2A9CA

Crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
359
Chain Sequence
RVNSQKPFNAEPPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
total genus 89
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9cA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9cA01
4PW9A 2CA4A 3HBGA 3HC2A 3HBPA 3HBQA 2XTSA 1XDYA 2BPBA 2BLFA 4PW3A 2BIIA 3R18A 2A9AA 2A99A 1SOXA 2A9CA 2A9BA 2C9XA 2A9DA 1XDQA 3R19A 2BIHA 1OGPA 2CA3A
chains in the Genus database with same CATH superfamily
1JYXA 4HJJH 1JNHB 1XGUA 1JOIA 2XIDA 2X3BA 5KSBF 3T6QC 4ZNCD 3UZVA 2UZYA 3DETD 3FH8A 1QLRA 2EVIA 5FB8B 1KTJA 4R7DB 4A2LA 5I6XC 3MR9B 1GGIL 3FW6A 3GIZL 3T6WA 3UGEA 3QQDB 2IWKA 5FF6B 9CGTA 5K69A 1J8RA 2ZOKB 3QJHA 4ZUSB 4BQ8A 4PJHF 1BAFL 1QG3A 3CFIC 3QQ4B 4YXLL 2UY6A 4G8GB 3V5KB 2JKIS 5HDBF 3WOVA 1A66A 1UD2A 3D0VB 1PTZA 3FZUC 4NQDD 3MLWH 2M8XA 4HUUB 4L3CA 5HGBB 3DX7B 5TDNB 2LT9A 4OFYD 4IRSA 4LCIH 4ODUB 4YHZH 3P2TA 4DP5X 4K23L 4KGLA 2V5RA 4L8SB 4FABH 5H35B 5I5IA 3NJVA 2AJ3B 3C5ZD 5TDOB 2WVVA 4PFEA 3RVTC 1BZ7A 3A24A 3WFHB 1AH1A 1DQDL 3EAKA 2KZKA 4TSAH 3VG9C 1L3WA 4I1PA 2DM3A 3U6XS 4BKLB 1LO2H 4IYKA 2NSXA 1OAXL 3VXPA 1RQ5A 2ZWYA 3JV4B 4UCFA 1ORSB 3TH3T 1TSHA 4GSRA 3RWEB 2JCCE 2IDFA 4UIKL 4R0LC 3FRPA 5FA4A 3GMOA 3UC0L 1MJJB 3BMVA 1R5IB 1OB1A 2BOCB 4XBMA 1ZT1B 2HLEB 4HUXA 2MCG1 1Q72L 1YN6B 4W6YB 4HSCX 5E51A 1MCRA 3CVIL 1B0WA 4OLVH 2WLKA 4MQTB 4N2MA 3NJKA 2BFVH 3SPHA 2ZUQB 3GRBA 5MP6H 2R0KL 3C5JB 1WE5A 1IGYB 3FUFA 3OKDB 3SKMB 1QWUA 1R3IL 2JKNA 3ILEA 3QZLA 4JO4L 5E56A 5F9DC 5B39G 1LE5B 4C4BA 1H0DB 4EDXA 4M8QA 3T3ME 1UM4L 1KJ2B 4RCAA 3ZKNC 4F7TA 4HPHA 2E7DA 3U6XA 2WQRA 2WXHA 1KTDB 1NWOA 3BO8A 3KYMB 3O45B 1V5JA 4RGNC 2FEDD 3EJRA 5HHNB 1CDIA 2OL3B 3UPCA 2JF1A 4PJ5E 2C26A 2J6EH 1G7LA 1BAWA 2UWEA 5CBEA 4YDNA 4ZTPL 4NN6B 1DQJB 4OVUA 4A2MA 2EVJA 1M05B 1PKQA 3IMSA 4P9MH 1YQ2A 4PRIE 3CIQA 2BNQD 3FHQA 1P4IH 1KGCE 4OGYH 2VDOH 4P04A 4W4NA 4KUCD 2R2EA 2J4WL 1EIBA 1JGEB 3N85L 3KJ6H 4KMTH 4AIZA 4E5XB 2D3JA 3B2DC 3C5ZB 1CXLA 1M7XA 4HX1A 2Q2EB 1OV8A 5DMKB 3VW3H 3AT9A 5HHOE 3SYPA 1IBBA 1CYXA 2UZIH 1O9VA 3QZWG 4ZMTA 4AYBA 4MA8H 4P2OA 1CD0A 5EEWA 2F58H 5KBLA 5GS0H 2H4EA 1TFHA 3HB3B 4UBDC 3AFLA 1ZD6A 5ALBL 3OWEA 2A77L 1ZA6A 2X70B 3LOWA 5K1VA 4PP2A 3SBPA 4MB3A 4N0FA 4HETA 5AQ0A 4NO0A 3BGAA 5EC1B 5IIEB 5TF1H 2X6BA 1KTBA 5ADOH 3BWAB 2A1WH 1UWEH 3LVEA 1I8LA 2XXMB 3O6LL 4O9HH 3MCG1 1MHPH 5BS0D 5IJVB 3D39D 1T66C 1GYVA 4X6BA 4L29A 1QSFA 4FKHA 5JLZA 2PW1A 5T5FH 4LLDA 5HYSB 2NY2B 3CDZB 3IKCB 1KNOB 4M7KL 4XNMB 3SHSA 5AFAA 2P26A 2WB1A 5F70A 1DDHA 2IWGA 3MLZH 3AQXA 4YBQD 1MCBA 1MCLA 2F54A 3GS0A 3ZDYE 4F57L 1PQZB 3KWWA 4B9PA 2EYSA 3FU3A 3F7RA 3MSPA 4GQ9L 4QYOB 4E9TA 2HVKB 4AVIA 1CI5A 4ELKB 1JD7A 3FTYA 3K80A 2J88H 4FQHA 4M56A 4NM8H 4JY6A 1A9EB 3C6LC 3FFCA 5INDA 4DGUA 2GSMB 4GIOA 3HI1B 3QJXA 1O9ZA 2NNAB 1NL0L 3GMRB 1VEOA 1H5BA 2V5TA 3E2HC 5EN2A 5TE4L 3O4OB 3C12A 1G9ML 1E4WL 4HKZB 1NQBA 4LU5H 2NW2A 4M43L 3LKNA 3QULB 2AXWA 3ULSB 3CE1A 2A6JA 4JHWH 3OMAB 4FI8A 2RR3A 3VRIB 5T1KA 2XPGB 4R7LA 1LHZA 1G6RH 4HKXB 1AHWA 3BW9A 4MS6A 2XLLA 2JTYA 4A39A 5E6IA 2E86A 3LJ3A 1NGPH 1TZHB 3RTQD 3AB0C 4XZ4A 2Z8SA 1RUML 2YPLA 3QO0A 2BSRA 5JPNA 4FS0A 1OOWA 4LP8A 1ZPUA 5L7XH 4KJQD 4OQTL 5IFAH 1JGUH 1FHGA 2LV4A 1XEUA 1ZVSB 2OMXA 2ZXDA 3Q5TA 2XUWA 2LFEA 4P23C 3QYNA 2UXFA 3KLLA 3U1SL 1DSWA 1KC5H 3WFBL 3ULVL 1T2JA 3WS3B 4E36A 3HBQA 3CFDA 3C60B 4Z7VA 3IDMA 4FULA 1HE8A 5KZCD 5D2NE 2FWOB 1ZHLB 4V1DA 1UATA 1FFQA 2A73B 3B6SB 3DURB 3F8UB 3LXBA 1VDGA 1S2EA 2VAAB 3V0AC 2Y1AA 2L0DA 4EN3B 4FQ2H 1J87A 1UD8A 2F5AL 2W07A 4IKJA 4OW6A 2P5PA 5DD6A 3LSOB 3KWTA 1EUTA 3ZZQA 5HP5A 3BPOC 5AVZB 3LPFA 2ZOUA 5B39A 5DQJA 1A1MA 3QHZH 2BSSA 1M2VB 5ID0A 5T5FA 3V4PH 2M26A 3G9AB 4HT1L 4JMXA 3U0WL 3LEXA 3D2UD 1DBBL 3NFPB 5EDSA 4BCZA 3SPCA 1RPQA 2ZKMX 3KEDA 4ONFL 2F15A 3REVB 3SQBB 5D7HA 2VR6A 4GXFA 4NWUL 4DCQA 3PV7A 4YLCA 5EO1A 3OZ9L 3FOMA 1O5DT 3FQXA 5IB4A 4BELD 2FR4A 4HS8L 3FT3A 4PJ5D 5FIEA 5FK9A 3O3UN 5D1ZD 4A04A 2OW7A 1RJYA 1I9JH 3H4FA 5IROA 5HI5D 3RVWC 2WUBH 4FKEA 3RTQB 3VGAC 4G1EB 5C71A 4NAJA 1D5RA 1XF5A 4Y1AE 1RI8A 4PRID 2CDEA 3EYUH 3PAVA 2HKFH 1KGCD 5IEKA 2I7SA 3GNML 3NFSL 3MNZB 4Z7UA 5C0BE 1OAQL 3HNTH 4IEFA 2RMNA 3QE5A 4APQC 4CA4A 1G7HB 3QZWA 