2A9CA

Crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
359
Chain Sequence
RVNSQKPFNAEPPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
total genus 89
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9cA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9cA01
2A99A 2A9CA 3R19A 3HBPA 2CA3A 2C9XA 3HC2A 1XDQA 4PW3A 1OGPA 2XTSA 2A9AA 2BIHA 2A9BA 3R18A 2BPBA 2CA4A 2A9DA 1SOXA 1XDYA 3HBGA 4PW9A 2BIIA 3HBQA 2BLFA
chains in the Genus database with same CATH superfamily
4AM0Q 1JPFB 4XC1L 3H3PL 4JQVC 1TZ8A 4LPVA 3DJRA 2OMTB 5FM5M 4CRPA 1P4IL 3RWIB 1N70A 4HUWA 4JN2A 1CBVH 5I5JA 3KLAA 2R27A 5ABAA 4LLDB 2OJEB 5G4MA 4ZS7L 5EU3B 3D3VD 3S37H 5CWSA 4QKTA 2DJUA 1W72L 3SGEH 4DP1X 2E7LC 4FHJA 4QI3A 4F20A 4JG0H 1SLVA 3IK2A 1FGVL 5IBTH 2EEBA 3B1UA 3KW8A 5MEQB 2DIAA 4PVNA 4QOKD 4ES9A 1SJMA 3VXPA 4M56A 4PRIA 2GHWB 3B9KB 3BPOC 4P9HH 3QJZA 3SYPA 4TTGA 3QCUH 2YN5A 1ZS8A 3V8CA 4CC4A 4Y1AE 1HINL 3ZKQD 4OZHA 1GS7A 3LRMA 4Z7NB 2GEQA 1MWAH 2XPZA 3RTQA 2WQSA 3MLXL 4D3CH 2BS8A 1U9KA 2QT6A 1D2PA 3R0MA 4LL1A 5IW6A 5IV2B 2F19L 3LXAA 1E9OA 3ZKND 5J9PA 5GRZA 4JREC 1HKLH 4HGKC 4KO6A 4UB0H 2BJMH 2XWEA 2AVFA 3A6CH 2HX8A 3MFFB 5I19H 4P4RA 1ACXA 1EHLL 2BSEA 5AW4B 2CA3A 2DD8H 4UTCA 2NR6C 3P4LA 1Z2KA 2EILB 3I3DA 1AANA 1WBZB 2D0GA 4DO5A 1HEZB 1AXTH 1B4JH 3VXRA 4WJG3 5GRJL 3WTVA 4UWQB 2A73B 4XMPL 4LRNL 2CR6A 2DH2A 5GS1B 1GA2A 4G42A 1DN2A 3U0PB 2Q8AL 4NSKB 1YEJL 3AWEA 1TMQA 1E4WL 1X5HA 1HYSC 2WXIA 5JOPE 3CG8A 2DQHL 4HUUA 3SQOL 3STZA 4OLYH 3ULSA 4AW7A 2VLJE 5HVFB 3H54A 1MCSA 3NSYA 3ZDYE 4RVBA 3IEAA 2WOYA 4LHQB 1AC6A 4HSCX 4ODWA 1UCBH 3VGGA 4G7YH 5JXAL 1T7ZA 3T0EE 1DVFD 5DEGA 3NP3A 3WTUA 4N6RA 1QBLL 3ARFC 3WTXA 4GKNA 2E86A 3CVHH 4U1SB 3VXUE 4C4UA 1FVCA 3H85A 5ANMB 1QFUL 3D4GA 4FULA 2HT3C 4PJ6A 1XCTB 3SB3A 1I1RA 3SE9L 1ITCA 3AXLA 3TH2T 1PG7L 4DH2A 4KI5C 3SD2A 1X5JA 2ZX6A 5F44A 5FUCE 1MRDL 1JXDA 2WY3B 4P46C 5CINH 3BLPX 3L5HA 5DHVA 3OSVA 1L9NA 3MV7B 4P46D 3L9BA 2IF7A 4LLMB 3IMTA 5DHYB 2XTSA 3PHSA 1TJIH 3UTPE 3PWUA 3O8XD 1JDDA 4P3CH 4X8CA 3HJEA 3LQAL 3I84A 1ZT4A 2JF1A 4QTHA 3U1PA 1YO4A 3JWDC 1YPZA 1F4YL 1FG9C 4NDMA 1R4XA 1WFMA 4PJ9A 3D0VA 3IXAA 4KUZH 5HI5D 3VMOA 3BEVB 5J3HC 3U36A 2GSGA 3CSPA 4WHTB 1IAKA 4Y5YB 2F58H 3CFNA 2CCWA 4PJHA 1NUDA 4IJTA 3UMNA 3D2UB 3AS2A 3VFGL 1TG8A 1XZ0B 4JKPH 4Z7VF 2ARJQ 1FVEA 3TPKA 1GW0A 1VA9A 2E74C 2MQGA 1KBVA 3BVVA 3MV7D 4P46B 5I76B 5I0XA 1OM3L 1BGXH 3BYTA 3AREA 4X9FA 1FGNH 3H4HA 1CB4A 3APMA 4PJ9D 2J25A 2F8IA 3HNSH 2NNAA 2P5WB 1P1ZA 5AYQA 2W9EH 1I8KB 4OJFH 3AMLA 2R29L 2XX0A 4I7ZC 1EGJH 2DQUL 3KLHC 2ENPA 5GZND 2P5EE 3K6SA 5HYJB 1BFTA 3TIEA 2VO5A 2NNXA 3MLXH 1MPAH 2GIXA 1F3DJ 1U58A 1Z3GL 3I02B 3Q2VA 1NOLA 1GYAA 1Y0LA 3Q8BA 1MCQA 3C5ZA 1AGFB 2VDRB 1OGSA 3LX9A 1A5FL 4QHLA 1PY0A 1D9KB 3HZYA 4OLXL 2WO3B 3SKUD 3MFGB 1AO7A 2YGNA 4JGUA 5T1LB 4FP8H 3RUGE 4ZOEA 3IDYC 2CG9X 4XH2B 1S9VA 5ITFA 1DDHB 3CUPB 5EPMB 4Y4KC 1QR4A 2ESVE 4TKWA 1X9LA 5AKVA 2EEAA 3BUDA 5DJCB 1N0LB 4WWID 3V0FA 1JV2B 2GJ6E 1R34A 1YNKL 4L9DA 5DYOB 2ESVA 5F1NA 2ZOTA 5AZ2H 3P0VL 1AXSB 2JTYA 3GSOB 3RVUC 2IPUG 4M7JH 4N2DA 1N6QH 1Z9LA 1G7JB 1JOIA 1WZKA 3U6RA 4N9GA 3U46A 1U91A 4C8XA 4X9YA 1FG2A 3TCTA 1D9KD 1G6RH 4B60A 3UPRA 3VDCA 4TVSa 2B3IA 1PDKB 1IBFA 3BWUF 4TTDC 3MRIB 3HE7C 3MXWH 3OKOA 3LTVA 4I3GA 2W1NA 5H94A 5E8EA 1PYWB 3W0WA 3EGXA 1L4IA 3VXUD 3ZHLA 4U2ZA 4AT6B 1NC4A 1BVOA 3H7BA 4L2LA 2RH0A 3GMPB 1WV7T 4NT6A 4RRPG 1DVTA 2GAZB 3GLAA 3SCMC 4AJWA 2QADD 5AW6B 2ZKWA 4MA3A 4LL9A 1YUHB 3QPQD 1QFPA 2CO6B 1AGDB 2E4FA 4JRWA 3GB7A 5E7FA 5FA3A 5SWZB 3KJ4B 1YYML 3DVFA 1U93B 3AFLA 1T22A 1DTUA 1QFOA 4TUOA 3VD9A 3HVDA 3LHPH 3LZPA 2XWRA 4K5NA 3RVXD 1CTMA 4D8PA 4AYBA 2IG2L 2YGOA 4LCYB 3ZY7A 4Z76B 5FA4A 4WWKB 1I7UB 4RGMC 4C4KO 4Y16C 4L3EE 1OGTB 3TZVA 4NNYB 4QRTA 1KPUA 2GJRA 1TQWA 3VNYA 4G2AA 3BQUA 3SZ6A 4WGWB 2OMWA 4AV0A 4I77H 4UT7L 2L7UA 5DD1L 3W11D 5GS2D 1RZQA 5AW8B 4HSQA 3WY2A 5DD3L 1KCBA 4XPTL 3GRWH 4Z7OB 1SY6A 1HILA 3BEWB 3UYPA 5TF0A 3BIBX 2GUOB 2PYED 3CVDA 4JVUA 2GJPA 4XO8A 4W9ZA 4GRLD 2P24A 4GRMA 3CHOA 3L81A 3EH4B 4FXLA 3RKDC 3PREA 5GRUL 3TVMC 1GAFL 5A2AA 4X6FA 2YAFA 4XPAH 3FXIC 2EIDA 2DTML 4JK0D 1M6OA 3K3QA 5FEBA 2H26A 5A2JH 3X3GL 3P4NA 4RA3A 3PHQB 4YO0B 5DJYA 2Y1VA 3T0ED 4HS8L 3PUCA 1EAOA 1DP0A 1MUJB 4NZRL 1WRFA 1SBSL 1OIOA 1KZQA 4LT7A 4N0UB 5A43C 3V7AE 2V2XA 2PO6B 4H8HA 2QQQA 4PJFE 2XDHA 4K2UH 5C7ZA 1JNLH 5B4MD 1IB5A 1ETA1 1J1OH 5FYLH 4B7LA 4AL8H 3N85H 2UZPA 4JFHE 3M8OH 1MLCB 3BLBA 2JVUA 1MW3A 4I1PA 3ULVE 1H8NA 3EOBA 4HV8A 4UTBL 2APVA 1GTFA 3N50A 3QRLA 1QSFE 2DDQH 3CHRA 1AIZA 4GUPB 1UA3A 1WYJA 1ZVYA 1JYWA 2MHAA 1RUAL 1UD2A 1KGCD 2O5NA 2BMKB 3CD4A 2NTSP 4XCFH 4XP9L 2XZQH 1PYWA 3W0WB 1QRNB 1TDQA 1F45A 4AT6A 2XT1B 3GIZH 4RNRB 4YAQB 2C5DC 2X41A 3QXDB 2VDNB 5BZDB 2K8QA 5EU3A 4X8XA 2GAZA 4G8EB 1FZMA 5HHQA 1LO3H 5D93C 5C3TA 4WKZB 1BBJB 3MV7E 5J89A 5T3XD 3ZL2A 4TQIA 4UINH 2G2PA 1QLEH 4FQXA 4HC1L 4KKAD 3RFRA 3SO3C 3JWNC 2DICA 1MJUH 4G43A 1SHMA 4IKIA 4EF3A 2R1XB 1R24A 1MZZA 4RRPA 4WU5A 5I2IA 1BYNA 1TZAA 4G72B 2UY7A 3BSZH 3HR6A 3ETBJ 1QI5A 1S7VB 3D18A 4PRIB 