 1ITBB 2VN7A 5KBPA 2R23B 3UYRH 1F4WH 4WU5B 1R3JA 5SX5H 3FUIA 1FHNA 2DWEA 4JR9L 2P80D 1T2JA 2A38A 4H0LC 3OHXA 4PVMA 2L3BA 3GSOA 1BD2D 1URIA 4X7DC 4X4XA 3RYMA 2F7RA 2DKMA 5F70A 5C09A 2DWDB 4LSVL 4PG2C 4UAHA 5D7JB 1Y0LA 5HDOA 2ZUSA 5FYKL 5HDLA 2NY4D 2CHZA 3LKRB 4NO3A 3TH3T 1SVCP 2G0KA 4E5XB 5F89A 1A2YA 1N0LB 4M48H 4IKKA 5D9SB 3VI3F 1EHNA 4Q7DA 1KPRA 4KV5F 4H40A 2X44D 5ESQB 1A3ZA 4LCYB 5E99L 4G71B 3ULVL 1IAIL 2NXYD 3FCTB 1VGKB 2L0DA 5DUMH 4AQEA 2V5YA 5JQHC 4IOIA 4JFDA 5B8CB 1ET5A 1OCCB 4PAZA 3TBSA 5SWSD 2EH8H 1KN4L 3NZHH 2JIXB 4JKLA 2NQCA 1ZLUK 1RZ7L 4FC3E 3KJ6L 4UT7L 1KCLA 5DVKA 1H8LA 4Y4FC 1OGTA 4NWTH 2HT4C 2WHVA 5AYQA 1NWOA 4OJAA 5GISH 1JZHA 1GTNA 1D5IH 4V1DD 1D6EB 2J1XA 1TNNA 4MGXA 1E50A 3RZCC 1EV2E 1ZEAH 1CL7I 1G4MA 1J9QA 1RLWA 1ZT7B 2AEQH 3GSNA 3DUHA 3J8F7 4L8DA 5CZXC 1OTTC 4XZUB 3G6AA 3HAEH 4OJDH 1GYUA 2CIIA 1SJEB 4H44C 3HZKB 3APDA 3RX7A 3I75B 3DO4A 3FS9A 3OLEA 4N0CC 3U2SA 5ICXA 2FX8H 2Q86A 2CALA 5JOPD 3ULUD 3B3IB 1MF2L 1ZLSH 1G7JA 4JDZA 5AVZB 5EFIA 1GA2A 3CC5A 4L1SA 4Y5XC 4PJHA 5IFAL 3C08H 3EUDA 4I18C 1WBZA 1GGCH 4KJYA 5F7FA 2XQBL 5BRZE 4YGVA 2UYLB 3DA0A 2WLHA 1Z0MA 1IM9A 4L9LC 2WXFA 5LGYA 1AYRA 3CXDH 3ZE0E 3FQ2A 2YWZA 5D6CA 1P4BH 4L23A 5GHWL 3CX2A 4GXVH 2Z4QB 3SGEH 4Q74A 3U30C 1VIWA 1IEAA 1HSAA 5EU3B 4Y7OC 4NT6A 4ZT1A 4IJ3C 2EDXA 1OOAA 5DRNA 2ITEA 4LAQH 1S3KH 3BUIA 2H26B 2TRYA 2APTA 3HHMA 1AHWC 4I77L 4QXWA 5FGSA 1D5ZA 3CMOL 1YMHB 4HIIB 1JK9A 1M3JA 1RURL 2D7TL 1DANT 2R7EB 2PP8A 3JZYA 4RGOL 5CLYA 5C3IA 4MA3B 1AD9B 4NUJA 3CFJB 4NZJA 2IQ9L 2HFEB 4IBTA 4DGIH 3ZO0A 4Q0XH 2C8NA 2RQ8A 1JZIA 1K4DB 1MFNA 2WBJB 5DZAA 4G42A 3BZ4A 2BM3A 2EUVA 4HSQA 2HLFD 4ZFFA 2ICES 5DJZB 5DQJA 5KUMA 5C07B 3W37A 1BF2A 4N2FA 5MERA 5CJOH 5GJTH 1MJ8L 4KKBC 3ZE1E 1S7UA 3KE0A 3PDOB 4YSAA 2ZCLH 2UUDK 3QPKA 5E6ID 3AJ7A 4YFLI 4Y19B 4OCWH 2AGJH 2C9AA 1OGAE 4IU3A 4GKNA 5BCAA 5AUMA 3QJHB 3HAEB 3F5WA 1M7IA 2ICWJ 2JI3A 2BP0A 3DOIA 1OQOA 4JFZH 3RDTC 2MTAA 4OZHE 5FYLH 4X4YA 4KNUA 3ECBA 5GGRY 5T3ZL 