4YDKL 2ESVE 2CO7B 5HHOD 2HN7B 4J8QA 3NIGF 1P4BH 1THAA 2XXCB 3PGCA 1K8DA 4U1MA 1FBIH 1CICD 1ZWIA 3CFNA 4WTZG 2YXMA 1DJGA 3QDJE 4JFDD 1Q9KB 4PPTA 1F6LL 4L4VA 1YY9D 1LQBC 1M7DB 3IU3B 4XWOC 4Y5XC 5DJCB 5JNYB 5IV2A 3TVMC 1ZEAH 2LTQB 2N0MA 1C12A 1PFOA 3A6OA 3EOAB 2F53E 4Y4FD 5GJSH 1M7IB 3CFKA 4DKAA 1EEZA 1R3LA 3QO1A 4XXWA 2IH3B 3RGHA 4WHDA 1GIGH 2FEEL 3EDFA 4YSDA 5K39A 3X1BA 5IHZB 2R4SH 4H5SA 4QXUH 5KJRH 1M6OA 1M53A 5I76B 3T3PF 4AV5A 2W60B 5FUOL 3US9A 4AI7A 5JORB 1JHLL 4DUWA 2CGRL 1S7VA 1L5GA 3X11B 2OK0H 2A83A 3WEBA 2XWTB 4NN6C 3BFWA 5AW7B 2YUWA 3T3MB 4G1MB 1BCIA 2P49B 1EAOA 4F8LA 3C6SB 4A68A 4V2BA 4HCGA 1YNTB 4U05A 5A1AA 1JERA 1H6UA 4JFWA 5EA0L 2QPEB 5IREA 1YECH 2EUVA 4YFLF 1ZLSL 2XETA 1U2HA 1PYWB 4PJ5B 2P46B 2OLDA 5D1ZB 4A7GA 2V9UA 2ZIDA 2FJHA 5F0MB 4PGDB 2JKJA 5CIPB 4FNLH 4FA6A 4ZFFB 3ZE2F 2WCSA 4MXQC 1D5XB 5AVWB 4LCUB 2MQ3A 4PRIB 3T4AA 1UVQB 2FO4A 4PJ8D 4MX7A 4M5TA 3S97C 3EHBC 2YKLH 3VI4A 5BO0D 4YHNB 3GXUB 4PJGA 3U9WA 4U2ZA 4O51B 1I7RB 1I8UA 3FPYA 3MQIA 2YQGA 1OSEA 4I13B 4ZMXA 3IGLA 5TE7L 4UUJB 2OR9L 3HRZB 1NZRA 1TXKA 5T1LD 1J5IA 1VESA 3UC2A 2IQAB 4BD4A 2WBXA 2GT9A 5DHVH 4F7MB 1I9RH 2F0CA 3SGKA 5SV4A 1BPLB 4WV1A 1IFGA 3GBMH 2NY2C 4FMFA 3RGVC 1P5UA 2YR3A 2GSIB 2CKBA 4Y4FB 3BI9X 1SHWA 5IW6A 4PUBL 3QNXA 1KIRA 2H2SD 2VKWA 2OJEA 4LCCB 3U4KA 1INEL 4A6YH 5KVFH 4K3GA 3CLFL 3MRIB 4ORGA 1ZXKA 5DC9B 4JKLA 5FM4A 3O6FD 1GGTA 3SDXF 4YHYB 1DCLA 2YGVA 3ARBC 1X5LA 5DD1H 1UG9A 4BM7A 1V05A 1JDAA 2W38A 3HAEB 1OE3A 2ENYA 2F7RA 3G6AB 3AWGA 2IJ0C 3JV6A 4EI0A 4K71C 4G6AC 1S9VA 2MPAL 1LEGB 2GTZB 1I3RA 2VMCA 3CFCL 4NXKA 2YPVA 5IP4A 1FF5A 3ZDYB 2ZNWA 5KSAC 2X4QA 3GTVA 3CD4A 3BT2H 2PYFB 5KEZA 3ATDA 3H42L 4OCRH 1FPTL 5BV7H 4G8FA 2G4EA 4CU8A 4G7YL 4E9WA 3KLHC 4YR6B 5E7BA 1B0IA 4NP4L 3SYOA 2CKNA 4F2EA 1H15B 3H6AA 1C7SA 3W0WB 1NKGA 2EILB 3ZDWA 1YMHB 2ITDB 4LSSH 5E1IA 2P45B 1B3IA 3W2DL 3U9PL 3QJTB 2ZAHA 2AV1A 2Y1YA 3IRCA 3GMLB 1GJIA 3L17A 1FFOB 3X14B 4O00A 4PJ8B 1U8PB 3GYRA 3TESA 3REWA 4DO4A 2YMXH 5HJDA 2D8KA 4IMLB 3X12A 1AO7E 4HP5A 1DP0A 4KFZC 4JFPB 3P1VA 1F4AA 1QR4A 2E27L 1ZANL 1JXDA 2VABB 1PDKA 1JZ2A 1UCTA 4K7PH 2J8OA 3HN8A 5AW9B 4U6HB 3HI5L 1GW6A 1FCGA 3G08A 5C0AE 4D0DB 4Y1AD 4Y2NA 3C9NB 3L95B 3R06B 2CAKA 4PRHE 3RVXC 2OMWB 3TO4A 3D6GA 4O4YH 5C0BD 1IGTA 1LD9A 1P7QB 3JWDH 5GZOD 4OZ4B 2ESVD 4ZZKA 3TJEL 2VL4A 3DMMC 4AH2B 3O6FB 2EZ0D 5L4JA 4PJCA 4WTZA 5CEZL 1AGDB 3VDAA 3DGCR 3JUZA 5H37G 5D2NB 4KO9A 4ZSOA 3QDJD 4O58L 1O6SA 2A0LD 4HH8A 5FCUH 1EEYB 4GKZA 1TLMA 2UX6A 4P2RE 2O6CA 5AVUB 2F53D 3F12A 5ESQA 2XSKA 2DB8A 5FYJU 4MDRA 3VH8B 4KUZH 5B8CC 3L9RA 4KITB 3FQ1A 3I9GL 3MGTB 4DGIH 5D93C 1Y0LB 3V5HA 2E9GA 5IMOB 4U1IB 4IGBA 2C9VA 2WO2B 2CLVA 4OZHA 1AZUA 3QI9C 3L2LA 4LXFA 2VQUA 2QFRA 1BVKA 4JX0A 5TH2A 3S35L 3CDGA 3D52A 1PZ2A 2RA1A 4KVNH 2D7NA 4PYGA 1VADA 5BUGA 5G4OA 2YRLA 2EC8A 4XMXA 5E8OB 4XCFH 3OTTA 1Z3GH 5DC0A 5FYJD 5HVGB 3K6SA 5EO0B 1BLNB 3H1ZA 1BWWA 7PCYA 5KYWB 1QFWH 5ADPH 2EE3A 4KV5F 5KSAB 1E9QA 9PCYA 4Y2OB 3FNKA 5AZUA 1SMOA 3S4SB 4G8EA 4BZ2H 1NGQL 5IHLB 1G43A 3I75A 4Y1AB 4Y16C 5AB9A 3O8XA 1B4JL 4B6ZA 4XP4H 2W65A 3ZL4H 4DKEH 4IBVA 3SY0A 4Z23A 2ZP8A 1RZJC 2YXVA 3NCJL 1J0YA 4ZS7H 5EZLA 4XNZC 3SGDI 1TSRA 2FQDA 4GP4B 2ESVB 2A5UA 2EIZB 4AYEC 1DQML 3HE7A 1OD9A 4UILH 4UMSA 5H37H 2ALAA 2WSPA 1IT9H 1KLFB 5E8DH 2WC7A 4OQ1A 4W93A 4P48A 4AE1A 1QYGL 5D5MF 3B83A 1Z9MA 3MLUL 2B2XH 4Y5YB 4I3SL 2GJ6E 4P06A 1WPCA 2X4SB 5A7EA 2AK4A 1S9WB 3BPCB 3BPLB 5DJZB 5I6LA 1E7VA 4H8VA 5CGTA 3F65A 1VB9A 1YN7B 3QORC 4U6XA 2APTA 2ZSVA 3TT3H 4JRLA 1GVIA 2CIIA 3RIAK 2AQRA 4IBSA 5HI3D 5EF3A 1QPPA 5IR1A 2YAOA 4YFLI 3MJ7A 4HBCH 2MNWA 4BJLA 3IT8D 3ZQWA 2K0RA 1UA6H 4BDVB 3LQAL 4FFVC 2BHUA 4JRYB 4XN7A 4P9HC 3V0DA 3BAXA 3PFUA 3N1MC 1ERNA 5I0XA 3EYVA 3NFNB 5A16A 4U4BA 1AZRA 5AYTA 2X7LA 2ZPKL 3QEQE 4FL4B 3QHTC 1AR2A 5KSVB 1MVYA 4BQ6A 3WTUA 3D3VE 3SQOL 1I3UA 4X5XA 4LVNC 2AJYL 3KVQA 4NHUB 4JMNA 5IOPA 1N6VA 4K8RC 4U1HB 4UNUA 2ZUXA 2WLNA 3OM3B 3PWLB 4PGZA 1G7IB 4BRVA 3HMWH 3L5HA 2NQDA 2WN2A 4U0RC 5HYJE 3DV4A 2HLAB 5ISZE 1AO7D 4J6RH 4MLIA 5DU7A 3PUCA 4GSDL 3E3QE 3WYRA 3WHXA 5CCKL 1M1XA 5F7DB 1D5IL 3V6OE 3EJUA 3NH7L 1YPZB 1JD9A 4WUUA 3JWNC 4XNQA 5C0AD 4XNYH 4ENED 3EFFB 1U8HA 1J05A 3CSGA 5EU3A 4XVJH 4NNYB 