1DFXA 4CKVX 1NM4A 2GTQA 4H8WH 5HVGB 4Z77B 5E5UB 2DPKA 3DVIA 5BZWB 4JQVA 5DEFA 3BUPA 5LVEA 4M8QB 1FL5B 1UATA 2D7PA 4F57L 2WKLA 4OI9A 1JMXA 4GP8B 1AGCB 4HFUL 1HHJB 4HJ1A 5D5MF 2XU9A 4DQOL 1FNSH 3MR9B 5L9DL 4PJDF 5F2FA 4ESKA 1Y7VA 1EGJL 1U8KB 2DQUH 3MRNB 1AGEB 4WIQA 2DWTA 2NY5L 2WANA 1I4FA 3V95A 5KSUB 1IEHA 4C56B 3LD8C 1QBLH 3J8F7 3WUWA 3MX0B 2IG2H 3OG6B 4RFEA 2GUOA 3QORB 1HEZA 5DTFB 1JIBA 5AKRA 4LPTA 4ZUUA 4BXVA 2VC2B 3CZKA 1EO8L 1Y18A 4YUEH 3B7SA 4U6YA 4ZFFB 4PB0L 1BX2B 1N7MH 2BFVL 2IPKB 1MHPH 1V3KA 4I0KA 1KTLB 2CIIA 5C08B 1GL4B 1EXGA 3ZRFC 1SJEB 2Q76B 4CADA 4JPIB 4RWYL 1P2CA 3D7PA 2ZXWB 4JRFA 3L7EB 4NHCH 2X09A 2VXQL 2V2XB 5CEZE 1HTYA 3UCQA 4F2MA 5KYWA 3SO5A 1INQA 4YDIH 1OAXH 4NI6A 5CGYC 4Z95H 4TVPD 1EHKB 1CS6A 4U1MB 4AGQA 4UAOB 2AQ1A 1WIOA 2EYSA 4H2CA 4XNQB 1R3IL 1H9VA 4FFWC 1QWUA 2VR9A 1XMEB 3UOAB 3LNGA 3QDMA 3VFSB 1XCTA 1IVTA 2AJVH 3TYFA 3I6SA 2X9ZA 3IDGA 3OZ9H 3IDYB 1A7NH 4M6NL 3G5YB 3WO3B 2YBRA 3B5TA 1GZPA 3MOQA 3OWEA 3E1ZA 1KCWA 5CCKL 3FTXA 4Y4KA 1A6UL 3K2UH 4N5UA 2FQGA 2ZOWA 4YXLL 3NAAL 2IEPA 4JANA 2VLJD 4A2HA 3RILA 4X2UA 4OAWB 4G7YL 1WQVT 4YFEA 4U1KB 4B9CA 2EDYA 1N2RA 2HX9A 4NI3A 4CKQA 2HTLD 2XN2A 2VN5A 4MXWH 2X28A 4N5ED 5KAQF 2R7EA 3WUZA 1QW8A 4PY7B 5KVMC 1G4MA 4HLZH 5B8CA 4BSWB 4N4YB 2QZQA 2E8YA 1X5IA 3T0VA 4F7PA 4MX7B 2CRZA 2P8LA 3QNZA 2JKJA 2QGBA 4I18C 4ACTA 1MCWW 1OHZA 5C0AE 4UTAH 1FFTB 4M48H 3N1PC 1HZKA 1HXYA 2NX5B 3C08H 3GBLA 5D71H 3OX8B 3H0TB 2WHVA 1WF5A 4GW5A 5FYLD 1PIFA 3ESNA 3FH5A 4PWHA 2YS4A 2IALB 4EI6B 5DMGC 3UDWC 5AL8A 5I15L 3MNZA 1EEZB 5C71A 2ZCLL 5DUPL 5DGRA 4L8CB 4ZMTA 4R90L 1BV8A 3K6SB 3LKOB 1E8ZA 1AI1L 2FLBT 1CICD 5DRZA 4JPSA 1RMFL 4WWKD 1OSYA 1TQBB 3PGFH 4PGCB 4NAMA 3A23A 5FOJA 3F01A 2G4EA 3V0AC 1BVLB 3B2UC 2WZAA 1AHWB 2X4UB 2M2DA 1KIPB 2WP3T 2Y5TA 4M02A 4PHZA 4KFMA 1OZTG 2FL5B 2X5PA 4KK8D 1NCOA 2JKLA 5DZAA 5TH2A 5JW4M 1A4KA 1RZ7H 1JXFA 3QFGA 3FONA 2BIPA 2ZCKH 4AC2A 5F7FA 1XGPB 1EEYB 2JH2A 3T2PA 4K7FB 4H1LG 4BA8A 4YX2H 5HJGA 5E5MB 2E47A 2UZYA 1YMMD 1FZOA 3Q48A 4MYPA 1KGXA 3K6FA 4UQCA 4QYAA 4MNQA 2OMYA 1WS8A 2FZ3B 2XJKA 4DN4L 2ZF9A 4KU1A 1XF3A 4ODVL 3GPSA 3NRFA 4U31A 3HC0A 3A0OA 4NZ8A 4NQVB 4OJAA 5JXAH 3GJEB 1U8CB 4Y19A 4UQBA 2NUTB 4AQ8C 4Y8AA 2HZHA 2ATPB 4HUVA 4C83A 1OT2A 1BVKA 1MCKA 3GI9H 1BDYA 2CNYA 2CGYA 4CDGC 1Q0XL 3QGVA 2DTSA 5AVXB 2WZ6A 3NJIA 4ATWA 4CMMB 4GH7B 2VJ0A 5IG7B 2OMBA 2QQKL 2WWNA 1XIWA 5JMRA 1ZT7B 1J48A 1HNFA 2P47B 3P9WB 5HHVL 5ADOL 3MZTA 3EGXB 7FABH 2OL3L 3L95B 5KVFE 3UAJD 2PW2A 1I3UA 2DIEA 1CUOA 2JIXA 4ZMNA 1YC7A 3BSZA 4LCCB 1MVUB 2NXZC 2A6IB 1W80A 1LXMA 5F7AA 5L6YL 1NTDA 3IMSA 4DGVL 5G5DA 2VUKA 1A6VL 1E5BA 5D93B 4JUSA 4IBUA 2B1OA 4HJJH 2F8VA 3GF8A 1A3RL 5FXCH 2VZVA 1NLDL 3IYLW 3W0WD 1N6QL 1QRND 2GJ6D 4XBEL 4AJVA 3C2AH 3N91A 5KJ4A 4K55A 5GGRY 4OTXH 4D8PB 1G9EA 5HD8C 2DB8A 2Z0UA 5SWSB 4F57H 1MWAL 4GQ9H 1F4AA 5FCUH 1MCWM 5H35B 1KF9B 3PF2A 1I7UA 1N5AB 3VGFA 1I1AB 5GRVK 1PLBA 3D25B 3UTQA 1F6AB 4L3CB 1VFAB 2VGLM 5E9DA 3SQRA 2X6UA 1O0VA 2QKIA 1K2DB 5DC9B 4HBCL 3RQ3A 1JNNL 3SPJA 2OLDA 2YZ1A 4KX8A 3HN3A 3T0BA 4OZGB 1E9OB 4KH2A 5E2VL 4ETQB 1T6BX 2D2CC 3BAEH 4PRID 5A2BA 2O61A 5EFIB 4X9GA 4LCUB 1QKZL 2B59B 3H9HB 5I1KL 3FDWA 4ATTA 4ZAKC 5FOBA 5KYNA 2ZXEB 1FZJB 3E3QE 2EDXA 3O6FD 3RI5K 1UT9A 5IQ7H 1KCVL 5CKGA 2W59A 2ZP8A 1IMHC 4M1GL 4QXWA 1WFOA 2GI7A 1YY8B 4XHJC 4UDUB 2JJSA 3PP4L 2ETWA 3ABGA 1RJZA 2Y36L 2YD7A 4BIKA 3PWVA 4GG6A 5IQ9B 2C9SA 3G04B 5DD6B 1CICC 1XIWC 4HAGA 1OB1A 3STLB 4NZUH 1PJ9A 1RUPH 3C6LA 4B9PA 5CJ5A 3WNOA 5BOZG 3CFTA 4MNHB 4PJCE 4M62L 2QEJA 2WINA 3T0DA 3V5HA 1KYDA 1RIVH 3DO4A 2IOIA 3SZKC 5C0AB 2VC2H 4WUKL 1DVXA 1MRCL 4ZI8A 5DF0A 1NCAL 1HE8A 3MODH 2W9DH 1CFNA 3GK8H 5E2JA 3KWUA 4RGND 4JLRA 3MCKA 3U9WA 4BCXA 2E46A 3C60B 4GUPA 5H2BA 4DZ8B 3ULVC 1JZJA 1A7QL 3CFEA 1FC2D 5CBAB 2I9LB 1G7QB 4CNIA 2MMXA 5IG7A 3FTVA 4ELMF 1KDIA 3GSUA 1XIWB 5IQMA 2QSTA 3PL6B 3QIWA 2IGLA 3ZE2F 3QUZC 4KXDA 5HVHB 2HRLA 3WLWD 3ALWA 1GAFH 1NCWL 4QRFA 3DSNA 5LN8A 3TESA 1U3ZA 1IGFL 2IMMA 4P07A 3GUTA 1FL6B 5J7CC 1FJ1B 1YDPB 3VXMA 3SCMA 4OCLC 1MVUA 1WD9A 3DK0A 2H6PA 3R0NA 5F7YC 5GGRB 3UL4A 2OZ4L 4PRHB 1F8TL 1O9ZA 1E9PB 1GKOA 2RCSL 3RWCB 2EKSB 1G9NL 5TDNA 4NPKA 4PJ5D 5E6IB 4G43B 1L9SA 4D0CB 4UTAA 4OGZA 5DMKA 4QRBA 1D6EA 2ZPKL 3QHZL 4I9WE 2K6YA 3OAYH 4HCRL 4CUCA 4FTVB 3JVGC 4DO6A 3EO0A 4W70A 4CSZA 3SHSA 2Y7LA 4PRBB 5KVGL 1OAJA 2P80D 2YJLA 3FO0L 4IRJC 4ZDHA 1B9KA 2ZXBA 2C3VA 3KM1A 2V9RA 3V4VB 4Y9GA 4PJIA 3I85A 4QHNB 5PCYA 2WXLA 1AGEA 1M7DA 3T65B 1DQTA 2DEXX 4R5TA 4PJDE 4JY4B 4A7VA 2YUWA 3D50A 1JXKA 4JZNB 1NOAA 1PSKL 2RGSA 3G5WA 4LEEA 4HF5H 1JWMA 2FH8A 2VL4A 2VR4A 3FT4B 3GS0A 4PJXA 1EDHA 4BZYA 3OJVC 2R15A 3TPUA 2K9FB 2VUYA 2CRYA 4Y5XB 3WHXA 3KZ8A 2AEOA 5AW2B 2D03H 4ERSH 5GGVY 5EU7E 4N86A 5KG9A 5FECA 1YY8A 2DQGL 2ZXAA 3QEUB 4MJIE 4NBXB 4WI2A 1TZIB 1YQVH 4ZMOA 3D5OF 5ADPL 1BQHA 3BAIA 3Q05A 1F41A 2P42B 1C5CL 3TV3L 1EJ8A 3NSDA 3ZTNL 4RMWA 1E4XI 2R1YB 1UVQA 4I1RA 4R2GB 3SDXB 2G3MA 3JWOC 4PS4H 5I6PA 4JHUA 1U3HD 4Y5YC 4LGRB 2HLAA 4U1MA 2G2NA 1I9EA 3ZJAA 3T2LA 1SYVB 4IKLA 2CUAA 2IPTL 3CU7A 3AREC 