1JVOA 5HHPA 1FE8H 5JZ7C 4Q9BA 2FEEL 4PGDA 1F1AA 1BP3B 4FLQA 3LS4H 4WKZA 5IHBA 1B2WL 2W0PA 2EDMA 4HJSA 5E6RB 3F83A 5TK4A 3CDFA 5A6LA 4HC1L 2X1PA 4AUJA 4JHAH 1RZGB 3QQ9C 3GC3A 3HG4A 4GQQA 2UY6A 1R5IB 3ESNA 1UOLA 4UAOB 3PNWA 3EDKA 3ME0B 2GK0A 3FQRB 1YDPB 5CLWA 1FNGA 2C3GA 4NNYB 3VACA 3LNGA 1E4XI 4JDEB 2G3NA 2E7LC 2LLLA 4M1DL 1ZHNB 5HJBA 1U8IA 3L3OC 3X11B 3LRHA 3Q9QA 4JRFA 5E2TH 5KVGH 1JPGA 3GXFA 4P23B 4PGCA 3GT6A 1M4KA 3AT8A 4WHTA 3S4SA 2AFNA 2R0WH 3ML9A 4AENA 3WBDA 2AZAA 4KNTA 2AERT 3MJ9A 4DKDC 5GGSA 1F6AA 1F4XH 4C83B 1OLZA 2O93L 2A2QT 1DQVA 3DTXA 5CGBA 4G3YL 1IGTB 4U2YA 4WO4C 4ZW6A 4BK4A 1F18A 3VRIB 5TPWL 3RTLA 1HCYA 1K4CA 2QFPA 5JPMC 4U3CA 2IQAB 3DVNB 5KTEL 1I9IH 5KVFL 1NGPL 2DQGL 5IT2L 2YPKB 3QA3B 2NNCA 1KCWA 1MUJB 4NZUL 1MCOH 2UXFA 1ZHLB 1HINH 3RBSA 3EOTL 4E0RB 3VFNA 3TBWA 2ORBL 1JMXA 3OC8A 1L9OA 3LZQA 1RULH 3ABGA 4XCFH 4BWTA 2XPZA 1TPXB 4F9LC 1UKSA 4LCCB 1JWSB 5KBDA 2BOBB 1JERA 5J12B 2OMUB 3AY4C 1S7QB 2XRAL 4KTEH 4ANXA 3CQFA 4AE0A 2Q2EB 3H7BB 3CZJA 3HB3B 1O7DC 1ZJBA 2GIYA 3NK4A 4ZSOB 2W0FA 4OLXL 4WEBL 5JHDA 2PCYA 1E8YA 1QTSA 3CCHA 3MCLL 4U6TA 3T2PA 4PSRA 4F24A 4TUOB 3PJSA 2V8LA 4OCLC 3QZNA 3U1SL 5I19L 2WLKA 3CSGA 2VH5L 3FONB 4JMXA 2HG0A 5EOCJ 5ERWA 2UVEA 2YD1A 1CIDA 5TD4A 4HJIA 4JQXC 4MJIE 3BD4A 3UTOA 3ZR6A 2DMKA 1S6NA 3I6KA 1ZV9A 3FT3B 3TTSA 4XBGA 3CFCL 3T2NL 4A7TA 4HALA 5GGTH 3K71A 4MCMA 5INCB 3VTTA 1IE5A 5D5ME 3IMUA 4EOWL 2NQDA 3L16A 3OB0K 5D1QB 1X5ZA 3BZDA 1I7UA 2EH7L 4IHOB 4D0CA 3BCDA 1GAFL 5BJTA 2MEJB 4WJ5B 4OQTH 1A7RL 3ZDYE 3DDFA 3DO7B 1L9MA 5CCKL 4C54A 5D7JD 1OW0A 4HHAA 3MACH 1YEGH 2MQ0A 3RUGB 4CVUA 1JGUH 12E8H 3C09B 3OAZH 2IGTA 4JG9A 5D71H 1HEHC 4UTAA 5KSVB 3ARQA 1A47A 1I7TB 1G7IB 2P48B 2BNRB 1WBXA 1P1ZB 3NSYA 4Q14A 4OFYA 4E42A 4OIAA 5F7EH 4C56B 3HFFA 1UD4A 4TNVF 1HHHA 4XNMA 1GH7A 3ZGIA 2C1OA 3WXVH 3S5LG 3BKJL 2MOQA 2DBLL 2JIXD 4LSUL 4R84A 1KBGL 4Z7VF 2AP2A 2G3MA 4LHJB 2E75C 4A7SA 2IG2L 3WHE0 4XTRC 5GS3A 4GG6A 1DUZA 2R29A 1XWVA 3U46B 2XA8H 4PW4A 