5C7XH 2BDNH 3PIQB 4BZ2A 5JHAA 4MD5A 2JNZA 4PRHD 1S7UA 5JPMC 4R3SA 1N0XL 2W9EL 4W9EC 4BGLA 1PIFA 4QXTA 2L04A 1A6ZA 1UOVA 2WJ7A 3FU5A 3HUJB 1U92A 4XXCC 3MOBH 4XMKL 5DDHB 4PVMA 5H37A 2WIIB 3ULUF 5F9OL 3SE4A 2VZUA 1WFJA 5JMOC 3MACL 2Y36L 5LAPA 2GFBA 1KG0A 4OD3L 5L4MA 5HGAA 1DBJH 3N44B 2C7UA 3MOAL 2XWEA 4P2RD 1NGYA 1KJVB 3UCQA 3NK4A 3JZ7A 4YPJA 2SEBA 3EYOB 1JV2B 1J1OL 1C8QA 4YSEA 1Z66A 2BMKA 4IKLA 3F7YB 3FQRA 1OGAB 5L2JB 1N5YH 1RZFL 1IM3A 2V9TA 4XC3H 4HPOL 1BEYL 1WA1X 3AY4C 4YH6A 4PJEF 4HZLB 2EIDA 4NJ9H 4U1NA 1AMXA 3RZCB 5EOCJ 4NZ8A 3SKUD 3R0MA 1CJYA 1E2WA 3UAAA 3UIZA 2IC2A 4PJXF 3CSYA 1KIUB 1D5ZB 3IJEA 1WIPA 3VGDA 1ZGLM 3VXTA 1CDGA 4GI6A 2H1LM 5ETUA 3D0LB 4JL1A 4X9YA 4NXSA 1J8HA 4Y8DC 3FO2B 4W4OC 1XGTA 2AITA 3P3UA 5F9JA 4HLJA 4DFIA 3ARFC 3VXMA 5E5MB 3T77B 1ACCA 4PAZA 1Q0YH 4JK0D 1G0DA 2YEQA 1BBDL 4JG1H 5D1QA 1ACXA 3L2MA 1K72A 3E6HB 3UZQB 3DX0A 4KO6A 4DN3H 1CT8A 4WJG3 4PTUA 4X98B 5CSZB 3O9WB 1WGOA 1H8NA 5KVDE 1JFQL 3SDAA 12E8H 2DQDH 1U21A 1M1SA 1WYJA 2H8PB 4KXDA 4MD0B 3IDGB 2IG2L 3NA4A 4LHUD 5DVPA 3MRKB 3PWVB 1BBJA 2ENJA 5CN1A 2WMPB 5KYXA 2OXHA 2GJ6D 2X44D 5GGSY 4K5PA 5EBGA 1CFVL 3O2WL 4FTVB 1TVBA 2DM7A 1BMGA 2K8MA 4TV3A 3QXWA 1EJOL 1IC1A 4ZW3A 5DRWB 1MQ8A 2VO5A 3AREA 3WLBB 3KR3H 5GS0D 2AJZA 3V7MA 4J3BA 2KL6A 4L48A 3HZKB 4S1DD 4Y1TA 2QL1A 1FNEA 4MVBC 4YIQA 4H0LC 4R4BB 3RNQA 4NKMB 1WIUA 3RNKA 4L1DA 5GRXG 5F9WB 1BFSA 3D4CA 1CK0H 3NDZE 5FCSH 1Z2KA 1A6PA 3QJFA 2PCYA 1XGQA 3QK0A 32C2B 4I0PA 1MCKA 4KTDH 4O02H 5D72H 2J2ZA 2K3TA 4PY8J 2VTFA 4AT6A 3AM8A 4MAYD 2BWDA 3QWOB 1BREA 3E8UH 5GRYA 4DW2H 3QEQD 4HC1A 2DTMH 3EJJX 3NIDB 4AKPA 1FJ1B 1J9QA 5I2IB 3D3VD 3B9EA 2BP3A 4R96B 1OB0A 1MRDH 2YSSA 3CZNA 3ETBJ 2LHAA 3DSFL 3S3PA 1QI3A 2Q7NA 4JFYA 4XMTA 2X42A 5I30L 4QHNB 4LPXA 2R0ZH 2X4OA 2XI9A 1RZ8B 1S7SA 2AQTA 4NQSB 4P2QA 2VXVL 3LKQA 1JWMB 3V2AR 1RCYA 5AVSB 5CCGE 2D3LA 2NW3A 2IGLA 4YHLL 3TNMB 3Q6FB 4X7SL 4LLQB 3MJ9L 4C58B 4JO5A 4QTFA 4TTDC 5ISZD 2WSDA 2A6DA 3WO4B 3BPLC 3HA0A 1MDAA 3WJJC 4UAHA 4RAVA 3MUHL 3DBSA 5DC4B 4PVLA 3LCYA 4WU7B 4XPGH 2XNAB 5EIQA 1Y6KR 4UT6L 3TJHC 1LK3H 3MV7A 4LHUB 1T0OA 4Y4KC 5EU7E 3ZK0A 3N1PC 5FECA 5EULV 2GAZA 3RWFA 5A6IA 4ZTEA 2GJ6B 4KDVA 5DFVC 1QVOA 1HSBB 1A9BB 2PP9A 3DXAE 2BSED 3O2DH 2DD8L 1F1GA 2W8CA 3DK0A 3FL7A 3Q6GH 4GW4A 3H55A 3IVKB 4WI8A 1HU8A 1KY6A 3PNWB 4UQDA 4W81A 4KTGA 1JYVA 2QHLA 3QDGA 4MJJA 1T5WA 3KYOB 3MBED 4KI5E 1ASPA 2CJUL 1GOFA 1W72A 4KJWC 3FU7A 3MLVH 4ONHA 2XZZA 5D7IE 3TZVD 2WN3A 2YEVB 2JKSA 2OX5B 3BH9B 4UQ2A 1GAFH 4EEEA 4W9HC 3PP4H 5I24A 3SJVA 1AE6H 4BH7B 1TZGL 3BH8B 2GW5A 4XCYA 3TO2B 4P5KB 1B3JA 3JTTB 4GJTB 3HMXA 3QZOA 4HXBH 1LO0L 4ANVA 7FABH 4J3OF 3O3DA 3KYNA 4DK6A 4F7CB 2GITA 4DP4X 1GOHA 3SE8L 4UTAH 4AJVA 1X6NA 4I5BA 1G7PB 1MJ7L 3G5ZB 3H9HB 1FYTD 3VQ2C 1TENA 2PP7A 4WIQA 4YSCA 1FNHA 1KB9J 1Q1JL 3LXCA 2Q6WA 4O02A 4DZBA 4Y4HA 3F00A 1JVLA 2O6FA 4LFHD 3N40F 4PRBA 1T4KA 4OI7A 5HYJB 1J0ZA 4PJAF 4ODXB 5D6CB 1XF4A 4YDLC 2A9CA 5GGSB 2YD3A 3LZQA 4U1GB 2P44B 2BW5A 4LEXH 1O9WA 2BIHA 3QIBB 3LRKA 4JHVA 1U58B 1EFXA 2AJUL 4ELMF 4Z7NB 4UU9B 5FKPB 3L5XH 3PGDA 1A9VA 4KUCF 5I1CH 1AFVL 4H26B 1QI5A 1FNFA 3ML8A 2VISA 4GAYB 1KJ2L 4AIOA 4HU8A 1XCQA 1HAWA 1CG9A 4AJ0A 1FN4A 4HH9B 2QKSA 4CADA 2JJTC 1T1ZB 3BCDA 4W9FC 5CHNA 5JHMA 3IXTB 4FLHA 1EMTL 2YRZA 5CF3A 5I1IL 1HN1A 1Z9NA 2NY7H 2OL3L 3MBEB 1IL1B 4QTIL 1BFTA 2FL5A 3GD1C 2XZCL 4LL1A 3MA9L 2P24B 3BD5A 3KGRA 1CE1H 4HGWA 2AZAA 2X4NA 5I0YA 3CMOH 1IEAA 4PJ9D 4J2XA 5I1GH 4IS6A 1M9SA 5EBMA 1E6JL 2AQQA 1AZZC 3H8NA 3O2DA 2YD7A 1L3NA 1ED3B 1ZTMA 5TFSH 5B3JF 2F8OA 4O2EB 4AGLA 2AEQL 1JZ5A 4P2YA 2G9HB 5DGRA 1DSYA 3B8SA 1CVRA 4XB7A 1FH5H 4X7TB 3RL1B 1LWHA 3ZE0B 4B0MM 2VW4A 2X9XA 5DJ6A 5C0EB 3A21A 3HC4L 4XWGH 4AEEA 1HYSC 1A1NB 2E7HA 4X6CE 1A6UL 2HRPH 4JFXB 1A4KB 4JDZB 2KQNA 4B96A 1Z3RA 4PEEA 1KUMA 2N01B 3SKNB 4ALAC 5TK2A 1I1AA 1F58H 5F1IB 5F71A 4BFIB 3Q2CA 1CE6B 4NRXB 1CD1A 1OEZW 5FFLA 1XMWA 1AIZA 1HYRC 1T7XA 3O0LA 4JFOA 5JIPA 3BVNB 1MJ8L 1K5NB 2A9MH 4CGTA 3TIDA 4WNQB 2HJLA 5CP3H 2R29H 3QUXB 2O30A 4G6FD 4H8WH 1EXGA 4KY2A 4X6DF 3I50H 3TCLA 4UWQB 3CPLB 1I7TB 1N9PA 3FMGL 4ZS6C 5AVVB 5FDYA 4DIXA 3QPQC 1UC6A 4OD1L 4QRPA 4A67A 5LGJB 1F18A 2OI9C 2ROYA 2WD0A 5L2KE 5CM1A 4R90H 4HPYL 3ZW3A 5SV3A 2PXYD 