1X6NA 4JKLA 4K5PA 5J0BA 1FFNB 1K8DB 3HI6L 1EZVY 3VVWA 3VQMA 3EDEA 3GSOA 3KH3A 3S98A 5CBAA 1W6WA 4J2QA 4CNIB 2OP4L 1BZQK 5KS9E 1H5BA 3ISRA 1RKRA 1GZPB 5F7MC 3FOMB 3IN2A 3DV6B 2H0EA 5I8CB 1YEFH 1O9WA 3CWGA 1L9RA 1KGYE 4YDNA 4R8WH 4BFNA 3EJZC 5KSVB 3U79A 4DO4A 5MENE 3VG9B 2FX8H 3FMGL 3GSWA 3WFHA 3WIHH 2DQJH 3NBNA 5IJVB 3OLGA 3WEMA 3AWGA 3KAAA 5EBMB 4X9BA 4BQBA 1JV5A 5TF1H 1AHWC 4Q9RL 1KGUA 1U0QA 3KPRE 4WFGE 4U1KA 3DKHA 9PCYA 4HAKA 1IBDA 1MVFA 4JCLA 4CGTA 1USZA 3ZMEA 1PL3A 3U9UB 5BXFB 4MA3B 4PWEA 4WNQA 4WU7A 2VITA 1QSFB 3MVSA 1NDGB 1UH4A 3SJVA 2JI3A 2QJDA 2JCWA 3TU6A 2R0LH 3S36X 4I1NB 4YE4L 1UQSB 4HCFA 1RZ8B 1IM3D 3BKJL 4M61B 4KJPC 3ARDD 3FQNB 3H0TA 4GW5B 5CN1A 4WWKA 1Y1UA 4ZMZA 2VR3A 3AU1A 3NPZB 1WZMA 3GJFH 4PJ5E 4PP2A 1SOQA 2Z7UA 4XXDA 3QUHA 4P3DB 3X2QB 4LB8A 3IMVA 4EOWL 4ISVB 1JGVL 4XOAA 1IAIL 2YEQA 3WHE0 3PS6A 1MFDH 5JQ6L 5B7FA 3QZLA 3S9DB 2WOBA 3T3ME 3QQXA 4H40A 4TVPH 4Y1SA 1BP3B 2OMUB 4GKSB 4UU9A 3WS6C 5CP3A 4ZXBA 1FYTA 3GBNL 5D2NE 2G5BA 1U8MB 4U1NB 3RU8L 3U4EB 3TEZA 1A4KB 2JKRM 2ADJA 1AVAA 3VFPA 2ZYIA 2X10A 1MFAH 3DPDA 4J4PD 3SE6A 5A6LA 4ORZC 4KK8C 1KNOB 2ED6A 5L8KB 5IVZA 3CX2A 5J1SC 3HG1E 3HZ3A 1SY6L 2OI9B 1FNLA 4ZFZB 3GSNA 4X5RA 3A3YB 1XGRA 1UVQB 1A2YA 3O6ML 2NYZA 3VFVB 4N87A 4MNGE 3JWNE 2HKHH 4AENA 4ONHB 3ARQA 2FYYB 4KNSA 3G08A 1ID5I 3P30L 4MAZA 2DI8A 5JNYB 3VXNA 2H2PD 2VXVH 4X8JB 2NUTA 1QFWM 3EJCA 3MI6A 5AYTA 4HKXB 5ESAB 2HCZX 1XR9A 2JIXD 1OWRM 1T0OA 5JLZB 1Q94B 2FEJA 3POCA 4XP4L 3UC0H 4FA8A 2HH0H 4LVHB 1BECA 3GFUA 5IW1A 1S8DA 3EYOA 4GXFA 3VFNA 2I9TB 4QD2E 5D6CB 1KB5H 4FXGA 4PJIF 2HLFD 2VLME 2EIZB 3FH8A 1YN6B 3SGKC 4AEEA 2BVPB 4F7MA 1YYCA 2D7MA 2GBAA 2PW2B 2QTVA 3ESPA 1KG0A 1AIFA 1OD9A 1JGLL 4LLYB 4DP0X 2W65A 4E9LA 3O2DH 4Z0BL 3OWRA 5JW5B 4Y19D 4TLSA 2Y4SA 2XWJA 1ZWIA 4OF5A 3QUXD 4OZIF 5DS1A 2BJML 3D4YA 2WD0A 1Q9KB 5I1CH 5CLZA 1I8MA 2P8MB 3ZR6A 1HQ4B 1FDLL 3D39E 3IDIB 3R19A 1G87A 2VDOH 3ZT6A 3EBAA 2NNCA 4WI6A 4Z6AT 5LLIC 1MF2L 2FK9A 1FWXA 3VRLF 3LEYH 2BZDA 1CGUA 3SYCA 1HEHC 3QJXA 4G6AD 4J3UA 3LKSB 5DEFB 1HJBC 3SDAB 4L5FL 3ZMRA 3E9UA 4PVMA 1X7TA 1OY3B 5F7BA 1C12A 3LS4H 4HS8H 1BEYL 4N2OA 3LSOB 1M53A 1WZLA 4FFWD 1PPIA 1KIRB 2ZP9A 3IAQA 2FAUA 4D9RD 1UWGH 1LP9F 2B59A 3L4UA 1EXHA 4F92B 4YLCA 2IJ0C 4XNYL 2O6CA 3HPLA 4OR1A 3SO3B 5DGQA 2R56L 2VERA 1TYRA 2W0FA 3G5VA 1RURH 2FJGB 2FYVA 5CMAA 3TZVD 4O2CA 5HVWA 5ICZA 1DANT 25C8L 5D1ZI 1CK0L 3S35X 3WS3B 3E3QC 5FR3A 1ZSHA 4U6YB 4ZFFA 3U9PH 2QPUA 5C0ND 4JMXA 2ZOUA 3MRFA 1T5XB 2A5UA 4CJ1A 1JN6A 4WLCA 1N3NA 1QLFB 3K0WA 2J8HA 2Q3XA 4YSCA 3LAFA 2ICEC 1R0AL 4QGYA 3TJHD 5FV2A 3C6LB 3UROR 3FFCD 4AENB 1BF8A 1VGKA 4R7NB 5MEOA 2YWYA 4OZFH 3HBPA 3FRUA 1CQYA 3P11H 3KYAA 5TGBA 5IBUB 1JF1B 1AFVH 4AQEB 3GJFK 4ENZA 4Y2DA 4GBXB 3QO1B 2JJTA 2XY1A 4M4PA 3RBGA 4N2MA 4PJCB 3K72A 2VDNH 4JMNA 1MDAA 1HSBB 4NCDA 2Q7YB 3ZDXF 4G8IA 1Q94A 1RY7B 5JZ7C 3TYFB 1A9EA 2AK1H 5J9PB 2MPAL 3MKKA 2PR4H 1THCA 2EEDA 3DBXB 3E6HA 4PBDA 3QIWB 2DY2A 5FHBH 1HHHA 2IDTA 2X0UA 3BH8A 3SBRA 5I30L 2QVKA 4P49A 1Q4NX 5D1QE 4F8OA 5CZVH 2NY3B 1R5WA 5EU4A 1KLGB 1A9BA 1AZVA 2AMGA 3AG1B 3C8HA 5KBLA 4YBQC 5DVLA 3ZT5A 3WN5B 4NPJA 4U1IA 1UADC 4PRHA 1WPCA 4NQDE 5CWSB 1BEXA 4F7EB 2XXFA 2J44A 3VFWA 4HF5L 2YA0A 3S48A 2NW3A 3CFCH 3EYUH 5LWYH 3DYMA 4AEFA 4LRIA 4F8LA 4U05A 2VLKD 3TBSB 3P3SA 3GI9L 1G7PB 3FN0H 2CPUA 4IHBA 3IDIA 1IKFH 3EO0B 3LKRA 1P4LA 3AM8C 4CVUA 2J3SA 2WC7A 3CDZB 3HS8A 2O6PA 4LEBA 2LVEA 3MREA 1G5AA 2GFBA 2G4GA 3L4YA 4EN2A 4EZMA 4YDJA 3N5AA 1B6UA 3VFOB 5TK4A 2ZCZA 2A9MH 5DFVD 5K33A 3ARSA 4J4PA 3HNVH 4LCCC 5T5FH 4ETYA 5LJYH 1MCJA 4Q9QL 3MYZA 4B9ZA 2KHAA 4BZ1H 4OLXH 3ARFD 3EJSA 3IWVA 5DRWB 3VD7A 1QSFD 2BVOA 1DVFC 2C4FT 4H4NA 5BUPA 2JXMB 5IHZB 4N0FA 2K6WA 1K4CA 4ALAH 3WIIH 4F9LC 4Z3TA 1XXFC 3MNZB 5C0BE 3O9WB 1B0WA 2ZNWA 3RVTC 4G5ZL 3EJZD 1EX0A 4FL4B 4P23B 2X4TB 3BDXA 5E9NA 1JXGA 2BNUB 3H2WA 5HDWA 5CEXB 5IVNA 1FNEA 1S7UB 3WS3A 4BFBD 2EO1A 3ZZSA 2CJ3A 2AV1B 2VXUL 4AC4A 1UB6B 4YHKL 5I1HH 2VDLB 3F7YA 2B1HH 3VXOB 4CU7A 4H0LC 4GI8A 1L7IH 3D0VB 4NAQA 5FFOA 3ULVF 4MAUL 5BUGA 2OMZB 4H20L 4ZQKB 2DIJA 1YRKA 2IGFL 5IQNA 2PWEA 1ORQA 3OGCB 4M3JA 3QO1A 1ASPA 1NC4D 5TD4A 4FXKC 1CMOA 3ZDYF 2Q7YA 1UEMA 1AD0B 2BNQD 4XN4A 4DP8X 4Y2NA 3MOBH 4EIGB 1IE4A 1IQDB 5KYYB 2ZSVB 4WK4B 4LARH 3S5LB 4NZTH 3VXQA 1HHGA 3CTTA 5F9AC 5AVYB 3V8OA 4CMMA 1A6ZB 5FX3A 5F3BA 4X7TA 2J6EA 3BFQG 1DYZA 3C5SB 5D7SL 2HTKD 4YXHH 3RX7A 2OCCB 3H8NA 3RVVD 4DAGH 2ICCA 4NRXA 1DBJL 2JIXB 1HZHH 1U8LB 2H32H 5HHNA 2WSPA 1ZT4B 3UTSB 1JD7A 4LF3A 1BFVH 1CI3M 4WENB 2VITB 4BKTC 4NLAA 4GUCA 3JV0A 3BJLA 3WJLA 3QXAA 5HHOB 3EYFA 3L2LA 5T1JA 4QEGA 4EEEA 4TULL 3DDGA 1YEDB 3HE7D 3KPSA 1AE6L 2VZOA 4ZW8A 1FVEB 3AACA 1T80A 5A7BA 1TKWB 1GCYA 4P46A 5I76A 2DLTA 4OCRH 3BKMH 5TPWH 1OSEA 1GPOL 4OIFA 4P9ML 1CFQB 3D0LB 1DSWA 3RVVC 1ET5A 3LZQA 4JFFA 2YLKA 2YPLD 1KLUA 3QQ9C 3D09A 4OZGA 4ETQA 4R7VA 2OQJA 2O5YL 2MCPL 1ZRUA 3PY9A 2OL3B 3F65A 2R23A 4NHUB 4H8WC 5I1DA 4R7DB 2C34A 3MRIA 3Q43A 4BWUA 4XR8C 4YXKL 3MLZH 3SDDD 1U8MA 2DD8L 4U1NA 3SODB 1S46A 5FUZH 1CL7I 4JB9H 1FLRL 3HIZA 3HR5A 4PVLA 