3V0AC 2APXA 3AU1A 4S1DD 1CT8A 2FJGA 1NDMB 3M1BB 1Z2KA 3BDYH 1YCSA 1IZJA 2V33A 4PJXF 4WV1A 3VRLF 1F4YH 3UP6A 4X9HA 4PHZA 3POCA 3ZQXA 1NM9A 3VD4A 4X9GA 2YGQA 4XCEB 2ZAIA 3M17B 4Y4HA 4N8CL 5D7IE 4KY1H 2FT7A 4QHNB 3ASOB 3CX5J 3EUUA 3QE5A 4XPGL 5CSZB 1EA9C 4S1RH 5EF3A 4EDWL 3EG9B 2YIHA 3K5SA 2XN0A 3TEZA 4J4PD 3WTTA 3OKLB 4G6ML 4JN2B 1N18A 2G3ZA 2WZ5A 3LHPL 2X2JA 3FU6A 4H8VA 3HKFA 3US0A 2H3NA 5HI5C 1FGNH 1MRFH 1MQKH 4NQDA 1SRDA 3VSVA 3W57A 4XAKE 1XZ0B 3LPFA 1TVHB 1ZVSB 4KDWA 5FXCH 2XKNB 3BVDB 1K3IA 5H2BA 1BF5A 5TE4L 3I84A 4LLMB 1I8MA 3FCBA 4OGYH 4XI5D 1I3RB 1ZPLA 4FXKC 3S0PA 1MREH 3KLAB 3B8YA 4LVEA 1FFQA 4N6RA 1U6AH 1KV7A 4K55A 4CJ1A 5LBGA 1QSFA 2F58H 2QKIC 3DGDA 1I75A 2ERJB 2A0LD 2QTEA 3SOBL 4WTXA 5L6YH 3PAUA 1KCSL 6CGTA 4XPFL 3PWLB 2WBJD 1PDKB 4FTDA 1OCWL 1WRFA 4ZOBA 4XNYH 5C0BB 3VQ2C 5E7BA 4L1DA 3ARSA 4LCWB 4GG6F 5C07D 4HOZA 3DDGA 4NRXA 4YL9A 2FQFA 1KACB 4MSWA 1I8AA 2R2HA 4ADGA 5BO1H 1WFOA 3CSTA 3U7YH 4AITA 4CVZB 4AEIH 4WTWA 3L81A 5LDSA 1H0DA 2QGBA 1RZFH 1QWNA 4BUGA 1MCSA 4TRPL 4H2AA 4XNZB 3WHXA 4X0KB 4ODXA 1BCIA 3DLQR 3OX8B 3UTQB 3MV9E 1MJUL 2F0CA 1UD6A 2ITCA 5ALBL 3RTQC 4ZOCA 4M8QA 4O4YL 5DGRA 1RZIB 4HXBH 4FNQA 3HBPA 2CA3A 5KBLA 3LQZA 3RWCA 1NUDA 1TG8A 2EDEA 2YPLE 3ZSTA 4TV3A 3WEXA 3DV6B 3MMEB 3BVNB 5GS1B 3KWWB 2Y06L 5ID1A 5EEWA 5D1XC 3QCVH 2AV1A 5A43C 1AKPA 1JVLA 1AGCA 5EEZA 3HC4H 2OMVB 1HHIB 4KJWD 3GD1C 1P84J 4AT6B 1EHLL 3E9TA 2OR8A 2BZDA 4KK8C 4PLNC 5C0JA 2J2ZA 1PKQB 4I2XE 3EYOA 2Y5EA 3MRRB 5FGBC 4EDXA 1W0WA 4Q9QL 1BEYH 2CLZB 2CO6B 2KKQA 3ARTA 5IESH 5SX5K 4P23D 3D09A 2HJKB 2N3JA 4Z7UB 3TPKA 3QUML 2COQA 7PAZA 4X7FC 3FDWA 2ZOLA 1GY2A 4M4PA 4ZBJA 4M62L 3M86A 1XMEB 1PU0A 3MAWA 2J25A 4NQVA 3Q01A 1N6QH 3ROOA 4FNRA 1LO2L 3U36B 1A3LH 1J9TA 3VE0B 1SFDA 2F19L 5D2NC 2VQTA 1KEMH 2RB8A 1JG9A 2X4SB 2PYEA 1X6NA 1CF8H 5D72H 5E94B 3VDCA 2B8OT 4RWYL 4PLJC 1ZSDA 1XD0A 1TIUA 4PJBA 1P4LA 1B4RA 1CQKA 2YHGA 2JE8A 1U30A 2QGDA 4J28A 5JO5B 1K8DA 4CVXA 5JXAH 3MV8E 1DQQB 2ZAGA 3GMNA 