2D2CC 1S7RB 3GSNH 2J55A 1N6QH 3MFGB 1EO8L 1ZTXE 3QJVB 3NJFA 4NKDA 1CS6A 1AG6A 3RDTC 2VJXA 4GT7A 3VD7A 2JK5A 4IIQA 4LLUA 4A63A 2XRAH 3DX4A 2QMKA 4P57A 2DL2A 3DXAD 3GSUB 4PJ9B 4ILDA 1D5BA 4RBPK 2E46A 5F9WC 2X1QA 3AT0A 1CXFA 4PTTA 4IU2A 3VXSB 3Q9PA 1MW1A 3P4MB 5GISL 5LGKA 1N70A 2QQNH 4FQLL 4HUVA 3KS0J 1ND0B 3T2NL 2IGFH 4KI5D 3SO3B 3GSWA 4WO4C 2X89D 1L0YA 3ALWA 4IHOA 3BQUB 1X9RA 3QNZA 2JCCF 1U2YA 3UBXB 4P05A 5ALCL 5EUOA 3LKPB 4XOBA 4K7PY 1SDYA 3RAJL 4CW1B 4KKZA 2PPEA 3M07A 2VSKB 3WHE1 5C0CA 1CF8L 3NQKA 1S5IH 4TYUA 1I8KA 3EYQD 3MRBA 3UJJL 4U1JB 3T0VA 4TUOB 4XT1C 3U25A 1YEEH 1TQBC 3NRQA 4P4RA 1Q9OB 1RIVL 4PJDA 2QGDA 1KB5A 5I73C 1JK8A 4OZFG 3ARVA 2Z91B 2XFXB 4YDMA 2P28B 2XVBA 2RALA 4K3DH 3VYNA 4Z8FL 5E9DE 5CJOH 4Q9CA 3RYMA 1S7QB 1PG7L 2IBGA 1NUGA 3RUGA 1JPST 2WOBA 1E5AA 4QHUA 1NCJA 4GAGH 4TL5A 3QUZD 1MIMH 4YSTA 4QI3A 3X2QB 3FUEA 4K3EH 3P69A 4LASH 4M62H 5JA8B 2ADIA 2XYCA 2QJDA 4PCKA 4PWKA 1W0WB 3DJZA 1DLHA 3IFLH 1O7DC 3AU1A 3B7UX 1ZSHA 1BX2A 2FAUA 3PXHA 4OLUH 4QTHA 1ECYA 4Y7OC 5LGHH 1FRGH 3GB7B 4MB4A 4ZT1A 1ACYH 3LIUA 2X0WA 4LSUH 5I6OA 1YQVL 4QGTA 1TJGL 1JE6A 1NKOA 3MX0B 3UO1L 3BEWB 3AGVA 4JO3L 3FTGB 2QQKH 4P3DB 5DJ0A 5ITFA 2QLYA 4M61A 3DXAB 4UINL 5TGBA 1T6VN 2V37A 3FQYA 3ZIMA 2FJSA 4WFHE 2Y3NA 2L8AA 4WY7H 4PJIF 3FB6A 3ZMNA 2PCPB 2NX5A 5HHVL 3VDBA 3KPSB 4M1CC 2BZDA 2ZAIA 3QCUH 2A9DA 1EHKB 3IMWA 4PCYA 4EZKA 1QRKA 5E2TL 1WZ1L 3GSNA 4OF5A 2H6UA 4UT9L 4XCEB 5HHXH 5T1MB 3SQRA 1A6TB 3P3YA 5D7IB 1BVNP 3WN6A 4KBPA 1IAIH 2A74C 5I26A 4FN0A 3RWHA 1AACA 3NP3A 2BNRE 3ZXAC 3EOTL 4KKCC 5H4YA 1JNNL 4JR9L 4OZFH 4DT2A 5GZNC 4MDJA 4AGNA 2Z35B 4POUB 3OPZH 5DK0B 3RDJA 4K9EL 3UJIH 2ATPA 4DKFL 5GS2H 3BUQA 3NCMA 1JP5A 2K4WA 5E70A 5LN8A 5ILTH 4RNRA 3T0AA 5D55A 3UL4A 4KX9A 4R0LA 3PJSA 1PY0A 5J11C 4UAOC 3K46A 4YHPB 2P8MA 1TPXB 3OZLA 5D7SL 3VTMA 1O7VA 1CFNB 2VW7A 4U1GC 4WW1A 4RFEB 1LQSR 3BWZA 3H9SA 3OPUA 3QC6X 3RA7L 4KWUA 1E9OA 5F6IC 1RZJL 4A55A 1GSKA 4DPBX 4N2NA 1FZJA 4LHJB 3ARDB 1KWKA 1CI3M 4FQ1H 1ZS2A 2MCPH 2EDXA 2PW2A 1KCUH 3EDEA 4RLDA 1FNLA 3CFUA 3HW7A 4MZIA 4N1EA 3TBCA 1ONQB 3TF7C 3ZTNH 3M8OH 1FNGB 2IPKA 3MNMA 4RFOH 2VXQL 5EHFA 1XGZA 3IFOA 4P5TD 4WKZB 3WTTA 3MNVA 3Q8BA 4B9KC 2OQJA 4PJBE 2JIXB 5LNEA 4L3EB 2EYRA 1NANI 3MLXL 1LTXA 2WVUA 4Q6KA 3LH2H 5LN4A 3RFRA 4DTGH 1QQDA 2PPDA 3S88L 3K2UH 4EVNA 5L2KD 4DKTA 1VZHA 3QUMA 1FP5A 5DSCA 5BO1L 2W91A 5DS8A 3ES6A 4KTEL 4WWKD 2F8VA 3T65A 1DSFL 2YD9A 3LB6D 3LKOB 1SPDA 4CC1A 1EGJA 4AZ8B 2ZKHH 1HEZA 3B7RL 4WGWB 3HHRB 1H3GA 4HVBA 5C2BH 3BZ4B 3D4GA 4F9PC 1HKLH 1FGVL 3F58H 4OIIH 3QARA 3ATFA 3CC1A 4KRPC 1KN4L 3V9CA 2DH2A 1RK1A 2YS4A 4I1NB 4Y7MA 4Q58C 1VGKB 1YJDL 2K78A 4W1TA 3BAKA 3DPDA 3QS2A 4ZNEA 3FN0L 4TULH 4DEUA 5TD4A 4AENA 3QG7H 3VACA 5AG8A 2AXGA 4KNTA 2UXTA 1KXTB 2DQCL 4X8JB 4HWBH 5GJTH 2NY5H 5EFIB 4DGVL 2YPKA 1Z5YD 2AQ3A 3VNZA 1F56A 4KKAC 4Z5RA 5ACZA 4JM2D 1MFCL 1SLXA 2GJZB 4X6CB 1K4CA 2VERN 2IF7A 5DFTA 5DUML 2PKDA 3L8QA 1LDPH 2C9UA 4L37B 2IQ9L 5GS1B 2KLSA 2IMNA 4OZFA 1T5XA 2FX8L 2ZOLA 3FQWB 1ADWA 5K9OA 3OAYH 3NOIA 3R7RA 2FZ3A 4K2UL 2H47C 3VMPA 4ODWA 4LL9A 1JIBA 4FEMA 4MGXA 2JE8A 3VXQA 2BSDA 3QRBA 4KQ4L 5E9DD 2GKIA 4JKNA 4ZQKB 3NTCL 4JBSA 1CXKA 1S3KH 2JQZA 5HJ3B 1NMBL 1ICTA 4XN8A 5IW1A 1H8SA 3PDOA 3ZE1E 4A38A 5DQ9B 3HS0C 2RCSL 1VZIA 4ABWA 4LVHB 1TVHB 1U8NB 2VO8A 4XRCA 1KGUA 4AC4A 2F5BH 4FQXD 1WAAF 3EYSL 3MV9E 5LBSH 5MI0B 4KDTA 2BIOA 5I8EB 4ZI8A 4EI5D 5L2KB 1BVZA 2HH0L 1HOCA 3HE6C 5D7LE 2GBAA 4WWKB 4M7ZB 3VFTB 4YUEL 1NFAA 3FC8A 2HG5B 3CHOA 4S1SL 4LCWA 1MN4A 1T6BX 5BOPA 2X6UA 2HFFA 2MCAA 2ZP0T 3JYBA 4NS0A 4AXWB 1BIHA 4QXVA 4ZAKB 3ABKB 1BPVA 3QJOA 4YFEA 5IFHL 4WFHD 4NO3B 2DQFA 4OF8A 4Z7WE 1K9TA 5B21A 2JV6A 3FT0A 2V8MA 4V33A 1ZLWH 2UY7A 1KGWA 4HG4J 4AX3A 5CLZA 1UGKA 1HINH 4LLMB 2IXQB 1E65A 1JWSB 4NQTA 2R69H 4JM2B 4U7MA 2EKSB 3GO1H 4LARL 1PEZA 4PJFB 1HHIB 3L1GA 6FABH 2BNRD 4WI3A 5F3BB 5EOQH 4UMGA 3MGOB 3PS6A 5FO9B 4N2CA 5GGQL 1TEYA 2CBMA 2P8PB 4N68A 2ZAGA 1MJUH 1E8ZA 5T33H 4L8CB 2YQBA 3CFQA 5ICYB 3BC9A 4B7LA 3BXNA 3MA7A 1QBLL 4XI5C 1OO2A 2WINA 3FT4B 1FVDB 2FE0A 5E9DB 4YS4A 4WI7A 5HYIA 5EO9A 2H1PL 1DZBA 4ODHL 2WLZA 2IWEA 1G1YA 4B50A 1NC4A 4B3VA 4FQXB 1MFAH 2DMGA 3NEEA 3ARQA 5I16A 3BFOA 1IBDA 2CDFB 3RWGA 3C6EA 3SD2A 