1D5RA 1XSIA 2KYIA 4XPBH 3ETTA 1UT1A 3MROA 4BZ1A 1UB5B 3DRTA 3MNVB 4WDIA 3ILQD 1NAKH 4JN1H 4AM0A 4L1HA 4Z0BH 3QJRB 5EN2A 1NDTA 4JPKH 3FOLB 2I32A 4S1RH 1NGPH 1IC7L 1RJLA 4MB1A 1AP2B 3CDGB 1T3FA 2AGJL 3S96A 3DMMD 1PCSA 1A3ZA 3C5ZD 3WDIA 3TWCL 1W0VB 3KL0A 3WE1A 2Y25A 2V5SA 4JZJA 4ZYKA 1V10A 2CJUL 5J06A 2JELL 3POHA 4E5XG 3SYAA 2BW5A 3IFNH 1LLAA 1NIDA 2Z6FA 1I8LC 3FQRB 4DETA 4JLRB 2HRPL 4L05A 3U46B 3C60A 1IT9L 4YK4C 5FO9B 3QORC 4PLKC 3LPWA 1BEYH 4AL8C 2ZSWA 3OXSB 4NQDD 2VDKH 3OPZL 5HYJE 3ZE1F 1UFUA 3O9WC 2VLRE 4K3HA 2CQVA 4MVBD 3FFDB 4ODUA 4F7MB 4ZAKD 5I1AB 1F2XK 2XWTB 4M5SA 1XF5A 4LASL 3SOTA 1J87A 2AK4D 1VEMA 3JV6B 3QUKA 3ZUNC 3C5ZB 3EADA 3GXIA 2X4NA 2UY6B 3MUGB 1KJVB 3PCYA 1G4RA 3ESOA 4XMKL 5HDBE 4MCNA 4F9PA 1T0PB 3HTLX 4O02A 1JAEA 2WO2B 3RWCA 3PDDA 5HDRA 3S36H 2BVQB 1AJ7H 3GO1L 3NFNA 4D0CA 5G2NA 2BW4A 2F1EA 2R0ZL 2R2HA 1NDMA 3CHQA 5EEZA 3WN5C 1MUJA 1OCWH 3F12A 2XBDA 3D85B 3IDNB 4LCYA 4KK9C 4E9WA 4U49A 4OF3A 4L1SA 1HYRC 1E2ZA 3ZR5A 3FKUS 4KMTH 2VDPL 2Y7QB 1CJYA 5D4JA 3VA2C 2WLKA 4OZIA 1HL4A 3MRPA 2EVHA 1NCJA 3DJZA 3VXTA 4BZ2H 2JI2A 2AK4B 2HPTA 4GAGL 4HWZB 5L88H 3RWDB 1Q9OB 1YAIA 2V7HB 2CDEB 2XBZA 1VACB 4TM9A 4TNVK 1PSKH 4BCZA 5ACLA 3UTZA 4NZFA 1F3RB 3BUYB 4KO5A 4BFKA 2BLFA 3MSPA 5GGTL 3KVQA 4F91B 4XMTA 5E00A 1JYXA 5CGBA 4BFFA 1DBKH 1M2OA 4GBXC 1RIVL 1WITA 2YKKA 4MJ4A 4WI4A 3ZQWA 5E8EB 3SE3C 5IB4B 1KJ2H 1XR8A 1MJ7L 3MRKB 3HA0A 2F18A 4LE8A 4RFOL 3CVIL 3QDJD 2HWZL 3ZKNC 5CP3H 4ANWA 3CFQA 4AGNA 5A16A 1N8ZB 3Q13A 3MGOB 4B5ZA 5IBLD 3KGSA 2YQ3A 1QO3B 2BDNH 4XZUA 1L9QA 3RWJB 3ZHFA 1P7HL 1TO4A 3V7AG 4P3WA 4IRJA 3ALXA 1JN6B 1SBBA 1X5ZA 1JPSL 4PJ8D 4TQEL 3ZVVA 3MLWH 4OLZL 3VB9A 2XACC 4P23D 3JVGA 4IKNA 2W9EL 4U1GC 3AQXA 1NJ9B 1NFDF 1MY5A 1ZLDA 2VJ8A 1YEHH 4YXHL 5AW1B 4F8NA 1XTMA 4PV8A 3WKPA 4URKA 2R69H 4GYBA 2TAAA 1U2CA 3OD3A 2H8PA 1AR1D 4MJ2A 1WT5C 3P73A 4LCWA 1HSBA 3MRBA 3J27A 1T4KA 5GGTA 2Y7SA 3DJTA 4BUGA 3AADB 5CM1A 4OT1L 1HH6A 4I48B 3F6IA 1IAIM 2Y1YA 4BKLA 3X1EA 1AHKA 1JGEA 1WC7A 2NY4C 3V9FA 4C56A 3FFDA 4E36A 1PKOA 5I1AA 3TP4A 4DKFH 1EEQA 4QDGA 1HH9B 1J1XH 4V1DE 3T3MF 3BN9C 5EZJA 3OLIA 4BH7A 3L3DB 3BQVA 2FR4A 4JL2A 2ATKA 4AZUA 1QRKA 1NFDA 2P48B 4Q0XH 5BVJA 4WEBL 2FSEA 5D7HA 4G8GE 4JO2L 3S0PA 3DX0A 4K23L 3T2NL 3OKKA 2MCG1 5DYFA 4CADB 2LU4A 3B2VH 2J1ZA 5EO0B 4NENB 1J0KA 4JBSA 2VLRA 4J3OH 4PJFB 2G60H 3DX1A 3KR3H 3ZE2B 1L9MA 5F7DA 1YLBB 3HHSB 2Y7QA 2EH7H 3N41F 3NIFF 2KC0A 1ZHBA 3UTSD 4NP4L 4IIZA 2C4FU 5EBLB 1QPXA 4FFZA 4YDMA 2W60B 3RWFA 5GJTL 2EADA 2VUOA 3MOAL 3W2DH 3CZEA 5B38G 4XCFL 1OQXA 5L7XL 3S37L 2HVJA 3MA9L 1JWUB 1DBAL 5EA0L 4WEBH 1LJMA 1UXSB 1LEKA 2A4EA 2CO2A 5DZVA 2AS5M 4GO8A 5SV3A 2BCMA 1R3IH 3IGFA 4ZSOA 4M3KB 1FNEB 4DKEL 4JB9L 3WD5H 3DOSA 4L9LA 4TN9A 2CHDA 4A38A 1KC5H 1U8HB 3NZUA 5EZLB 5E1GA 2IDUA 3K81A 4KVNH 3LS5L 4PSPA 1KTLA 1MY7A 5IM7B 3TN0C 4ZUSA 2YPLB 3SPGA 2OI9C 3JWDH 4FQXB 4NQEE 1LE9A 3ORJA 1RULL 4IRSC 4OLWL 4UNIA 2B77A 1BXXA 3GD1C 3HFMH 3QK0A 4WWOA 3S37X 1OARH 4LSRH 1J9QA 4V2CB 3GSNB 3QUMB 1RUQL 4WFFD 4YPGB 3GRGA 1YMME 4YLBA 4WGVB 4ZQKA 3MRGA 2Z3FA 1R3HB 2GJJA 4DKAA 3V6FA 3DV4B 5IVXF 2I85A 1I75A 3NVQA 4DEWA 1VERA 4K3EH 1KJ2A 5IFAH 1TQTA 2YOCA 1DN0A 4QXTA 5L2KA 4H1LA 3VTMA 4POYA 3K8LA 4MB3A 4H25A 4LCWB 1DJSA 1KSRA 1AKJA 3NCMA 4IDJH 4KKCC 4D2NA 1AE6H 2BIHA 1B4TA 1OSPL 1U8KA 2X40A 2OMXA 3NESA 4NQCA 1S4IA 1TVBB 4HZLB 5DZ9A 4WO4D 2PTTA 1CXEA 2VXSH 2X89D 5IMOB 1URZA 4XP6L 1A7BA 3GNMH 2J5LC 1FPTL 4L8CA 2CCLA 1Z9NA 2WLYA 3PP3H 5I8KH 5D6CA 3QIBC 2ZCHH 4FKHA 1FI8C 3F8UB 3ZDYB 4NO2B 5FHAL 3IJYA 3OMIB 3JWOH 1G6RA 2IQAB 4RQQA 1GYCA 3ERXA 2DLFH 2AQRA 2YUVA 3MZGB 4P5RA 1X3DA 5AAMA 2CIIB 1VESA 4LF3B 5I1JH 1UYWL 5C97A 3K4DA 3QAZC 4Y5VA 1KEGH 2NCMA 1KXHA 5GGTH 2R7EB 3O11A 3V5KB 5GGSY 2UVEA 5TDPA 4B9IA 4TNEA 3PHOA 1ZT1A 4ZZFA 1FIEA 2HYMA 1A3LL 3AY2A 1PY4A 3VX0A 3HUJA 3ZKXB 3F3HA 1NL0H 3UZEC 3EFOA 1E50A 4KY2A 1DQJA 4J8RA 5K9JL 1OANA 2R39A 4XNQA 3QRBA 1CFQA 3D0LA 3EFFA 1QMUA 3PG2A 1KCRL 1LK2A 4YZFF 3VWKC 1ZHNA 4MA7H 3EJUA 4UMSA 1CFVH 4JFEE 3AITA 4X4ME 5JHMA 3PQYA 1GIGL 2UZXB 5IB1B 3O3UN 4AH2B 4G3YH 2FT7A 4AYEC 4AYID 3ZMNA 1I1FB 3MDJA 3O41B 1PS3A 4XNMB 2JQMA 4U3CA 1KJMA 5HDQL 4ZPTB 5DD0L 4Q6KA 4WQOA 3O0LA 5IEHB 3H4FA 5EUKB 2E75C 5JDJA 3D33A 5IHWA 4XVSL 4G9FB 4RMVA 2DQTL 1MXDA 4YPJA 4ELME 4AZ8B 3RGVB 4XBPB 2NY2D 2YFOA 3CXFA 3GSQB 4KUZL 2QHRL 4PCKA 1DBAH 2YZ8A 3TCLB 2ZAHA 3TL5A 4CILA 3FOLA 2L7EA 3CVBA 3AJ7A 1J0HA 4LOUC 3S4SB 3ZN6A 3LV3A 1TQSA 3EYVB 4FDWA 1LWJA 5L0QC 4HG4K 2FZ3A 4OCRL 1IKOP 5IZ7A 2I7SA 4R7NA 1KJ2B 1V05A 4M6OH 1CF1A 4QXVA 5L2KB 4FLSA 3SE4C 4Z7UA 4MAYB 1WD8A 5SWSA 2WUBL 4H25B 4IRSB 2WCSA 3T8XB 2DMCA 1X5XA 2OZ4H 3PGDB 3WY3A 3L3KA 1SFDA 1I1AA 2D7QA 3C5XA 4HUVB 1JRHH 3UTQB 3GIZL 3DRQB 3FQRA 1EDQA 4NN6B 3VXUA 4JREB 5AD0A 2MQ0A 4IOSA 5C0CA 4M29A 5E4IA 1ZA3A 5ANHA 4BFRA 4DVBA 1E0OB 1HHIA 2J72A 3MNMA 1FH5H 4FMKA 1BW8A 1RSFA 4POZD 3M7FB 2XN9D 2ICWJ 3L5WA 3OMNB 2Y7OA 3IDUA 1J0IA 5EU4B 1E65A 4ACPA 1CDJA 4F27A 3CHXA 4LCCA 4CN4A 2V2TA 4KNTA 4Z95L 3ZKMD 5KVEH 4S1QH 2H6OA 5LCVH 3L4TA 2FLRT 2HT2D 1MI5D 5I1EH 