4ZNEE 2CHXA 5E8PA 2H32A 1KTLB 2ZPKH 3IMVA 4IU2A 3LZOA 3FFDA 2NT1A 3TT1H 5I15L 5TF1L 3G5XB 3IN2A 4URTB 3ZE2B 3S37X 2D9QB 2B59A 1EFXA 4G8GE 3EO1A 2ZSWA 3D25A 5JIPA 4LLQB 4QEGA 1V7NL 4W93A 5GSRA 2Y7QA 4FA8A 2A74B 1EEYB 4BGLA 2FWOA 3FT2A 2CD0A 4MD0A 2ZCHH 4TVPH 4MAYB 2BVEA 3FQWA 1BZ9B 3QEQA 4OCSH 1PLGL 3BXNB 3EOAA 4PJCF 3OZLA 2YZ1A 1YPZE 3C6EA 3MNZA 3C6LB 3X3FH 4C4KO 1H6FA 4QRSA 2NY3B 3I3DA 2AEWA 5B3JF 1IEBA 3C8KA 4GT7A 1PNDA 5D1QD 1KTCA 1XGUA 4BYHA 3A47A 3DC0A 3V9EA 1NLDH 5A2IH 4ZFQA 4IIQB 2HXAA 1X5IA 2Z1PA 1BVNT 4G6JH 4RETB 4ZFZB 5EA0L 1U33A 3O6FA 4QLRA 3LRSA 4ADIA 4OD1H 4DUXA 1NCJA 4HKBA 4AQ1B 2PW2B 4FNLH 1P69B 2LU5A 3S3CB 3ZTNH 5I30H 1UXWB 2BNRD 3W2DH 4RAUB 2BDNL 1DVZA 4YNYA 4C56D 4PJBF 1AD0A 4XWOC 1HAWA 5D8JH 4DUWA 1G6VK 1LEGB 2DQTH 4ISVA 1S7RA 2J12B 2A6KB 4X8CA 3KPSB 4PJIE 2C9QA 2HUEA 4NQCA 4XMKL 2HVJB 1ET8A 3GHEH 4HS8H 1C8PA 1IGJB 1XGRA 4FXTA 1QVOA 2AJVL 4UT6L 4XC1L 2JCCE 3CFDB 4LP5A 2QZ5A 8CGTA 1GIGH 4UYQA 3GLZA 2B4CL 1BYPA 2Y3NA 1CL7H 1PZCA 2W65B 3RFZC 3LKNA 3MNDA 1B4TA 1BHGA 4JHWL 2YPVL 3FF7A 4PJFF 3DETD 2APVA 5DZVA 3VXTB 3KGTA 2E4TA 2VXUH 5BZDA 1WUZA 4Z0XB 4MS8D 1A6TA 1XF4A 5B39A 3II3A 3NCCB 4IRSB 4PEEA 4I89A 3WFBL 4ONFL 1A7NL 2R1XB 3D2UB 4R5VA 4NN6C 4MNQE 1P6AB 3LKPB 2ZOKA 4LP4A 5KJRL 3VG0H 1GC1L 3D3VE 1CLCA 3PQYD 1CURA 3O41B 2DLEA 4JFFA 2GAZB 1C12A 5F7MC 2ATPA 5E4AA 2WP3O 4L5FL 1SOKA 3CUPB 1DUYB 1DBBL 2EYTB 3WS3A 4N5ED 3BWUF 1YUKB 5HHNB 1CFQB 4AK1A 1YNLH 3FU8A 3PL6B 4Z3IA 3S2CA 1PYWB 1QHPA 1YEEH 2C3VA 4UDUA 3VFGL 5F8QC 4FD0A 3BSZL 3DX9A 3X1FA 2IWEA 4YXHH 1OSEA 1A8ZA 2A9DA 2CA4A 3MLRH 1N5AB 5I8OH 1AS7A 5EORH 4YO0B 3EH5B 2MQGA 3IEAA 1EO8H 3GSWB 3KPMA 4PVLA 4Y9FA 5BOZG 3VX0A 3MRGB 3RKPA 4L8CA 5IMKA 2HFFB 3DJ9A 3QZWB 1U2CA 4HF5L 2PTTA 5F7UA 2DJSA 3BUDA 5J8OA 3CFKB 2BVPB 4U1IB 5I5RA 4LSRL 5C0BD 1ZT1A 2NYKA 4LCWD 1JIBA 1BQ5A 2FD6L 4UQIM 1D5XB 5FHBH 32C2B 4LLUB 3PP3H 5JUEH 2VR5A 1IBFA 2BFGA 3FT4A 3VM7A 2FATH 5K1VA 4LEEA 1BOGB 3QUGA 4ZMVA 5DQ9B 3SDDC 3JV4B 