1MHHA 4JKMA 3DVNB 4LIQH 1HC1A 3GJFB 5FYKH 5AALA 1I1RA 3UYPA 2RACA 3Q3GA 3PF2A 3QXDB 4N0YL 2R23B 4PV9B 1V7NL 3A4EA 4ZMNA 5JMRA 5DUBA 4FLOA 1G7QA 3BOVA 4MSWB 4B3EA 1JZHA 3VWJB 1XGYH 1AGFB 4QJ5B 1RP9A 5BOJA 4OGXL 1NCWL 1OQXA 2ADGA 4HEPA 5F8RC 3VFWB 1N64L 3L9EA 2XG4A 4O2FA 1R5WA 4A37A 2VMEA 3GMNB 3MRQA 2ATKB 1RMFL 4MBOA 2DTSA 4APQA 5EUKA 4QCIB 4BWUA 4C4UA 4AUUA 5E1AB 1NFDA 1A7BA 5HDLA 5I71B 5J3HC 1P7KB 43CAA 4AGMA 2Y22A 3AWEA 3PP3K 4IDJL 1HHHB 2YXFA 2Q7YA 1UJ3B 2V3EA 4MAUH 3TZVC 1WIOA 1OLZA 5ENWA 1IU1A 2O5ZL 2DMBA 1YMMA 3DPBB 4HIJA 4TNFA 1BZQK 3ARDC 3L3DB 5BPPA 4F5CE 1NCDL 4FZEH 4S2SA 2OYKA 2JLPA 1BHGA 5FUZL 5MEPA 3QYMA 4Z78A 3VFMA 3OAYK 4AJYV 3L5WA 3MLYH 5C86A 3GTTA 4PJ7E 4JG0L 3ML9A 4BZ1A 4XX1E 4E42B 1F6AB 3IDYC 1MF2H 2GABA 1KYAA 2H32H 2CA3A 1E2ZA 1FNSH 4P5MA 1UA3A 3HZMA 3BAWA 3TCXA 3VX0A 1QPXA 2H26B 2Y5TA 3ZSTA 5E95B 1GS6X 4HWNA 4S1RH 2B77A 3VD0A 3QQ3B 3CDCA 2O26U 5I0WA 3B2XA 1QMUA 4J23A 3PWPA 4N0UE 4HWZB 4YHIB 3IDIB 4CKVX 2ARJA 1KXQE 2CO6A 2HZHA 5DJ8A 2B1AH 4ABQA 4I7ZC 2DWYA 3K72B 2VLJA 5LCVH 3MV9D 3B9VA 2H3NA 5L0QB 1DBAL 3ULUC 1GGYA 2HJKB 5D7LD 1JVOA 3P4NB 1IQWH 3PAZA 1BF5A 1E5CA 4HIXL 5T5NF 4ETQB 1PIGA 1VACA 4BE5A 3EBGA 4QXGH 1IGFH 5KJ7E 4QUOA 4ZFQA 3WU1A 1ZK9A 4CAGA 1RUPL 4PD4J 3BRFA 2XWXA 4OI8A 4UIMA 1NOAA 5I1LA 1MEXL 2WB7A 3BZFB 5CN2A 3SPGA 4QO1A 2Y2WA 4KKLD 1YEDA 1B6DA 5DMIH 2OMYB 4GBXB 2KZWA 3SDYH 4UTBA 1NIFA 1UT9A 4J39A 4Z76B 5C3IA 4IRZA 4L4TE 1REIA 4XE0A 2ADYA 3RGVA 4HUWA 2CA4A 3HPJB 4F9LC 1B0RA 4GRLD 4AW4A 3T1FA 4AUYA 5DYOB 5ICXB 3CN0A 5GPRA 4FFZH 2YBRB 5EC2A 5EOCH 5KYYB 3P30L 5L9DH 1NAKL 4JHZA 1X4ZA 1FO0B 2VYRE 4UB0H 4LCYA 3ILQD 3II3A 3UMNA 3VGBA 3PYCA 2YIHA 3WIHA 2VXUL 4TLSA 2FX7L 4MWFB 4LP5A 4FQIH 3C09C 5AWNL 3ROLB 3WFZA 4NQQA 3KBFA 4MMZB 2Y7SA 3O3EA 3V55A 2A4EA 2OMZA 4Z95H 4ODSH 2LR4A 5JZ7D 2IOMA 4H25B 5EBLB 4YX2L 3ZE1B 1YAZA 4NQCB 5GXBB 3NSDA 3AQYA 3N04A 3CGTA 1E40A 4N8UA 3WG7B 3FTWA 3QB7C 4HWEL 5DR5L 5C0NC 4GG6A 1WBXB 5CCHE 2XQBL 3UYRH 2Y07H 5JOFB 4HEMA 1BJ8A 1IAIM 1HE7A 2ILLA 4HFUL 4OB5L 4G7VL 4RDQG 4GUOA 1SY6H 3HCVA 3AUWB 5FLVA 4FCAA 1C16B 4Z3JA 1UKTA 2J8UE 1AAJA 3TIEA 1P69B 4BFOA 3CLEH 2VDQB 2C3HA 3CVHB 3HZYA 1QNZL 2JMRA 2QTEA 1IGIH 1WWAX 2W9DH 3UTSE 2VZTA 3MRDB 4QWWD 3O0RL 5D70L 2ZQKA 3CFEA 3H53A 5LCVA 4FNUA 4MCYA 3U46B 4Z7WB 4XMZA 1N7ML 4K07A 1XHHA 1VFBB 3AXLB 3PL6D 4KAQL 2C1PB 4PB9H 1A64A 3I74A 5H94A 4ZPVB 1MCDA 1VFAA 2J73A 4FG4A 5IM7B 5K9JL 3GI8L 3SGJC 5BMFH 3CH1B 3TN0B 5DD0L 3GSQB 2ORBH 3DX8A 3PQYD 3DMMA 1G0YR 1SXNA 3MRJA 4K94C 3FRUA 4JN1H 5K9QG 4LRIC 2HCZX 5ESAB 1CDCA 4GUPB 4J4PA 1FFNA 2FECI 3DETC 4NN5B 2K6YA 3MLSH 1BOYA 4LSQL 3MUY1 4OF6A 3RIFK 1JPFB 1YO4A 2XIIA 2F1BA 3GBNH 1MWAA 4E9RA 4M1DL 5SX4I 1FFRA 3S5LG 5H4ZA 4NUGL 3BRGC 4HK0A 1XGPB 3KDMB 5B8CA 2DZEA 2NDGA 2I9TA 1XDQA 4F33B 1PZDA 4Y19D 2IFFH 4MDIB 1DO5A 3EZ8A 5IMKA 3JXAA 5JHLA 5I8OH 1P4LB 2B8OT 1K4DA 3WKML 3QI9A 4I77H 1NMCB 2OW6A 1BJ1H 1J86A 3EO1B 4JB9L 3QEHB 2NR6C 1MI5A 4YAQB 2Q8AH 3VWJC 3M86A 3OXSA 1GPOH 2DDQL 4JFEA 4YDVB 3WE6B 3W9DB 1T1XB 3QIWD 1C5BL 2WQWA 1Q90A 3T0XA 4YE4H 5HDQL 1B88A 2AXFB 3NCYS 1C5CH 2D31A 1OXYA 3ECBA 1U4EA 4FXGC 5A2LH 1HNGA 4WW2F 1L9TA 4XVUD 1J8KA 3D7PA 3EBAA 3QXVA 3VGHA 1QBAA 2Z4QB 4QRQA 3T0WA 2R7EB 1FFTB 5KS9E 2HKHL 1AXSB 5EF0A 2O5NA 3B9KD 3PL6B 4EOWH 3WJLC 5B3NA 4M48L 1YZZA 2BZ7A 1ZE3C 1P2CA 1E9PA 2PCFB 4Q4EA 1ITBB 1SY6A 4DP9X 3TH4T 3QJSB 1G5AA 1GGIH 1TF4A 3GIZH 5HYEA 3QWRD 3CFBB 2WZ6A 1CPUA 2VSDA 1BAFH 2Z92B 2AQSA 4J3OC 3K4AA 2P5WB 4YXLH 1N12A 4HK3J 3BUTA 2XXGA 2VM3A 4MQXC 3LKSB 1MCWM 3PWJA 4L4TD 1S8DB 2VLRE 4GQQA 1HHJB 1LO5A 2PWDA 3QORA 2GHZA 2IEPA 1DL7L 4FA8A 3DOHA 1KB3A 4FFWC 2DBJA 5EU6B 4K23H 4PJ7B 4X5WA 2YJLA 2FIRT 1Y6NR 2FB4L 5J9PB 2JXMA 2QDWA 1OW0C 3D48R 2BVOA 5EOTB 4AL8C 4C55A 3FO0L 2PN5A 1TG8A 3UZEC 4F27A 2BHZA 4TUJB 3OJDA 1DQDH 2GEEA 4I3RL 3DOSA 4M7JL 4ZMQA 1PL3A 2FLMA 2WLLA 4X5PA 1OAXH 1USQA 1I7UA 2WTRB 3CXDL 3VRJA 4N0UB 4XBGB 1R3KB 3U36B 1MLBA 4UIKH 1FZMA 4MHHG 3UC0H 1F45A 2OSYA 5MERA 4MYPA 4WSKA 3RL2B 1EAJA 1Q72H 2XXFA 3UAJC 2FSEA 3CVIH 2N7BA 2ZCHL 1CFBA 2Y9RT 3CVCA 3AADB 3GBEA 2BP8A 2R0KH 1B6UA 3RRQA 2IH8A 3T0BA 1GZQA 1R3IH 3Q1SL 3RB5A 1BQ5A 3WNJA 4JO4H 1X7QA 3ZDZE 1NEZB 4CKQA 4DAGL 3ZDXE 1Z5LA 5HHQB 