4BM7A 1Z66A 4O02B 4ODXA 1H15A 5D96C 1QLRB 3UP6A 3O0RH 3TN0B 4FE9A 4FFZL 3QWRD 1V7NL 2EUXA 3B9KC 2GW5A 1F3DH 2BOBB 4B9JA 1DQQB 1WDAA 3IU3A 2DQIH 1S9WB 2PYEE 3L3OB 3SDCC 2WUCH 4U7KA 2VSMB 4NZJA 1MFEH 2D4DA 1CDYA 3EFOB 3OG4B 1DQIA 4J12A 2R0KL 4XX5A 2C9UA 1XF3B 1ZLVH 5B1BB 3DIVA 2G5UA 5IHBA 3P3TA 3MRDB 1U8CA 1JHTB 4OFDA 4PU2A 2XKNA 2EYRA 5IEKA 3BP4A 5D9SB 4QYOA 2CM5A 4UB0L 4PRDA 4LSRL 5EOCJ 4N2KA 4ADGA 2UZXA 2FO4B 3V0EA 2GK0A 3T6WA 2AK4E 1G7QA 1HIML 2ZYRA 3VFTA 4PD4J 5FK9A 1P0SE 1LQSR 4NKMA 3DXAA 2VMDA 3GBEA 4JFPA 4AYFB 5K9QG 2HLFC 1EFXB 4LSDA 2E5EA 4MMXA 5HYSA 1N8ZA 2I5YH 4XVJH 1ID2A 1CT8B 2QPSA 1UJ3B 2VQTA 5LAPA 3LNHA 1HSAA 3GSQA 1BMWA 2LU3A 3OAUH 2AV1A 3SPVB 1YMHA 3GZOA 1R1CA 3HJ0A 4NYLA 3MV8D 4A6YH 4BK4A 4NKOB 4EDWL 3EYSL 3ZHDA 1JPGB 3LV3B 3V0JA 1OB1B 2V37A 3F7YB 2FRGP 1SEQL 4PRAA 5FWRA 2YFNA 4MCMA 5EUOF 5CJ8A 5C8JA 4LVOC 4PJEB 1JZ2A 4LSQL 4DGVH 5E5RB 4Z7UB 3S3SA 2FJFB 4BZ2L 1ACCA 3U1SL 1FN4B 3F00A 4MD4B 3VFRB 4C4KT 4PM1A 5I1KH 1XEUA 5JOFB 4P5KA 4CL7A 4J3XA 3FH7A 1BQSA 3C60C 3E38A 5C07B 3DK2A 1PFOA 2XTJE 1EJ6A 3WDJA 3D34A 3T2QA 2YQGA 2YEZB 3K2IA 5KYYA 1S78D 4DN3H 3Q7JA 1DUYA 4GEIA 4YDLB 3PJSA 3P2DA 3D2TA 3OQ3B 1F11B 5DWPA 1PFCA 3P0YL 4HSAC 3II1A 3LHAA 2BY0A 4PGJA 4HMEA 1YCSA 5KBPA 5HHMB 4LCWD 3MJGX 4NUPA 1KIQA 2DQDL 2VMEA 1J5DA 1OVZA 1J0JA 3ARGB 3GRBA 4BUHA 4F2ME 2CDGB 3R8BB 3G6JB 4WO4B 5C9KA 4K9JA 2EIKB 1NEPA 4XT1C 3UTSA 3HS0C 1U8QB 3V0DA 5DMKB 2OR9L 3ARPA 4RISL 1KIUB 3STLA 4GKZA 1THAA 1H6EA 4M6MH 1S9WA 1P6WA 1BD2A 4GQRA 1WFIA 1CD1A 1CWVA 1DQVA 4CSPA 2XA8H 2R1YA 4XVTL 4F15B 2Z8SA 3SDXA 3V5HB 1D6VL 3HCVB 3TO4A 1OSZB 3F05A 2CRMA 2Q8BL 2L7QA 1D5ZA 4KRMB 1XH3B 1RZJH 3QIUA 5LCVA 1PKQE 4HX1B 3I6LE 3TO4C 1A7RH 2OSYA 3EKCA 3OKDB 4ZFGL 4LQFL 4YHNA 2I9LA 2HVJB 3RDTC 3ABLB 3FYIB 2GHZA 4Q14A 4KI1A 1A64A 3I75B 3HG5A 4HBQA 4KUCD 4ANUA 4EJ1C 3IVKA 4KVPA 2A0LC 4JO2H 5B3SB 1TJXA 3ZQXA 5I8CA 3QC5X 4UM8B 2ZWKA 1RI8A 4HUXB 3RAJL 1FLRH 1UJ3A 2ID5A 3V9EA 2WAHA 2ZNXA 1P4IH 2V9UA 4ZUSB 2PCXA 4IGBD 2WIIB 3RTQD 4QO1B 2VZSA 4PGDB 5EUOB 3QUYA 1MHEA 3APFA 5BMFH 2Y24A 2B9AA 2JB6A 4UBDC 5GGVH 3UEQA 3FB7B 5F1IA 1ADQH 1IQWL 4GAAA 3GDCA 5D1QB 3L48A 3VH8G 5JXEC 1A6WH 2AQ2A 4WW2A 4L29B 5T3XE 3E2HC 3KJ6H 1PEZA 2OXGB 4NBYB 1E9QA 1T3FB 1OW0A 2AEIT 4FQLH 4BCYA 5DJZA 3NZHL 4KQ3H 5AVWB 2EDHA 5IHLB 2OL3H 4YSOA 5T3ZD 5IW6B 1RZKL 4JDEA 3JWNG 2Z93B 3NZSA 4KZEH 3RAJH 1T0NA 2C1PB 4R4FH 3AU1B 1NMBL 2PW1A 3OLEA 1ZV5A 1M3IA 4RMQA 5ECJE 3HZVB 3MV9E 1A4AA 1XB3A 2FQFA 1X5YA 2J71A 4OCMC 3DV6A 3K5RA 4RA0C 3X14B 2X38A 4B95C 4U33A 2Z7WA 3FN9A 3K2KA 1I7TA 4DP2X 5HGDA 5SWQA 3ZSSA 4BHUI 1BZ7A 1JGUH 1MFBL 2B0SH 1JPEA 2BNQA 4LEOB 5C0DA 4R7XA 1L3NA 1XF5B 4GAJL 2HFEA 2XFXA 2DLIA 3QBTB 1PQZB 4OLUL 2YXWA 4HIHB 1N19A 5HBBA 3VQ1C 2BNRE 3PABA 3BCDA 4W4OC 3C8KB 3T6ZA 4KZCA 4DFIA 2YD4A 2CXKA 3HZYB 2XN9B 4F8TA 3MLRL 4X80H 4R3SB 3UAJA 3WL9A 3BVWA 2P28B 2J56A 1MREL 1EFQA 1QEWB 3SQOH 3B3BA 1MH5A 3FQ1A 3MCG1 1S9XB 4KGJA 4N24A 3G7TA 4U6TA 4GKNB 3P9MB 4V1DB 2PN5A 1N0LA 4M03A 2WGNB 1MHHA 1X44A 3MRPB 1G9MC 1UUNA 3GXDA 5F1NB 3SOBH 2C4XA 3TCXA 3HG0A 1VZIA 3FSWA 4M6ML 3RWHB 1DQMH 2BP0B 5D7KE 4XB8A 2RIKA 2X4PA 1N6VA 1PX3A 2WLNA 2CCVA 3ZGIA 3QWNA 1JFQH 5E00B 2J6EL 5KZCB 5EOQH 3KWTA 1QQDA 4JO4L 4OU3A 4PBVC 5F7UA 1BF5A 3U7YH 3UCRA 5K9OA 3ABMB 3KD4A 1GGTA 3RGVA 4E9YA 3VFGH 3H7BB 4XZUB 4RGNC 2NX5D 3QIUD 5JW5A 3NRPA 4BELD 3RURA 1JZ8A 1NGZB 2R4SL 3A22A 2PCPB 3EJPA 4A68A 2I69A 3OLDA 4WW2B 4OF0A 1Z5YD 4YHPB 3PWPB 1GZHA 3VI3A 5F0MB 4XPFH 2X70A 4R83A 4UIKL 4AE1A 4F5CA 2VDPB 3WXVL 4J3OC 2NZIA 5HI4C 5DMIL 2FIKB 5ACZA 2CDFB 5C0CE 3TO2A 4QRUA 2A7BA 1NC2A 3TEUA 1LK3H 2X4OB 3G9AB 4GG6E 3SSGA 1XR9B 1FNGA 2CLZA 1J05A 4DGUA 1JK9A 3DX6B 1C12B 3QUYD 4ELKB 2YPLE 2N56A 3FN0L 3T77B 3AGWA 4YHYB 4LLUA 2QADB 2LLLA 4XCCH 2VT0A 1S8DB 3EYOB 3H3PH 2Z4QA 3FTGA 3Q6FA 2I9TA 3QDAA 1JTOA 1BXVA 3PXJA 5ERWA 1AOZA 4K23H 2XWBB 4Z23A 1EJOL 3PWJB 3MJ7B 3JTTB 1YMMB 4PR5B 5FYKE 5C0DB 1U8IB 3ULAB 4OY9A 3A4DA 2XFXB 4HXBL 4BQ9A 1CF8L 4L0PB 4TVPL 1EGJA 5FGCE 1OK0A 3WXVH 3HHRB 1H15B 4BINA 2M26A 3IM1A 4BHUA 4JG0L 3TF7C 5HPOA 4JG1L 2H26B 1HL9A 1DBBL 3Q2CA 3P4OB 4PJBB 1RIHL 4HH8A 4DP9X 4HHAB 1N59B 4MNGB 1A4BA 1CD0A 5D1XB 2D3JA 5HD8D 5C7XH 4ZMVA 1ILSA 4FQQB 3UJTH 2Q2EB 1BVZA 2DQEL 4LDOB 5F7DB 5BO1H 4EDXB 1AXSA 4D7BA 1NPNA 1ONQA 2RALA 1GTNA 3GDBA 4EBQL 3N0PB 2HKFL 4N0RA 4OJYA 3GS4A 4H0HB 1QD0A 5ACMA 1M71A 1MI5A 3T0WA 3K72B 2AAVA 4JQXA 4HV8B 2EVIA 5DJXB 3ZBMA 1KCSL 1YQVL 2XPGB 3BH4A 3QH3A 3KPPA 2Q3ZA 2WLLA 3QYCA 4NUMA 2P44B 3L1GA 1QBAA 3HPLB 4I0PA 4AEIL 1J1OL 2P26A 1YEEL 4LSVL 4QHMB 1OE1A 3VM5A 5KVEL 1IM9A 2YGPA 5F97E 5BRPA 3RY5A 3C5JB 1A1NA 1FNFA 1KLGA 1XQ4A 4DT2A 2GUYA 1GCFA 1GXEA 1DSFH 5JPMC 2B9BA 4XN8A 1URLA 4NKOA 2EEFA 4WKZA 2QFRA 3ROLA 4I0PD 3QA3B 1Z5LB 4NQSA 2XZAL 3REVB 3BPCB 2AW2A 3KDPB 3OB0H 4YBQD 5IB5B 1IE5A 5A3ID 1O6VA 1F1GA 4K3JH 1ES0A 4FQIL 2X70B 3T2OA 2NY3C 3II2A 2CRIA 2X4RB 2WTOA 2BSSB 3D18B 5T3XL 5C0RH 1NM9A 3JQOB 4FEMA 1ZS8B 4CN6A 2N7AA 3T0AA 4WO4C 3RTQB 1EQWA 4YDJB 3O2WL 1BJ1J 4X6DA 3ZE1E 4TLKA 3FFOA 3LPPA 3TVMB 