3H8NA 3Q06A 2EYRB 1JUFB 1MW3A 2V2TB 3H2QA 2KBGA 3EW3B 2C1PA 2OP4H 5FECA 2UZXA 4JGUA 4DF9A 4FNUA 4ZK8A 5HI3D 5C09E 5CCGE 3QISA 2RMNA 1IQWH 1QI4A 1FQ9C 2Z64C 4X8JB 3QIWC 3UADA 5CFAA 5CM1A 1FRGL 1XGQA 1SXZA 2VABB 4PRNB 1HSBB 3GZQA 1W9XA 2QR0A 4MA8L 4F8PA 1H6EA 4LSSH 2VJ8A 5DK2B 4GO9A 1XL6A 4BFGA 5G2NA 4JFDE 2C9PA 5DMGC 1QBML 3EDDA 1S8DB 4JO5A 3AQDA 5FO7A 1Y18B 2E4FA 1OTUC 3N43B 2MCMA 2PMZA 1E4XH 1UENA 3BEVA 2G0LA 2V2WA 3AG4B 4MHHI 2VAAA 1OCOB 2BS71 3RX8A 4BZ1L 1D2OA 1AIZA 3V5DA 1FC1A 1KLFA 4L8SB 1XF5A 3O3AB 3K2UL 4ZMPA 5A3ID 2HVBA 2ZUXA 3CPLA 1SOQA 3SKUD 5AAMA 5DMIH 4XXCA 4IK6A 2YA2A 3C2SA 4L4VB 3OXSB 5E1AA 2F15A 1KGXA 1LWHA 4N8VB 1MCQA 2XV6B 1CLOL 1DQDH 1N59A 4G83A 3TIDB 5F1SA 5KANG 3VFOB 1KXVC 3OAZK 3HS9A 4UINL 5JW5A 2X05A 1MHCA 3RG1C 2Q7YA 2VLKE 4PJHE 2DQIL 2VDKL 5C0CB 2PP7A 3T09A 5EF0A 3FULA 4F93B 3V4PL 4MJJA 2ED9A 3FHAA 3MXWL 3OV6A 1UKQA 4HLZG 3S88H 4O2EA 2ITDA 4P5KA 1RQ5A 3MA9H 1GGIH 3ZHFA 4OJFL 4PBXA 3H42L 1H3PL 4OT1H 2WQXA 4OUUB 1IQDA 2R4SL 4OLVL 4OJEH 5F72S 1M1XB 1MCIA 4GW5A 5AAPA 2PCXA 3LXBA 3Q5YA 1EGJL 4HS6A 1A6WH 1PJ9A 2ICEA 4AQOA 1NUNB 4DCQB 2K3TA 2A6IA 3B7YA 3BE1L 1TETH 1WIPA 2XWRA 4FHBD 2DIEA 3TBBA 3L9RA 4HH9B 4OM0H 3V0IA 3IKKA 4FMFA 2AMUA 2QQNH 4MNGA 5EHFA 5AOZA 3WFDH 2B9AA 2CDFB 3ARPA 4QF1B 3FO9A 4MAYD 2ZYSA 3T3PB 3D06A 2BSSA 1T0NA 3T1WA 3DHMA 1A9VA 4G8EA 3SZ6A 3HZMA 5FFLA 5JR1L 3F84A 3N9GL 1DVTA 3ZT5A 1T03L 4ZMWA 3Q2CA 3C6LD 4XB8A 4GOSA 5CBEB 3T8XA 2VSKB 2AQQA 3CDGA 3MSPA 5DJ6B 1LD9A 2EEXA 5I75C 4YIQA 5GS0C 2C3HA 3K7UA 4NO0A 5AW9B 3V6OA 2BS8A 3V6ZB 3O3EA 2OMTA 2NLJA 2YOCA 1T1XB 4Z77B 1WIOA 3BRGC 3P0GB 5JQIB 3AW5A 4MASA 3IGLA 4QO1B 4MQSB 2J6EL 4GKSB 2YUVA 3BHBB 4FQLL 1YJDL 4RISH 5FLVA 5GGUA 4HWUA 1GJUA 2FIRT 4N0YH 2YKLL 3KL5A 2AMGA 4G43A 3JWOL 2YGNA 4RNRB 5DFVC 5CEZE 4BWUA 3OJVC 1F4WL 1UH3A 3K4AA 1L9NA 3ZL2A 1SXAA 3T4AB 3QNYA 4I0PC 2WWKT 1CGTA 2WUCL 4PP1C 3KPSD 5BMFH 1AVAA 4M5ZL 4LNRB 1JCKA 1DO6A 5KVDL 3WDIA 1DDHB 2WCSA 2ATKA 2GIMA 3B83A 4OF3A 