4GO8A 4QRUB 1UM4H 2L4OA 1QASA 5JXED 1NSNH 1XCTA 1M71B 2VDLB 4KX7A 5IQNA 4BK4A 2JSFA 1EWHA 1AZVA 4GW1A 1EHNA 1CLYL 5CD5C 3JV5A 4MD4A 3SPJA 4PMFA 4E9VA 4H0HB 1BM7A 2ICCA 3FTZA 4BSWB 1TZIA 3AZUA 3CZLA 3DGGA 1C5DB 5JPMA 1QLFA 4RMVA 4XO5A 4ZTPH 1OM9A 2VRKA 4YBQC 1MW2A 2FO8A 3NN8A 1MLCB 5TE6H 3SGEI 4UYQA 1Q9WA 4XXCA 4XP6H 1SJHB 4U3SA 1TYEB 3BIBX 4X5QA 2M1KA 3L3HA 3S0PA 2J4WH 3N85H 1SLVA 5FO8B 3SDDC 3ZBMA 2BK8A 1M3JA 2WANA 1SXZA 2N7AA 4MXWL 3S5LA 3L7FA 1WC7A 2NY1B 4W68A 4Z7QE 4LPVA 4XMLL 5TQ2L 3R18A 4MXVF 3IJ8A 4JFVA 4PG2C 1KBGH 5LKNA 1XZ0A 1DVFD 3BESR 6PCYA 2FUTA 4NKOB 1RU9L 5ALBH 4M29A 2AAVA 1BZDA 1OGTB 2A77H 1BIIB 5GS2D 3FB7A 3MO1A 2IADA 4L9LA 2HUEA 3CAFA 2OP4L 1OM3L 5I1AA 3Q5YA 2EE2A 1J8SA 3AY4A 4LPYA 1IC7L 3OKLA 4F2MA 1U8MB 1CFTA 3O6LH 4J1UA 3MCLL 1DYZA 3QW9A 4Q6IB 4ELDA 4YHOH 1V10A 1WTGT 1UACL 2F68X 1IE5A 4PBDA 4G7QB 2X87A 4M7KH 1P1ZB 2DJSA 1MZZA 2ZUWA 4I87A 1VIWA 5I8CB 2HTLD 5AW6B 4W4OA 4UZUA 3UTSB 4KX8A 4F57H 1S3RA 4JLRB 3GC3A 4GQ9H 1EHXA 2KLTA 2GIYA 3FQNA 5TQ0L 4ZBJA 3ZQ9A 5EB9A 5EEYA 3BLPX 1PZSA 2EDFA 5FYKE 5D1XB 2MQGA 3QH3A 4CRPA 3IDJB 1I1FA 25C8L 2IV9A 2DS4A 4NC1E 4NOBA 2FNBA 4X4MA 5ABZA 2AJSL 1NL0H 4GT0A 5E08L 2CNZA 5DEGB 5D2LA 4NB7A 4QIRA 5TE4H 4JQVA 4EUPG 2P5EA 3G6JA 4R7NB 2Y7QB 1G9MH 3NPSC 4G6KL 1E4WH 4M43H 3BRDA 4G82A 1H3UA 4OZGE 1AJ7L 1U8IB 1QO3A 2CNYA 2XY1A 3MXWL 2P47B 5DK2B 4EZMA 2ZICA 4XPFL 4HW6A 1YY8B 1ADQL 4FFYL 4HHGA 1G9EA 5KVDL 4UDUB 2VLRD 1RHHB 1NM9A 4P4KB 2YD4A 1T0MB 1KB9K 2ZWSA 1A7QL 1SXAA 3R0NA 5IKCA 3E80A 1QEXA 3GM8A 1RUMH 3KM2A 5KSBA 1DVFB 4EI6B 4JY4A 4ZMLA 4ECNA 1Y1DA 2PO6D 1DCEA 2IAMA 2ENSA 2AEIT 3K4DA 4OQTH 3QUKB 3EGDB 3N0PB 2FSDA 4PV1C 3HKZA 3DX6A 4GW5B 1SUJA 1J11A 1JF1A 4JS7A 1XGUB 1ETZA 3U1SH 3S2CA 4F1SA 1RLBA 5ESVA 1VEPA 1J48A 3WFBH 4HIIA 2YEZB 4NZUL 3ULVH 4PJHA 3UZVB 3LIZL 4AQ8A 2VLLB 1JCKA 2FQFA 4G80A 4LGPB 3FF7A 4WFED 3CFMA 3TL5A 4ZXBD 4ZUVA 3H2QA 2BO0A 2X2YA 1KIPA 1HWWA 2R0LL 1IGML 4X99A 3EZJB 2F5AH 1X5KA 5GRVK 1S7WA 4ES9A 1IBGL 5AYUL 4I18B 2UY6B 4Y8AA 4TRPL 5EZIL 1CICC 1SEBA 2Q2LA 5C0GB 5I75B 4EUPH 2C8NA 4GMTL 4DKDC 1E4HA 4LOFA 1UM5L 3FYEB 4IRSB 4HT1H 3U0WH 1IM9D 1DBBH 4WKXA 3CTTA 4ONFH 5KN5A 2DIAA 3AXHA 4G11A 2Y69B 2G75A 3ZTJG 1BA9A 5JIIA 4Y4KA 2V33A 3GRWL 3TC9A 3D06A 4C4KT 2WVVB 5JUEL 1IKFL 1BZ7B 3OZ9H 4HD5A 5K1NA 3LPGA 1CUOA 4HS8H 5TDPA 3VGFA 1EO5A 5LGYA 3ZMEA 3ZZ1A 3EJYC 3BGFC 3VXPB 2F18A 3LNFA 4WI5A 5KG9A 1CGTA 1ECZA 3QFJA 4OLXL 5IF0B 4AKQA 1AD0A 4IKNA 4MNQE 2HWZL 3D25A 4JFUA 5DYFA 5MENA 2BRRH 2WBJA 5BJTA 2A38A 2YD0A 1R0AL 3FO9A 4GFXA 1SJMA 3FRPB 3GNMH 3NFSH 3Q48A 5FA4B 2OTWA 5HYFA 1OAQH 1KSRA 4HUXB 4PCSA 1MCHA 3P3SA 4NQEE 4YDKH 3KLSA 2B5IB 4X7FC 5C0IA 1I9IL 3D85D 3KGTA 3O4LA 5GHWL 3VXNB 4FC3E 3UTZB 1QR1A 3FHEA 1INQA 1KXHA 4Y9CA 2OULB 1OSZA 3BKYL 1JTTA 4TLTA 3K4ZA 1T7YA 4XVSL 3CHQA 4CVZA 4BXSV 4ZXBB 1E4XL 1F11B 3N1GC 2X4PA 1UGNA 2XVLA 2GY7B 5BQ7A 4W9KC 5JO5A 1IGJA 2NY4B 3EGSA 1WZLA 4PREA 3BO8B 4DFHA 1F1DA 3VD5A 3MBWA 5IMLA 2NZ9D 2Y23A 3C5SA 2ZG2A 2BIIA 1G7LB 4TS6A 2UWEB 2WXIA 4ZK8A 3KBHE 5FUOH 3F3HA 1JHLH 3V0JA 3V5DA 2CGRH 3ZDZB 3NRFA 4NQXA 5DS1A 3ZDXB 1PKQB 1OKEA 3ZTJH 4YC2B 1RZKC 2NCMA 2IDUA 2XC8A 2R2EB 4AIZB 3NT0A 3VXUA 1TJXA 3NIFE 4P5RA 5EA0H 4W9CC 4HX1B 2QZ5A 1NBCA 2DKUA 1S9YB 2KLRA 5FYKD 1ZLSH 2ZNXA 3BAEL 2RHEA 4ICWA 1UZGA 3ATEA 1GC1L 3MKKA 4ANKA 4AQZA 1CIDA 2MQCA 1A3ZA 1VEMA 2JCWA 3GEWB 1HXYA 3LZOA 3QG6A 4FMVA 2VR8A 1MZYA 4PP2B 4YSPA 2L7QA 3LY6A 1U3JA 2YBGA 5E99L 3QVAA 4E0RA 2XTJB 5AVYB 3KPOA 4NO0B 2XBDA 4BFNA 2CBTA 1EERB 1JPGA 1WSST 4Z7QB 3MRPA 2XT1B 5K5YA 4HJGA 4X6BB 1OVZA 1QSFB 2ZYHA 3CCHB 4BFGA 2PW1B 3G5YB 5JLZB 1I85A 4LLDB 3KAAA 1U3HC 3TYFA 4N2HA 2QLVB 4JZOA 4Q6IC 5IB1A 5LLIC 3MUJA 2VQ1B 3OAUL 4N28A 2YO3A 3SKOA 5B1AB 3GSRA 1AYOA 2Y1VA 2F54B 1JPSL 3KWWB 2FT8A 4PUBH 2EYSB 2H9GA 4PM1A 3ARXA 1INEH 1IARB 1ES0B 3NCCB 3CLFH 3JWOC 1JK9A 1X5JA 4FQHB 4JY6B 1TZOA 5INDB 1HNFA 2XYBA 1FG2B 3QUYA 3AS1A 5D1XC 5AVQB 5EN2B 5CR8A 3MROA 5DRNA 1JXJA 1OP5K 2VDMB 4Z3HA 2MPAH 3R8QA 3ZU8A 3LKNB 4HGMA 4C56A 1G94A 2A6JB 4LBEA 2ENPA 3Q2LA 4PV8A 4WSJA 3TEXA 4F24A 3WE1A 1DANU 5T1KB 2Y5EA 4H13C 1FPTH 4G7YH 4N5UA 1WFOA 4B95C 1IQDA 4NP4H 3VGGA 2A0LC 4UANA 3SKJL 3VWKD 3MZGB 1FLRL 5ECGA 3PWUA 4DEWA 