2VRKA 4PWKA 1HIMH 4JG5A 2YEZA 1KTDA 3MRNA 1JF5A 3FPYA 1A66A 3Q3GA 2PTTB 2FGWL 1IVLA 1IJ9A 1SXZA 4ODHH 5J11C 5IFJB 1JK8B 4N2AA 1R5VB 4YIQA 2AQSA 1YMMA 2WMPA 4PR5A 2CO7A 3UYRH 1ZGLP 3IMWA 1MNUL 2FHBA 2E27H 5GS1A 2VZTA 2B4CC 4FLOA 5C0FB 2AMUA 4NSKA 4RMBA 3TYGH 2NCEA 5IQOA 3UO1L 1U8PA 5D4HA 3ILPB 3ZK0A 4CMHB 1RLWA 5MERB 4A7GA 3P4OA 1GOGA 4QHKI 3FSVA 1F1DA 3QNFA 4RSYA 4MQXD 2X3CA 5J56B 3KL3A 4NLHA 4XP4H 2YGQA 1IFHH 3UTTE 2YD1A 4RBPH 2D2OA 2VC2L 4MQTB 4JFOB 2GFBB 1TXKA 1Z9MA 3PL6D 2MIZA 5TK2A 1QI3A 2AV7A 5JA8B 2FLMA 1JUFB 5AB1A 4KRLB 4WV1B 4B97A 4U1SA 4XNAA 3KEDA 3GLZA 3NFSL 4MMZB 3OJ2C 3WU1A 4XMUA 1Z3GH 3V79C 1BOGB 5I74B 4PREA 3GZQA 1IV8A 3G9VA 1NBVH 2MHAB 4HH9B 4S1RL 3U2JA 2BC4A 3MRRB 1H19A 4N9GB 4YFDB 1G9NH 3LQZB 1KBWA 2N7SA 4KKPA 3QQDB 2ADYA 3TWYA 3W82A 2HLEB 4AGPA 3JTSA 2OV0A 4HUXA 3SDCD 3EHBB 2CKBH 4W4OA 3RU8H 2AJYH 1WGOA 3KYMA 2G60L 4F7EA 1NAMB 3S3JA 5GXBB 1NFDE 3FU8A 2FWLB 4IOSD 5C0CD 3GMPA 2ZUWA 5HDOA 3ZQ9A 4Z7QE 3NIGB 3EJTA 5B1JC 1AKJD 2WVVB 1W6LA 3ZL4H 2J12B 2OJZL 2G2RB 3F85A 4OLUH 2OMVA 4ZMLA 4PB9H 4U3HA 4F2FA 1A14H 2BSSA 3HI5H 3GKZA 4ZRGA 4HUKB 1KLFA 2A6KA 1Z9OA 2XWCA 3BWSA 4KY1H 4WI5A 3HG1D 2VDQH 4R96A 4ZMAT 1T1XB 5IMKB 1YEKL 3H9SD 2IC2A 4UI2A 4WFHD 1LNUA 3MACL 2A6DB 1NGXA 1U4FA 5TFSH 5L2JA 3RGVC 5JQIB 4X7SH 4ABQA 4G8GB 3UAFA 1QI4A 5FUOL 2WXGA 5C0CB 4MCYB 3O9WA 2IAMB 5H8DA 2WZ5A 1JK8A 5IFJA 1CGYA 2ZXDA 4K3GA 2GC7C 1JFHA 5HYJA 2D3NA 4JY5L 1S3RA 4ZW6A 1QACA 5HDLA 4NHUA 2QL1A 3OAZK 1GH7A 3SY0A 3H6JA 1D7FA 6PAZA 1U3HB 3DETC 3SDXE 3D4CA 3UC2A 3EO9L 4XCEB 5KBKA 1XGTA 3MCLL 4YWGH 1KIPA 2Y5TB 2BS71 2N7BA 4MAYC 2CLRB 4JPIA 4WSKA 4MRBA 3B6SB 2HAZA 4NQCD 4ORGA 2WV3A 5MEPA 5L0QB 4C4BA 3CN0A 2ZG1A 2XQYK 2FEEL 4AM0B 1ZVHA 2F9BT 1DHKA 2R83A 2VH5L 2DWYA 4N2NA 4KHXH 2GY5A 3MMEB 3VYOA 4NC0B 5BJTA 1RVFH 4PWJA 4BE5A 5F7HA 4PD4K 4QOKE 1XF2A 3GKWH 4AKOA 1OALA 3QS3A 3B2XA 3TASA 1RAMA 1PLGL 2V7NB 4DEPB 5DJ2B 2EACA 4NQEB 5CZXC 1Q9LA 4LHUA 4PJ8A 4UT7H 2VIRA 4JDVB 4TUJA 3RWHA 3O6MH 4YN3A 4KAQH 2YKLL 3BYYA 3TXAA 5LGKA 3F58H 2CJTA 1LE5B 3EYUL 5LWYL 4OI7A 4KKBC 2OL3A 4HJUA 2Y23A 3DHPA 3DECA 1QYGL 5D1ZA 4TLUA 1CLYH 1V54B 2HT4C 1AO7D 1GOFA 2H3NA 4ZK8A 3OR7B 4OZGE 5KVGE 2J57A 3W9EB 4ODUB 1EFXA 3F2LA 2G75B 2FJSA 4JFFE 3O4OB 4RNRA 1JNLL 3DGGB 4FABH 1CT8A 5EC2B 2M8XA 2Q86B 3Q01A 4UDTB 5ICYB 5K9JH 4KITB 1BZOA 5MEND 3NJKA 5I0ZA 2VN4A 5EZIH 1ZHKB 2WNXA 4BSWA 3MUZ1 3IXTA 2A9CA 4W9LC 2E7MA 5A6MA 4GQPH 3FO9A 1KC5L 3X11A 1WS7A 3FTYA 1TSHA 5I1IH 2NQDA 1NGXB 2BWIA 4UUJB 3BAKA 1JCVA 1H8OA 3WE6B 1Z3RA 3T0EC 2BSCA 5EMYA 4M5ZL 5EH1A 3LPGA 3RPBA 4FQHA 1DLFH 1BFOB 2AK4A 4JFFB 1XAUA 5BZZA 3OZKA 5JPNA 4MS8D 4MCYA 3RZWA 1B2WH 4IIQA 1KENL 1AY1L 1HL8A 5HI4D 3N1FC 3IFPA 4P2QA 5ERWB 1MQKL 4MDIA 3X1GA 2ZCKL 3MJ7A 5D6DC 4PH8A 5DJ8B 1PZUB 5C0AD 4PY8J 2Y3NA 3L2NA 2F68X 2P80A 1I85A 3B7RL 1QASA 3BPOB 1U3HA 3U30C 5CEZD 1AKPA 4BRVA 4G1EB 1B3IA 1MRFH 2UY6A 1TQCC 3QIUC 3VW3H 4JAMB 1HX0A 1GGCL 4PGZA 3MJ9H 43CAB 2MQCA 3C60D 5B1KA 4W9EC 1Y18B 4CW1A 4KQ0A 4NRZB 1MCLA 4L4VB 4OVVA 3PPSA 1C7TA 4IRJB 1JHLH 1J8HE 3SY6A 3TH4T 1XX9C 2O6FA 1MCPH 15C8L 4KJQC 4Z7UF 1C9SA 4ZNEA 2CBPA 4JM2B 4BFEA 5JIDA 5DMYA 3QI9A 2V3DA 3WEAA 4OGXL 5JIKA 1LMIA 4Z7VE 3M1CA 3MLPA 2ZT9C 2IH9A 3LVTA 2ZUVA 2X6BA 4JKMA 2UWEB 4V11A 5FGBA 3V0HA 5CUSL 3KWWB 5K5YA 3UTZB 2AANA 3A6CL 4N85A 5I8OH 1UXMA 5DUJA 2CLVA 1JZFA 3BP6A 4L8SB 4IRJD 5KEZA 5ALBL 3NPSB 4QRAA 4YDKL 1IM9B 1IT9H 4MS6A 2D03L 4ERSL 3C5JA 2DJ4A 1UD6A 2AJZB 3GMMB 3QE5A 4LLQB 3T1WA 2AQQA 1IAMA 4ZPVA 1OCOB 1CDBA 4A7TA 2X7LA 1FJ1A 1YDPA 3TLRA 4B27A 5K39B 4JANB 5E6IC 1A6PA 4X99B 3ZTDC 3EH1A 3SDAD 4DGIL 3AT0A 4UIMA 4Q4IA 4F37K 2FSEB 5GSRA 2Z1KA 4UILH 2BWQA 5F6IB 3G5XB 3AM8A 1PTZA 1NJ9A 1BMGA 5BVPL 1JNNH 3EHBD 4P5TC 1B6DA 3HUJF 1H3XA 5E8PB 2I25N 1YEIL 2PKDA 3C2SA 5HVHC 5TE4H 4HD9A 1QEXA 4OD2A 4UUJA 3QZBA 4JNXA 4X6DB 1OAXL 3QFJA 4TSBL 2LLNA 1AQKH 2FWOB 4IW4C 5I74C 5JTWA 4CBPA 1SJXA 3RWDA 4GQ9L 3CC1A 2X42A 3RBSA 2TRHA 4PJIB 1IKFL 4P2AA 3AXHA 1KTDB 4IMKA 4W9IC 5E5LA 2NYKA 2I7OA 3S3BB 5HY9B 4X4MA 3MRJB 3WMSA 1SRDA 4IOIA 1GJIA 4G71B 5DQ9A 3SE8H 5IB4A 4QRSB 2ZOLA 1D5XB 4NOFA 2WLHA 3H9SB 4MD5A 3CZJA 3GGWA 4YZFE 2J7LA 5AG8A 2FECI 2K7QA 4PFEA 3LH2L 1GMIA 1BA9A 1I9IL 1WEJL 1HFUA 4X7DC 4KJQD 4AUJA 2R1WA 2WXKA 2JV6A 2MTAA 2VN6A 3R1GH 4NRZA 3FUIA 5ILTH 5DLMH 1JZIA 2XHNA 1GYWA 5A6IA 1BJ8A 4W1TA 3VRJB 4L8BB 2AXGA 3RGBA 4YHLL 2VOTA 1S2EA 1WWBX 1T04A 1DQML 4K73A 5AW3B 1G7HB 3SGJC 3RVTD 1FZOB 2A77L 1EHAA 2WVSA 4RIRB 1NUFA 1TUPA 1P6AB 5D2LB 1R3HA 2X3AA 3CZUB 1PLGH 2C9AA 3IBOA 2Z31C 5C0AA 1XDQA 2IWGA 3SGJA 2Y1ZA 5I6KA 1HAWA 5FM5O 3VXMD 1FE8H 3KXFA 1MCPL 4FA6A 1VGEH 1KTRL 1U92A 3O8XC 2ATPA 3PFUA 4YSRA 3D30A 1NIBA 5T33L 5BV7L 4WHYH 1SDDA 3HZKB 1TTCA 3LQZA 3OHXB 1MVYA 3V52H 5BOPA 3QCTH 3ZDXB 1W72H 4HK3J 2HA1A 2E7CA 3ZIMA 4ZMWA 2YD9A 1A7OH 2ADFH 3KXFE 1UUSA 2I07B 2J73A 2WWOA 3QZOA 2DWSA 3MCYA 4G8AC 5K9QI 2D8KA 2WZPA 2BY1A 2FQEA 3G6JF 2YPLA 3K91A 4HJ0D 4MNQE 4B9KC 5I5IA 3KR3L 3FT2A 5JORA 1IGFH 1SUHA 3B2VL 5JHLA 1CG9B 3R06A 4BFIA 2ZKXA 4EUPB 3K6IA 5ALBH 5AWNH 