2ADJA 2LVEA 4YLCA 5D93B 5TH2A 3H3BC 2NYYD 2GABA 2NY2C 5I0DA 4DW2H 1JCVA 3UAJC 1A0QL 4KXDA 1DSYA 3SPVB 2WGNB 1NBCA 2F54A 5I76B 2D7NA 1Q9OA 4UTBH 1ONQB 1NCWL 4NIYE 4RGMB 5F7HA 1KCVH 4TVPD 4AQAB 4IRSD 1S7TB 3RQ3A 3BH9A 3D2UD 1X7SA 3LNEA 1V55B 3OLDA 5F88A 4PTUA 2YK1H 5GGRB 5BRZB 5LNGA 3ULAB 4JKNA 3RA7H 3FUKA 1O6SB 2XWBB 1NIAA 3ZE0B 4UDTB 5I1JH 5FLUA 1C5BL 1SEQL 2PCFA 2X6MA 3OZKA 2QBWA 1I8KA 4KVNL 4J3OH 3V0JA 2AEQL 3G5YB 3N2JA 3TCXA 3VD2A 5B38B 1YEKL 2BVOA 1U8NA 2Y07H 3P9MB 3PL6D 4XNXL 15C8L 1DQML 2V9RA 4YHIB 3T6VA 4BFJA 4U6XB 4DZ8B 4A6YH 1LYQA 3T08A 3VB9A 3TO2B 1PAZA 4CNIB 4WW2A 1VSCA 2PCPA 1WVZA 5EV7A 4NJAH 3E8UL 1QR4A 1O9VA 2CZNA 3DUUB 2BRRL 4N90D 5DC0A 2YARA 3DPBA 4JEGB 4G70B 4N5UA 4PRBB 1JYVA 1F11B 4Q58C 3I6LE 2AQRA 4PJGA 4KH9A 2VLME 2XTJE 1XCQB 3IDIB 5JHDE 2P5EA 2WWOA 3ZE1B 3C60A 3HEIB 1QRNA 3DX3A 4JAMA 1PLBA 5MEPA 3CFIC 1UD3A 1QI3A 2C4XA 2FTAA 3FYEB 3FQTA 3RBGA 3TCLB 3DK2A 1OGAB 1KJVB 4MDRA 3CLEL 3AZUA 1JWMB 4X5QA 4YZWA 1XR9B 3S34H 3P54A 1JZ2A 1YN7B 4XHQA 3WGVB 2F68X 4JPWH 1IJNA 4KKAD 4OZHB 4HX1A 3UO8B 3N0AA 3MRQB 3K0WA 3DMMC 3HNTH 5GGSY 3IJEB 3RL2B 2J1WA 1DBKH 3L3JB 3N3EA 5IMLA 3L3KA 3CE1A 1LEIB 2EIZA 2O5XH 3IJ9A 3EHBC 3I9GL 2B3RA 4P2OB 1BBJB 2BFVH 3MCYA 1X9RA 1CE6B 4WHYH 2D0HA 2C9VA 2D2OA 3EO0A 5CJOL 1QA9B 5GRVL 5HGHA 2CUMA 4KKRA 4PCSA 3CZFB 2J88L 2ZCLL 3CVHL 4KROB 2ITFA 1WFUA 3MKGA 3SGKA 3MCG1 1QLFA 3RPBA 3W56A 3IU3A 4B96A 4JFHD 1TTBA 5CN2A 3E2HC 1WCBB 3ZBMA 4M7KL 1IB5A 2SEBB 4U0RB 1WAEA 4A6YB 2LE9A 2SODB 5FYLL 2MQCA 4GMSH 3IRPX 5EU6B 5FEBA 4WW2F 4ZMOA 1QR1A 3BPLB 1JRHI 3VDBA 4GG6E 1MFCH 3ARDB 1WEJL 4FFYA 2OCCB 2D4DA 4RFOH 4HAFA 3FAXA 1Q94A 1AQ8A 3D39A 3FB8A 2YMXH 4I4WB 3HRZA 4U4BA 4N20A 1U3YA 4L4VD 1HNGA 4DQOH 3SDCB 3NABL 3ULVC 2WYIA 1L5GA 3FO0H 3QNFA 3D08A 4KFMA 1JZEA 3VH8G 3WNIA 1E0OB 5CAYB 1AQMA 1A7OL 1D7DA 1P7BA 1L0YA 4DPAX 3AQXA 3T1FA 3T65A 2R4RL 3RY6C 1E5ZA 2HKHH 4W9LC 2DL9A 4XPTL 3V0WL 2FVNA 3O8XB 1KTDA 4V2BA 5C0CD 3A4FA 1YQVL 2JXMA 4NQDE 5J6HB 2Y1ZA 