4ZMZA 3ALPA 2GG1A 3B9DA 1AKJA 4I48A 4P4KC 3W2DH 3U9PH 4DPAX 5JPNB 2FDBP 2A3TA 2L7JA 4OFIA 3ARUA 3LNIA 1L7IL 3L4CA 1I3GL 2X3AA 4BUGA 1AQDA 4UI2A 3RDTA 1JUFA 1RIHL 3US0A 3BZDA 2N4IA 2E27H 1ZANH 4EF3A 1XWVA 4PJCE 2CK0L 4NT6A 3CFDB 1D6EA 3EH2A 3T6XA 5EZJA 1JWUA 1ZTXL 3HI5H 4Z7VB 4YVNA 4I85A 1WZAA 4LVOC 4MNQD 4R9HA 3KLKA 2F19L 4AYID 1UADC 4V1DB 1XBDA 2WWMC 4N8CL 2Y24A 2WZ5A 4QOKA 1R5VA 4HDIA 4WO4A 4IK7A 2W07B 4NFDA 1WCBA 4X4XB 1KV3A 1P7HL 4F37F 4UOZA 5AKVA 5DD6B 4NQED 3V8OA 5FO7A 4AK2A 4LSVL 2HT4D 1GY2A 3ZGIA 4AYFA 4FXKA 5HSFA 5CEZH 4IRJD 4OUUA 5DQJB 1A1MB 3P0YL 2O4EA 2BSSB 4O58H 2GVYA 2VITA 1NCUA 3LEXB 2GTQA 2V17L 3O11A 4HSQA 2C7FA 4G9FE 3K6OA 4R4FH 4MMYB 1JRHH 4DCQB 5IHUL 3I9GH 1ET7A 1HQ4A 3FOMB 3EJTA 3FT3B 3HG3A 3IPFA 2PTVA 3VWKB 4DK5A 2FTAA 2CR6A 3F85A 1I8MA 3RZWA 1B9KA 3R19A 4L1HA 4PJBF 4PJ6A 1QSEA 1JN6B 2ZKXA 4JAMA 4LK4A 4A7QA 1XF5B 3GK8L 2CDEB 4LSRL 3S35H 5JQHC 1SEQL 5IVZA 1P6WA 4Z7UB 3T8XB 1LNUA 4IEFB 1T1YA 2OS7A 3QZWB 4NZFA 3B7TA 2OJZL 1A5FL 1NIDA 2C9RA 3X13A 3PGCB 2B5IC 1K8DB 3FULA 2JB6A 3OR7A 4H20H 4MFHA 4U1MB 2Z93B 4WI6A 2GJPA 2E47A 3VXRE 1ZWIB 3ZRSA 4EO5A 5C09E 5DVMA 1NGQH 2JKLA 3CZKA 4CSTA 1HFUA 3PREA 5KVEE 1MCSA 1ZIAA 1UB6A 1OT4A 2AK4E 1B4JH 4G42A 3K71A 1C12B 2RFXA 2OSLA 4GS7B 3BVVA 1EEZB 1R3LB 3QO1B 4UQEA 3VX1A 1ZT4B 2XVKA 5K39B 3HG1A 4NQEB 5C08A 2AP2A 5IMMA 2LU5A 5JDSB 4OIBA 1DQMH 4H5SB 2A6KA 2A74A 1VPOL 4GOSA 3N0AA 2YA1A 4FNQA 1W6WA 3LNEA 2R2HA 1QYGH 3G5VB 5JHDE 4IRJB 5GZNA 4M9OA 3MCYA 3MLUH 4S0HA 3QR2A 3NCWA 4I3SH 2Z7UA 2E75C 2IALA 2EUWA 5HYQA 2EDDA 4AUJA 1NC2A 4BXVA 2DLFL 2V8LA 2BJML 3FCUB 2RJMA 3AG3B 3F2LA 1LEKA 5I8KH 1QFWI 3VSVA 3ARGD 4LNRB 4ENEC 3KXFE 1S7XB 4ZUTA 3CDYA 5IBLC 1J5HA 3MVSA 3W38A 2OR8A 3OC5A 3LQAH 3L7EA 2XJKA 3GHPA 3SODB 4C83A 3LKRB 1TCRA 4P2OC 4IBWA 2AGJL 1AP2A 3GLDA 5T3ZE 2FO4B 1A02N 4CU7A 1SOXA 3VI4B 3DWTA 1E4KA 3FUIA 3ZTCC 3A6BL 4HG4K 2ZPKH 3CX5K 3OKKA 4PJGB 5DFWH 4ZX6A 1R4XA 4OJAA 1RZ7L 4NCC1 3IDNA 3SQOH 8FABA 2Q8BL 4LKXA 2MEJB 2AJYH 3ZVVA 4LPUA 3L3GA 4NWTL 3BP4A 3ZMRA 4RWYH 2WPGA 4WV1B 2Q7AA 3KPPA 4CN4A 2OV0A 1P5UB 2GK0A 1QBMH 2CKBB 5E4AA 1IZKA 1KIRB 4JZJA 2OJEB 3TU6A 3K91A 1X6LA 4GSDH 3MV8A 3GT6A 1KOAA 3Q0HA 1EJ6A 1FVEB 3RY6C 4F9PA 2ZP9A 5CCKH 4ZMYA 2PWGA 1PEWA 1D5IH 1PZ3A 5JOEA 3NH7H 5FOBA 3WIFA 1GKOA 1KPRA 3JZYA 1DQKA 4NI3A 3JV6B 4XBPB 4ZTOL 1I3RB 3OKEA 2R0WL 1H5BC 4WDIA 1QABA 2FYVA 3PGFH 1N0XH 2W9EH 1S9XA 2EXYC 2X4QB 2LGNA 2APVA 3VFOA 1QX1A 3AROA 5DF0A 3P77B 4JGUA 5LDSA 3AW5A 5ERWA 4GRMA 2NY6B 1OZTG 3TGXA 4XMKH 3FQTB 5I1EL 1AHWC 2MSPA 2Y6SD 2NY3D 5F9OH 4WTXA 4L05A 3MACH 2Y36H 5E6IC 2V2XB 1G7JA 4OD3H 2YK1L 5FDWA 2AV1B 1IAOA 4GB9A 3MOAH 3PU7A 3UGXA 1WQVT 2EIBA 3L9YA 5AOKA 4G9FD 3REWB 2WW8A 3GINA 1J1OH 3ZKXC 4ENZA 2H2PD 4D3CL 2V9RA 4OV5A 2I24N 1J8HE 2BHFA 3ARZA 1AS6A 3OMZA 1RZFH 4N90E 1PDKB 5GIRA 3HS0A 4HPOH 1BEYH 3KH4A 3SBRA 3ZL2A 4FLSA 1QSZA 3VXME 3FSZA 3LV3B 3MDJA 1W16A 2CR0A 15C8L 1EZUA 5D1QE 3V52L 4QY8A 3HBGA 3W1ZA 3D2TA 2WQXA 4QRTA 3OB0K 1OHZA 2XZAL 3TO4B 4B9CA 4S1DC 4GLRH 1JF6A 1IGTB 1LD9B 4HOZA 1E2VA 3WUZA 3DK2A 1AOHA 4OJFL 4JRXA 2NYKA 4PJCB 2A9AA 5A3ID 3VXRD 2VMDA 1XR8B 3CN2A 4M5ZL 1BOGA 3QGVA 5C09D 3MCKA 2J6WA 3BUBA 1DFXA 3AG2B 2YAMA 2XBTA 5KTEL 1BBDH 3IGKA 5LBVA 4KKBC 2VDQL 4GKZB 2ICWJ 3CVHL 3S37X 3F12B 4UV7L 2KH2B 2F1EA 3L9RB 5EUOF 1JFQH 4PBXA 3U30B 2ADJA 1CC3A 4OCLC 3M45A 1NUDA 1ZHNB 3SEPA 4FFTA 2HB0A 3GKZA 4IGBB 1BQRA 1PNDA 1JBJA 2IG2H 2CLVB 4OZHB 2DF3A 5B7EA 5JHDD 5IFJB 3STZB 2QPFA 3IRZA 4LLYA 1OTSD 2A7BA 5I1HL 3V7AE 4F7PB 5IROC 4W9GC 4HKBB 2XVGA 4AITA 5HDRA 4GXVL 5TH2B 1CFVH 3O2WH 1INDL 1MAJA 3BIKB 1JPTL 4R6UA 2X4RA 3V6OC 1ZHBA 3I02B 1EJOH 4G9FB 2BIMA 4N2LA 5ECJE 1JAEA 3RUGF 4CMHB 2XPYA 4HOMA 5MEQA 3KXFD 1OGSA 4PD4K 2YRPA 3SSGA 1IEBA 3S6CA 4L4JA 4XP1L 4L8DA 1ZS8A 3IPEA 1RUAL 5KJ4A 1S78D 3GDCA 5HVHB 2EJ1A 3EBIA 3T0DA 3I75B 5LXGL 4M7LT 3O8XB 1BYNA 4J28A 3R4RA 1R3HA 2JLLA 3KCWA 3B1TA 5F2FA 3SY0B 1E43A 4KZEL 3T0EA 3ABLB 3QDMA 1KYUA 2V3FA 4GS7C 4NDMA 1NPJA 3HE7B 4XXWC 4ZFOA 2FUQA 2EC9T 3VU1A 3WY3A 3MV7E 1MPAL 3ZHNA 5I30H 2VCOA 1ZLEA 5CSGA 3I3EA 4KJYB 3M46A 2VXVH 1HCFX 2G5RA 1VLXA 2AK4B 5CXPA 4YHLH 1BD2E 2B9BA 4X7SH 3MJ9H 2LE9A 4JFZL 1LLAA 5A6LA 5AOLA 3UTTE 4CILA 4U6XB 2YXWA 