3ROOB 4JFDB 2VYRE 1QLEB 3NN8A 4ZS7H 5AL0A 1KBPA 3UAJC 3MUUA 4XMWA 5JHDD 2VZUA 3HRZA 1T5KA 5E95B 1S9KC 4HQQL 4A04A 1MCOL 2BSED 4H1LB 1NLBL 2F53B 4AI7A 1LNUB 2WBJA 3A6BL 1F13A 3DHJA 5E4EC 2NY0B 5L2JB 1UA7A 3FCSB 3U2IA 3I50L 2FIKA 3RWFB 2CK0L 5JOPD 3RLSA 5CEZH 3WO4C 4N2GA 4XP5L 1JYVA 3D9AL 4FZ8H 3RZCB 3NJHA 1J05B 3DDFA 1TZHB 4BQ8A 4ELKA 1EVTC 4GG8A 2DKMA 3RX9A 3AB0B 1CIUA 4JFDD 5CILL 3H9SA 3TJPA 4ZSOB 3ES6B 1BXUA 1T7XA 1I1FA 5E6SB 4PGCA 5TPWL 4YSEA 2FJUB 1OCWL 3TBWA 2X4UA 5HHVH 1QG3A 35C8H 2AQNA 2FL5A 5TH2B 7FABL 3MKGA 1LO5A 3NACH 3GIVB 4KRPC 5IREA 2ENYA 5I24A 1OARL 1RV6X 4PWGA 5BQ7B 3S36L 3RKPA 4OKDA 3ECQA 3IJEA 4TRPL 1TTUA 3MLTA 3BN3B 3ZL1A 4DZBA 4PI0A 2CHWA 2MKLC 4WJ5B 4WTZA 1MJ8L 4WHCA 3S4SA 5E2VH 5J5EA 4LNRA 1G7IA 1BQHG 4Y4HC 2EDFA 2OK0L 3DUSA 4GSRA 5JIHA 1AH1A 1V27A 1DO5A 3UAAA 2HMIC 4Y19B 4UYPA 3TJEL 3ARBB 1CBVL 4L4VD 2ATAA 5AAMC 1SF3A 4NERA 2WM0A 5LUMA 1OF0A 1FBIH 3Q6GL 5FFGA 1N64H 2UWEF 1NMAL 4F7CA 4NNPH 1YNTA 2XXGA 5F96L 3GTVA 5ICXB 5HGAB 2Z64C 1ROCA 3NTCL 3DOIA 1ZE3C 1P5VA 5D1ZB 5ESVB 2VCOA 2WLLB 4OV6F 3RI5F 5DURD 3HB3D 3OB0K 3NG5A 4FYRA 1W15A 4P2RE 4XXCA 1KBKA 1KYOK 3F7QA 5HPMA 2ZD0A 1YN6A 5IJVA 4X5PA 3WBDA 5JW3L 4GT0A 1FP5A 2YMOA 1A1NB 4W9CC 3BWUC 5H37G 3TA3B 4Z7VA 3IFLH 2EC8A 1OP3K 4YDKH 4AYDC 4HZAA 2BWDA 1U8JB 1NCDH 1HESA 2F74A 3MYJB 3H9YA 4O5LL 4QXGH 5J13B 3HMWH 3VD0A 5I0VA 3MV8E 2B1AL 4W9FC 1TCMA 2O30A 3HHMA 1QSFA 2H1PL 5B22A 1I7RA 1C5DB 2IVFC 3S2CA 3VXRE 1CI5A 2EXYC 1FGNL 5E56A 2ED9A 3PQYD 1MW1A 4FFVD 5GRYA 1CL7L 4FTVA 4Z7WF 3L3OA 2HVKA 3COOA 1H6TA 4MQXC 4ODTH 3FBQA 4M4RB 2ZWYA 1MRCH 3SDCA 4GNKB 2MCPH 1WSST 1BF2A 1XVSA 4DKEH 2R2EA 4K7PY 3WNNA 3E8VA 1ZGLM 1CE1L 3LKSA 4NGHH 3VNZA 3SDDB 1K2DA 3L1OL 3LKQA 1I3GH 3U2SA 3BLKA 3MUHL 4HAFA 3P40A 5AVUB 4OZHE 3TT3L 3VXSA 5MHSD 1IC4H 4FL4C 3ETBF 4XNMA 1UT2A 2VXSL 2GJZB 4AIZA 5D2NC 2NY6B 2OMUA 4ZXBB 2APTA 2YGVA 4PGBB 3HG1A 2VZ1A 2NX5E 1J10A 4Y5XA 4M5YL 4HUWB 2GT9B 4JN2B 2K4AA 32C2A 2B4CL 5DVMA 5IROD 1MW0A 3EO1A 3WNKA 1MPAL 2AQ3A 2XFGB 3EF7A 1IC1A 3O45A 4UT6A 4L48A 4DGYL 2X6CA 3E2HB 3OKLA 1IARB 3OC5A 4Q2ZB 5AB0A 1XGRB 5KAQG 4XB3A 3FFCE 1X5GA 3VI4E 3IU3B 2NY3D 4XE0A 3ILEA 3KLQA 3LRLA 2H3XC 4JFOA 1GYVA 3NT0A 4LU5L 3Q5TA 3UTOA 3I9GL 4HXAL 3MV11 4PJ8C 2CO1A 2QPDB 4AMKL 4Y2DB 1J0ZA 5IP4A 2NW2A 4M8RA 2UZIL 4MJIA 1Z0NA 4LASH 4Z5RA 4U1LB 1FVCB 5H2BB 2EYTB 2KL6A 3MTRA 1G7LA 4GAFB 4AWJC 4ANXA 2FGZA 3CBKB 3H7LA 4DW2L 4G8IB 4IU3B 4PP1C 5ID0B 4DF9A 1N8OE 1RZGB 3L9RA 4EUPG 5BRZE 5ADPH 1H5BB 3CK0L 4JG1H 2X6MA 1LEGA 5IMMB 3ZDWA 1JHLL 5IB2A 3DIDA 3VGBA 5C0IA 4URTB 4IK7A 3VI4B 3VXMB 5CJXA 3NFPA 2XN0A 1OGPA 1QFWL 5A3IC 1CE6A 3GJFB 5AAPA 4G82A 3QFDA 1TTAA 3SDXF 3KPNA 4TLTA 4G42B 4A66A 3HFML 1YQ2A 3B56A 3BKCL 2XUWA 1NCUA 1M7IB 2VQ1A 5IESL 4MLSA 2X89A 5E0FA 1D6EB 4BK8A 7PCYA 4X6CB 3HE6A 4AIEA 3QYNA 5CIPB 3VG0H 3B43A 2K0RA 1XL6A 1KPVB 1MFCH 3QS2A 4HZ1A 3OQRA 1JXJA 2BFGA 3MLSH 3T0XA 2IFFL 3HS0B 2E56A 4OZFB 3FS9A 1Y1DA 3NJNA 4HIIA 1QSED 4WAFA 1UM6L 5JOFA 5C2BH 1K8IB 3ARGC 3CCHA 1EO7A 3O8XB 3PWLA 2BH0A 1KJ2L 4X4ZA 4BBWA 1XEDA 3LNEA 3GBNH 4U0QB 1CFMA 2N1KA 2YC1A 4JO5A 1QFWH 4LRIC 4PRDB 5LNEA 3NGBB 3NCYP 3J2PA 5ANMA 3BDBA 2PABA 3ET9F 3HLAA 4XP6H 5IT2L 2F54E 3RFZC 4PAZA 3TBYA 3FT3A 1GJWA 4PY8I 5EZIL 2RTTA 1CD9B 4MD5B 4ONFH 2VLKB 2EH7L 1JZEA 4X50A 43C9A 4H8VA 4OM1L 3VJ6B 3X1FA 4F8PA 1VFMA 3PXLA 4NM4H 1J11A 3X12A 2DF3A 3QDMD 1W72B 3C6LC 3GSNH 1SEBA 4JPWH 4XB7A 1DVUA 1WZ1L 2EH8H 2JLPA 3SPCA 3WFCL 4HHWA 4OD3H 5LGJB 1RD6A 1AFVL 5B7EA 3L2MA 1FFRA 2CE6A 2VMFA 4YFLF 5LGHH 3V9CA 5BW7C 4WUUB 5I19L 5KOVC 3KNBB 3KBHE 5AUMA 4O02L 1X5FA 4JY6A 1AZNA 4GFXA 5JR1H 5MEPB 2EABA 5KSAB 5KSBA 1D5BA 3UG3A 1A9VA 4ODWB 4X4YB 5FYJD 3FAXA 3V6OE 2DQ6A 2F54B 1WBXB 2PYEA 1SGKA 2I27N 1MCNA 4M48L 3LS5H 3NDZE 3MMEA 1OLLA 5FGRA 3W0WE 2WXQA 2X9WA 5DJCA 1EUUA 1W8EA 4OFKA 1S7SA 1MCOH 4U1JA 3MRMA 5IHUL 3OKDA 1RIHH 1WIUA 2QSCH 4N0CD 4PB9L 3NTCH 1M9WA 3UBXA 2Y7NA 1Q8MA 2YQ2A 3QJHB 5CO1A 3EH5B 2VE6A 2D7NA 3G6AB 1HHHB 1LEIB 1LE5A 4PSRA 3L6FB 4GI6A 2ZTBA 5C0IB 4HC1H 3MV7A 5EWIH 1KELL 2A3TA 4QXUL 2IXQA 3TIEB 3OKOB 3ZIYA 3MOBL 3TV8A 5CR1A 4LDCA 2W8CA 3F7KA 4PGDA 5H4ZA 2RFXB 4FZEH 2HFEB 3VFWB 2XYBA 3IB4A 4Y5VC 1XGZA 2BIMA 5BXFA 1BJMA 5F3HB 5DI8B 3KWVA 2KLRA 5CAYB 2X6AA 4JY5H 1ZWIB 2XVBA 4AEIH 3GMLB 1KPVA 1VGEL 2O1AA 1G0XA 1REIA 2P5WE 3CFCL 5BRQA 4DAGL 4KXAA 4E9TA 3MREB 4R3SA 4OZFA 2OXGA 4TTDD 1WTGT 2WBJB 3QI9C 1D9KC 3EJQA 5DJZB 4I3SH 5AFAA 2XA8L 4XC3H 4L8DB 4XVTH 2IIJA 2P5PA 1UWYA 3APDA 3EYQD 2B3RA 1MAML 2A9AA 1SDYA 1NCCH 2DBLH 2VB5A 3C12A 4KPHL 4X5XB 4XN2A 2NNAB 2P5WA 3MC0A 2N59A 3P9LB 3P69A 3Q2WA 1INEL 1R3KA 2CXGA 2TSBA 4U6XA 3DA0A 4A39A 3K71B 1XZWA 5JPNB 2CJSA 3OPZH 4XX1G 3DPBA 1KB5L 3WFEH 3ZDZE 2V0AA 4FNSA 1ITBB 2F15A 3QHFL 1WVZA 3SDYH 1I7TB 3IPEA 3O6KL 3VU1A 3ZL4L 2CGZA 4NRYB 5T5FA 1QWNA 2ALWA 2VZ3A 4P9MH 1QQDB 3BIAX 4WTXA 1CF8H 1G9HA 4U3XA 1NMAH 5DHXB 2NXYB 4NO0B 3CFDB 3S5ZA 4Y2OA 4JGMA 4QO1A 3D48R 4LVNB 5EG6C 1AJ7L 3GO1H 3NA9H 1U3YA 4CW1B 3TEYA 5CBEB 3OKNB 1W16A 2VABA 2FGWH 3M88A 1MIEH 4BA0A 2PXYB 1E4XL 