3NZUA 3GKWL 3EBIA 2VISA 1MCPL 4KJPC 1XF2B 1ADWA 1P5UB 4TTGA 1WTLA 3H4FA 5DD5H 3QORB 3FB5A 1A3RL 4PR5B 4U49A 4JKPH 3VMPA 1INDH 1MRCL 5DYOA 1DJHA 3QIBB 4NSKA 3I6GB 3KL0A 4HIHB 4XP1L 3O0RL 1BQSA 1EMTH 1QSFE 3C2AH 1J5OH 4YHZL 3MBXL 3WLWD 4WWKB 2EUZA 3RGVC 3DOHA 4NJ9L 2WXNA 3MOBL 4MJIB 5FAAA 2DM7A 1DN2A 1KPUB 2UX6A 2ZYIA 1NFDA 2Z0BA 2Q8AL 5KSAB 2NCMA 2G4GA 3NQIA 3FCSA 4N8PA 2EZ0C 3WDHA 3GSRA 1WA2X 4FQHB 4Z5RB 4LVOB 5HHXH 4Z78A 1I85C 4LEXH 5F7DB 4UYPA 3P02A 4N87A 3NGBC 3X1NA 1QSEA 5GRUL 4FRWA 3BW9B 2JMRA 5MEOB 5TQ0H 3WLBA 4GAFB 4MXQD 2FJFA 5JW3H 3PABB 1WZMA 4R4BA 3ZDYB 1UM6L 1AQDA 1FL6B 4NPYB 7FABL 4HUXA 1IKNC 4NHCL 1ZA6B 2HX8A 2JJUA 3EJPA 2VZ3A 1E9PA 4XXDB 3Q6FA 5A2CA 1JXFA 1JHTB 5ADOH 4JO8A 4ODVH 4HCRL 4AIOA 3RIAF 1F58H 3BO8A 5EEYA 1FZKA 1IGMH 4M61A 1O6VA 3VW3H 2OI9B 4KXAA 4JFPA 1KBKA 3LN4A 5GZND 2CBMA 3VGBA 4OGQC 3WXWL 5IQMA 2VLLA 2ILLA 1AIFA 2YEZB 4HK3J 4OFVA 5JQ6L 1UVQA 4D3CL 3SYCA 1T21A 4XO3A 1ECYA 4WHYG 1VPOL 4LPUA 4NO2B 5DEJA 3ZTJG 3CVIH 4YBQC 5BNXD 1ZLWH 2BMKB 1LMIA 2NUPA 1HKLL 5FB8A 4N1CA 5DJYB 2UZYB 1W8EA 4WI0A 5D2LB 5DJDB 1JGUL 4DK6A 5I2IB 5D7IB 3GNML 1RFDL 2OM5A 3ABMB 4FFWD 2AC0A 2XLLA 4HW6A 5KSUB 5BO0D 1KGWA 1ZA3A 4LLYB 2XPGA 3U0TA 1XSKA 3EJQA 3QUXC 2WXJA 2WKOF 1NFIB 3LN5B 3NJXA 3HMXL 1OF2B 2NNAA 4FQCH 5L4IA 5BRZD 3W0WA 1ODAA 4R0LA 1OPGH 1WPCA 2GBTA 3DGGA 3W5NA 3BQUA 5IOPA 2VTFA 3OGCA 4XVTH 5E9AA 1FZJB 1CLZH 1EHAA 3DWTA 2HP4A 1MAJA 3QQ4A 3QHFL 3JWDH 2DMBA 2W0LA 1R3LA 2AQSA 4PWHA 3IDNB 4NKMB 3C5ZB 2PYEE 2QQKH 2XWEA 3CLFH 2XIDA 4XHJD 2YUXA 5J57B 3OM3B 3P3RA 4PJBE 4GBXA 1MPAH 3ZDZE 1AANA 1N6VA 4KQ3H 2HTKD 3AAZB 3A6CH 3MLYL 3VWJB 2MCG1 1SJXA 1FN4A 4L3EA 4PV9B 2DM3A 1AG0A 3QNZA 1FHGA 4ONGL 4QDGA 3NZ8A 4HMEA 5EN3A 4CDGC 3VQ1C 2A73A 3IJSA 5F9WC 4ZX4A 3BC9A 1F8TH 1VB9A 3OPZH 5G4NA 3U7WL 3BI9X 1FGNL 2H8PA 1MQKL 2Z8SA 3WY3A 2ZXQA 1E6OH 2IOIA 3B37A 3QZPA 2XWJA 1TOXA 2VERN 3FQUB 4HGWA 4NKIH 1QATA 1TZAA 5F7NC 2VDNH 1OGAD 3UEZA 1WBYA 3NG5A 4GQRA 1BVZA 1ZVYA 3VFPB 