1EJFA 4L37A 3BDYH 4QRPB 4RAVA 4WJ5A 1HC1A 2P5ED 1XGQB 4ZAKA 3VFVA 4LLWA 5I8EB 5I16A 2C1OA 5EN2B 1CLOH 4AQ1C 2WYHA 3HUJE 2V3EA 1RJLB 2QDVA 3M86A 4YZWA 4TV3A 4GO6B 1U30A 5KVFH 1WFUA 4Y88A 1X7QA 1WA0X 1IGCL 1VZHA 2YMTA 5GZNA 3VVVA 4KZDL 1D6VH 3EJJX 4PRPB 4HKJB 2Z93A 4A7GF 1UCBL 2VW7A 3H42L 2P5EA 1E5YA 2XZAH 3CZNA 3ECWA 1FNGB 1F6LL 2CLZB 2E0PA 3FU9A 3S5LA 1B2YA 5HGAA 2R2BB 3O3DA 2YRPA 2YJQA 1QLEL 4FF9A 4L0YA 5FIEA 1I3GL 3JT0A 2PXYD 3OKEB 3Q06A 1KFGA 3BI9X 2FNBA 1R46A 2IXQB 1J0YA 1X5MA 2VDRL 4WF7A 3S5YA 4UV7L 5K9OB 3O2VL 3QDGE 5J3HD 2OX5B 1OAZL 2HFFA 4WY7L 2X7LB 1T7VA 1ZDQA 2H9GB 3P1VA 1ADWA 1ZANH 5FKAB 2OYKA 4DWHA 4JFTA 1T66C 2VN7A 1SOXA 4X99A 3M17B 4YHOH 3GMLA 2NW3B 2R0LL 1L5GB 2SEBA 2XN9E 4Y8DC 4FNPA 5DS8A 4TUOB 1U3NA 3ATFA 2NY5H 2D4FA 2YKLH 2A4CA 2PXYC 4NJ9L 1DEDA 1JGLH 4U3SA 4NQDB 4XMKH 3N85L 4B7IA 3PAVA 4X6CE 2Q2LA 1S9YB 1LO2H 4QRUB 3SDAA 5CSZB 3HBZA 3N43B 4UTBA 2F58L 2VR7A 1HK6A 4Z7NE 4KJWD 1BZ9A 5E24E 3JWNH 1OAYH 5CZXD 1N18A 3C75A 3Q2LA 2ZUSA 1QTSA 4ZUVA 3OM3B 5MP6L 2AI0H 3FTGB 1AO7E 2J5LB 4XMLH 1VACA 5AWNL 5BRZB 2XPGA 3QH3B 4IEFB 3DUHA 2R23B 3RWGA 2Z31A 2ZG3A 4BV1A 2PMZA 4XTRD 1HNGA 4PGBA 4JM4L 3KPOA 4PN6A 5HYSG 5GGUB 1LO4H 2GT9A 4FMFA 1ZA6B 3LS4L 2PCFB 4AYGA 4XHQA 1MAJA 5LXVA 5E6ZA 3MGOA 2Z7ZA 2FEDD 2FUQA 4XCYB 5DD3H 1LO2L 1OOWA 3HAEG 7TAAA 1I8LA 1T20A 2BHFA 4GIOA 4X6EA 4N28A 4OW6A 1N5YH 4LSVH 2P46B 5GIRA 5LDSA 2P8PA 2H5UA 5E9DD 3I6KA 1N59A 2QSVA 4AITA 2MOQA 3PWPA 3VI3B 2KLTA 4WU5B 1ES0B 1SXCA 4XN7A 4YHIB 2VISA 1HCFX 3IDJA 5BRZD 4R97C 5B7MA 2AFNA 3LY6A 3JVFC 4AQEA 4WSJA 2PTVA 1MOEA 1MWOA 1QW9A 5EO1B 5FKPB 1I8AA 3RNKB 2XVLA 4Z77A 3DJSA 3KM2A 4X6BB 1INDH 2BPBA 1G7LB 5D7LE 3DJ9A 1Q9WB 1NOFA 2CBMA 5FO9A 3KPPB 4OV5A 1KEML 3PP3K 3VD5A 2C3HA 2IQ9L 2BMKA 2BRQA 3VXQB 4OB5H 3O0RL 4H7VA 4JO1H 4QHMA 4XN9A 3CMOL 5C09D 1DBBH 3CZGA 5C70A 1TQUA 3RDTA 2LAGB 1U8IA 2VW6A 5J6SA 3TOPA 4HUCA 5I1EL 4GSQA 3AY4C 1NFIA 4W9JC 1S7QA 1JZ4A 1KJVA 2KPNA 4W81A 4PJEF 5ADOH 1FF5A 2FR4B 3MRCA 1HDMB 3MNWA 1D3CA 1GHFH 3I9PA 3VCLB 3SYOA 3ELQA 3QNYB 4HK0A 1Z5LA 4FNLL 1G0YR 5C08A 1JSYA 1QTYT 5F6HJ 3WMQA 4H1LH 2R1XA 1HOCA 1D7DA 4G80A 5I0WA 2BS9A 3BRFA 2DOCA 4OGYL 4WK2B 5E23A 3I6LD 2A6JA 2ZUQC 1JWSA 5D2NA 3QJFB 5CJOL 4CMHC 3V10A 4F2MB 4M8QA 4N9OB 2AP2A 5JXEA 1UM5H 4E9RA 1MZYA 4HJEA 4N0CC 3BIKB 3UZQA 4UOZA 2A2QT 2FATH 5D7SH 3FRPA 3ZW3A 4DOHE 3QDME 3FB8B 2DWXA 4N90E 4DPBX 2NDGA 4YS4A 3HE6D 3MA7B 5HP5A 3DROA 1DZBA 3DI3B 5CLYA 3D3VB 1RL1A 1WAAA 1NH6A 4PYGA 2H3KA 4ICWA 3UH8A 4HBCH 5DFTA 1CLCA 4FNLH 2VNCA 2Z0BA 3L8QA 2X4TA 4DSYA 5KSAC 3HMXH 3CBRA 5IF0A 3JWOL 3RNQA 4GAJH 3DURB 2K3TA 1HAUA 4NUJA 2OZ4A 4FFYA 1UACH 1QO3A 3NZ8A 1FORH 2X05A 4XCYA 3QO0A 4JM2F 1GVIA 2Y06H 3ILPA 4APXB 4R5VA 5J57B 1CO1A 4QMEA 4YHMH 5TTRA 3VQ2C 4NFBA 5GGSA 4I0CC 1A0QH 5F88B 2YMXH 2X4RA 3HAEA 3FF8A 3QUMA 5C6PB 1CFTA 3W37A 4MSWB 1AP2A 3OGCA 5FV1L 1OGAA 1UGKA 3BKML 3HLKA 4V33A 3TBBA 1G43A 4FXGC 5C08E 1XSJA 2OXHA 4MMZA 3HC0B 4UBDD 3ASNB 2A6DA 4M7ZB 2AK1L 2KT6A 4IIQC 2ZF8A 1VSCA 3N1QC 4UOJA 1S7WA 5E8OB 2KLSA 2H2SD 4ONFL 3VXSE 1HH6B 1BVKB 1E4KA 4A7QA 5GRWA 1WFJA 2BP3A 3PFQA 2MCAA 3T4YA 3O6LH 4R0LA 4XMXA 4U6VH 4FFYL 1FCGA 5K9KA 4NJAH 1DFBH 2JB5L 2UYLB 4NUGL 3QG7L 4PRPD 1QSZA 1PZAA 4U1HA 4I0PC 4M5ZH 3IJYB 4EIBA 1AHWA 1HDMA 4Y16A 1TNMA 3CZFB 3DSFH 3QVAA 3FQYA 2WVVA 3GNML 1R3LB 4WVRA 3GM0A 1F90L 4D7PA 4JPKL 2IBZY 1KCLA 1KN4L 4PY7A 3ZT7A 5D1XC 2F7QA 2CU9A 5EO0A 1BIHA 5IESH 3L3IB 1E8WA 4S0SD 3NACL 1TKWA 5KVDE 3HUJB 4HMDA 2KDGA 1BPLB 2X3BA 4S1SL 1XAKA 4GLRH 3BIKA 1KV7A 4W6WB 4OVUA 4TMPA 1U42A 3FL7A 3RUGB 1WUNT 2VW4A 5DDHA 1BOGA 4P2RA 1HHKA 2MOVA 4PJXE 3BE1H 2VWEE 4HWZA 5D7LB 3FUDA 5E2WH 1V8HA 1OLZA 4IRZL 5LXGL 3U2SB 2PP9A 3K4ZA 3HKZA 2V7HA 1JWUA 2GJ6B 4NM8H 1CTOA 1ZEAL 4LLVA 1D5MB 3CSYB 5TQ0L 1QBML 5EFIA 4TUKH 3HPJA 4KC3B 3ULUL 1G9ML 2BHZA 1A1MA 1HU8A 4HU2A 2EIMB 4AIZB 3O41A 3AROA 4N68A 3L1FA 5D7IF 5HYQA 3ZDZB 1U8HA 4A2GA 4Y2OB 4EN3B 4DHLA 4WEEA 3WEOA 2E6PA 4LOEA 2OULB 4LU5H 4M93B 4FNUA 2R9HD 3DARA 1N10A 3BQUD 1AR2A 5L6YH 1J5HA 2I60H 2ZE0A 2PNDA 2L8AA 2Z65C 3MNVA 4WDIB 4DERA 4KKZA 3B8YA 5I73C 4OD3L 4LHUD 1V3LA 5F88A 1Q0EA 4JQIL 1R5IB 1IAKB 4JE4B 2WLZA 4BD4A 1I9IH 2HX7A 3D2UA 4QXTB 4K3DL 1XF2B 4OCXL 3GMNB 2XNAB 4PG9B 4DKTA 3A47A 2IPUK 4LBEA 2GIMA 4QRQA 2WB1A 4GG6F 1J8SA 4IRZA 1NAMH 2A1WL 3FQTB 5TE7L 4D9LL 5E9DB 5DA4A 4GRLA 1RJCA 3M1BA 5L4FA 4Z5RB 1AQMA 4NB7A 3FB5A 1BLNA 1OPGL 2NY2B 5C9JB 4LPCA 4L1TA 5E1AB 4IU3A 1OZUA 3B2MA 2LTQB 5I1JL 5JDSB 4I48A 4KKRA 3CDYA 1GR7A 5K9KB 3VFUA 3W9EA 2H3NB 4KROB 3IJ9A 1QA9A 1CE1H 3MCLH 5DJ8A 3ULUD 4W6YB 3L5WB 3I02A 5KUMA 3DSNB 1MJ7H 4RQQB 3MXVH 3DGGA 1D7CA 1O5PA 1MI5E 5FKAA 4QT5B 3BDYL 1KFAH 2ATKB 3LEVL 3PDOB 4IRSD 4GKLA 5KVDH 1CFSA 3BKJH 4BDVA 1AS8A 3ZGHA 3QDGB 4ORGB 3WCYA 4N90D 4YE4H 4I2XA 4H5SA 3LMJH 5C2UB 1Z7JA 1T2JA 4MQ7B 3MRLB 4NKQB 4MA7L 3HS9A 3JYCA 3KYNA 3X11B 3BH9A 4MXWL 2MRYA 1HJCA 1RPQA 2L3BA 2R59A 1D5IL 4GRWF 2EDMA 4K7PH 2J2ZB 2YN3A 4G9DA 4GXUM 2R69L 2VDQL 4PJ7B 5JIIA 4BK5C 4EZLA 3OBAA 5I6XC 1L3WA 3PYCA 2WSKA 2X2IA 4Q4EA 4X9IA 2C26A