3QEQE 4CSPA 2K8QA 5KYUA 1NMCB 4JS7A 2X4TB 5IM7B 5DWUL 3QRGL 1K2DB 1P7KA 5F6IC 3GRGA 5TF0A 3EJJX 3MV9B 3Q1SH 4PG2A 1MFBH 1G7LA 3O9WB 2O6FA 3PCYA 4PYHA 4AGLA 2O5ZL 4U1KA 1T22A 2CUIA 4BSWB 1NH6A 1TLMA 4DTGH 4P2OD 3HUJA 2FEDC 5J5EA 2YPLB 4J27A 3D85A 4XN2A 4NGHL 5H8DA 3RWJB 3P30L 3IMSA 1NPNA 4E9YA 4FKEA 4K7FB 5E1QA 5FFOA 1QRKA 4XN8A 3HW7A 2YC1A 3UO1H 4Y4FA 1YEHL 1Z0NA 3F6LA 2YD0A 4KROD 4TNWF 4EMZA 5GZOC 2FB4L 3EYFB 2O30A 3KYAA 2XZAH 4J3OD 5EEVA 5I1HH 4R90H 1I7RA 1P4IL 4APQC 2E7BA 3GSVA 2AJ3A 4H1LH 1DLHA 1R5WB 4HYTB 5IV2B 3RZCA 5HJGA 1CK0H 2GC7C 3VB8A 1DN0A 4ODHL 2VUYA 4I2XB 3SDYH 4PLKC 3VFVA 4XP6L 3WU1A 1XAKA 1HOCB 4LLVA 5MENA 4NQCE 5FYKU 3CH8A 3EJRA 3RU8H 1A4JB 1J05A 3JSSA 5KG9B 4R2GC 5I1DA 1P5VB 4K4KA 3ARDD 4IRJB 3QDAA 4KI5F 5ELIA 4K5NA 3I50H 1HESA 5KBNC 1T2QH 4XCNA 1AJ7L 5MHSE 2GSIA 4Y5XA 1BXVA 3FMGH 4GI6A 4I18A 1MIMH 4TSCL 2ED6A 2N1TE 1K6QH 4GY4A 5EIQA 4ZNCD 1PD0A 2VXTH 2CPUA 2X4RA 3NJMA 4HIJB 4N24A 3SDCD 2FSDA 4L9LA 5LG1A 2KERA 3LRGA 3FBKA 3ALPA 4O5LH 2VDNB 5EU4A 5CHNB 4LEOA 3UTZB 3MJ7A 2FJHB 2KMWA 3CBKB 2W92A 5HDRA 2YSSB 1NPUA 4AV0A 1ROCA 1Q9LB 3ABLB 2X42A 2XZQL 3MV8B 2GSGA 2VZ1A 5GS2H 1JFQH 3LN9A 1TQCB 4LKCB 4W9IC 1KYAA 3O8XD 4GMTH 5I1EL 4QTHB 4BSVB 4NM8H 3AG2B 1JGLH 3CN4A 2FJSA 4OU3A 1AHWA 4BE6A 3VXNA 2ADIA 2RALA 3CFEA 3RLSA 1A66A 4XCYA 5MP6H 4ZQTA 5K9OB 4MJ5A 3SGJC 2VAJA 3X12B 5TGBA 4G8GB 1MIEH 3QORD 3SPJA 3P4OB 4TQEH 4HWEH 1JPSH 3PXJA 1A3LL 4NENA 3GMLB 2E6QA 4P57B 5FOBB 3QIBD 1KEML 4PWJA 2YQGA 2K0RA 4Z3EA 4QUOA 3EXJA 4H1LB 5J7CC 2V2XA 4WWKD 2QSVA 2X4QA 3VI4F 1YPZB 2PTUA 4MJID 4X6DF 2N1KA 2J56A 4B97A 4YHLH 1PSKH 2NYZA 5KSAD 3NAAL 4IDLA 3ULSA 3IM1A 3TEXA 2H1XA 3RDTA 1SBSL 3FQ1A 1S7XB 2VCOA 4BH8B 2D7MA 3ILPB 1MWOA 4DGYL 2E6PA 3FB7A 3BYTA 1E90A 4TSAL 2WQUA 3IGAA 4YC2C 5K1JA 5I28A 4UIMA 3WI9A 1GCFA 1PVHA 3HI5H 2HKFL 3LZNA 4Z7WF 3BRFA 2IH8A 4NKOB 2R9HD 3R0NA 4P4KB 1D9KB 5EUOF 3V4UL 1KLGB 3SO3B 1DLFH 4MQ7B 3D51A 1WFJA 5F1IA 4Y5YA 4LNVA 4L29A 3LHAA 1U8CA 3FTWA