2CIIB 3QQ9D 3P3RA 3QDGE 1PY9A 4F3FA 5IR1B 2NXYD 4UT6H 3K8MA 4PGEA 4JKPL 4RX4D 4HOWA 4TNWF 4UM9D 3SDCD 5K1JA 1ZXQA 3AT8A 1R6VA 1RK0A 5G5DB 4XVTH 2JB5L 3G5WA 4AYSA 1ZRUA 3ILDA 5IESH 5FW7A 3EYVB 1OP3H 1RLWA 3SJVE 5A16B 3QEUA 1PU0A 1FWXA 2Q5BA 2CRMA 2ZCKL 3T4AC 2X7LB 2AKRA 1UFGA 3TASA 1DQLH 5I5RA 1ZLUH 3K0WA 3KWVA 2CJUH 4H40A 4X5XB 2B3RA 3IF1A 3KEHA 1A3LL 2V6HA 4JEGB 4UV4L 3T8VA 1XXFC 4MA3A 4XAWL 2DWEB 3N41F 5IOPB 3OHXB 2ZSWA 4QRBA 2YD1A 3K6DA 4U1SB 1QRND 4ZUWA 2ARWA 5HHPA 1E0OB 3DGDA 1HWHB 1TZGH 3FQ4A 4YXHL 3WL9B 5E0QA 1YC7A 4M93B 3DV4B 3V0EA 1UXSB 2HLFC 1LO0H 1NICA 2QV2A 4G43B 1TTRA 2BM3A 2KYIA 4E5XG 1M1XB 5BZZA 1CLOL 2BS9A 3Q8CA 5F93C 3SE8H 3B2VL 2J8UF 4XCNB 4XNQB 3G3LA 3IGAA 1QWNA 1MJ7H 1U8HB 4M8VA 4TMPA 1J05B 1KGIA 5EU3B 2QPUA 5CD3A 1A7RL 3KGUA 4R2GC 3ESMA 1OE2A 3IKKA 4MD5B 4ATTA 1Q1JH 5DHDA 3WNNA 4R3SB 4PIRF 4LMQI 3U6RB 1JGLL 1ZT7A 1F3JA 1VSCA 2EIJB 5D7JD 5GRUL 5G55A 3APCA 1A6ZB 3TFBA 1U92B 4B9IA 4ABUA 1J5CA 4J8RA 3BUPA 1Z6JT 3QFDA 4D8PB 1P5VA 2EXWD 3WEAA 3GSOA 2NXYB 2VN3A 2NY6C 1CIUA 3MMEB 4UM9B 3B8YA 2AJUH 1NGZA 4KQ0A 1JCVA 1ZLDA 2ZOWA 3OKMA 4TM9A 5HGAB 4CMMA 1AFVH 1PLGL 3QRFM 2C7UB 1D9KD 1KJ2H 2EDTA 1NGYB 4PJEA 2VDLL 1I4FB 4DVRL 3SCMA 1P7BA 4DP8X 2SEBB 3MJ9A 4F9LA 2WVSA 4IJ3B 4MCZA 1TU2A 1WD9A 2BMKB 2Z7ZA 1EMTH 1FH2A 1UFUA 3ARED 4PJXA 5I1IH 3D8MA 3KHQA 2XWBA 4ZODA 2OL3H 4MJIE 4XOCA 4A7UA 5ANHA 1FVCA 4QTIH 3SBQA 3UTPE 6PAZA 2DKMA 2XZCH 1IM3B 4J3SA 4MB1A 2WYTA 3MA9H 3OBAA 4CU6A 3QWNA 3Q13A 3TONA 4FP8L 4XTRD 5E6ZA 3W56A 3WD5L 1F3DH 3EUDA 2FO1A 2Z31D 2MFNA 3CNKA 2N1KA 3BSHA 4U1NB 1BZ9A 4OIAA 3RVUD 3OXRA 5FB8A 5CKGA 2ID5A 3BYYA 4UNTA 5ANME 5IK3A 4F58L 3BP7B 5D4HA 1MNNA 2FRGP 3IJEB 4JCMA 1E6JH 1VCAA 4DP7X 1KDIA 2ZOKA 2XWCA 3BEVA 5ETUB 2EACA 3QQ4A 5CEZE 4L3FA 3TO4C 5B22A 2OMUA 3V5KA 1J8HB 2AEQH 3EYFA 3V0GA 1XGTB 1MQKL 3D0VA 4NZTL 5F9JB 3VXMB 3TWYA 2PR4L 3HC4H 2IFGA 2K1MA 1A6UH 5HGBA 4AQEA 3DX7A 4QR7A 5D1QB 4XZUB 5C07E 5IUSA 4F20A 1OPOA 1XF2B 1V3JA 4J3XA 4K15A 2ZUVA 1CT8B 3EO9L 4Z3EA 1F42A 3NEXA 5KS9F 1IJNA 5D7JB 3OLDA 2AJ3A 5TDOA 4QRRA 1MJ8H 4MYWB 1IC5L 5AOJA 3WFHA 1UH3A 4HMCA 1RL1A 4NKIL 1A47A 1TMCB 2GJJA 2XKNA 1BBJB 3P4LA 3EYQC 4IGBC 5KYXB 1JXGA 2OXHB 5G4MA 2EECA 2HVJA 3RKDD 3IAQA 3FMGH 1NEPA 1XF3A 1BD2D 3GPEA 1F13A 3TLRA 1TJMA 3WV0A 3ZSSA 4BSVB 1IC0A 4OD1H 1KV7A 2DYRB 3JWOL 3QAZC 1MJJA 3SGJA 3UTTD 1WO2A 2KDYA 2KBGA 5CGYD 1ZT1A 1OTTC 4HPYH 1DJXA 3GBDA 3AREB 1YN6A 1YEJL 3FU0A 3JTSA 4NAQA 3VI3E 3QUZC 3RNQB 1FNEB 3BJLA 2CIKB 1EO8H 2P7TB 4LRIA 4L23A 3U0PA 2XWRA 1W8NA 3CJJA 3RNKB 3C5JA 3OKDA 1HIML 3SKMA 4R4NC 3ZQXA 3NGBC 2C4FU 4I0PB 1LE5A 1XGQB 2ZXWB 4IMKA 1MRCL 1UOLA 1ETJA 2J2ZB 5HVHC 5DS2A 2VR9A 3H7LA 3KJ4C 4NIKB 4A2EA 4LRNL 5FFGA 5GISH 4FQLH 1KTDA 4IJTA 4PLKC 3T2NH 3KYMA 2HT3C 5HHNA 2BOBB 2OL3A 5IVXE 4CSSA 4GXUM 3QAQA 3DJ9A 5F0PB 3WUWB 4Y2DD 1BQSA 2X4TA 4GAFB 4NQDA 5BZDA 2OAAA 4HSAC 2X4OB 1DQJA 1N8ZA 3CSTA 4K5NA 5ALCH 1S7SB 1GYCA 1M05A 5DZVA 3LKQB 3RAJH 3QIUD 2C5DC 4OFYA 1E42A 3LRSA 4HIQA 1Q0XL 1CF8H 2NW3B 4MJ5B 3UG5A 1URZA 2B7DT 4JREB 3UJJH 5BNXD 2A6DB 3NACL 2QADD 3FBQA 3IS1X 1JGEA 1WGVA 3T5WA 1RIVH 4KK6D 5LAXB 3C5ZA 4RAVB 2AMUA 1J12A 5DMKA 4DO6A 3L6FB 3JWDC 3VG0H 3CUPB 1AOZA 2FECL 4Z8FH 3MV7B 1JYNA 1PG7H 1NCAL 2GAZB 3RWFB 3CBJB 1QVOB 3U7WL 1IIIA 4NRYB 1BD2B 4RZCA 3WJLA 4GW4B 4X0KB 2MJWA 2BPBA 1EDQA 4J12A 4JZNB 3RWJA 1HQRB 3IMVA 1XIWD 3QDGB 5I6PA 4D7BA 1T5WB 2WCGA 3C2SA 3CZUB 3NJHA 5IIEA 4S0SD 4M4RA 5M94B 1W72B 2NQ3A 3IMUA 1YQVH 3ZHDA 3UBGA 1WVZA 1TJGH 3UO1H 5J7CC 4PW9A 2VWEC 3SD5A 4UQ2B 4JO3H 4N8VB 3CDZA 2PETA 2Y5QA 5LUMA 4L0ZA 1MAML 1XAKA 3SBWC 3SJVB 3BVWA 4G83A 1WLHA 4MMXB 3EUUA 1MCPL 5FM5M 2WLHA 3OAZK 3O3DB 3KYNB 5HHVH 1EXHA 3B3BA 4P5TC 4MJID 3U4EA 2DEYX 3UTPD 3V0IA 4IDLA 5EZOL 1A9EA 1WZ1H 3L3KA 4PJAA 4UT9H 4HJ0D 4X4KA 5E2TH 1AKPA 5HI4D 1MKFA 1OW0A 4Y2DB 3GMRA 1EDYA 5JW3L 2H3KA 1PS3A 3B34A 4ZX4A 4HKZA 1KEGL 3TBTB 3QULA 4DZBB 3EOTH 4Y4HB 4ELMA 1JNNH 2BNQA 4JR9H 1GYUA 3TM6A 2VERA 2XPGA 5CEZD 4K9EH 4DKFH 2HTKD 1QI4A 3RU8L 1K85A 4X9BA 3FUHA 3KL5A 5D7SH 3W3BA 4Y5VC 4GUQA 4XMPH 1EFXB 1B2YA 1T1WB 5A2IH 4OU3A 3MGAA 4RGNE 3SE4C 5C07D 3RA7H 1J18A 1BF8A 2VISB 1AXIB 4NGHL 1XCQB 1CG9B 4MTMA 3WY1A 4GSQA 4CADB 5CHNB 5LG6A 1NGWA 4Y0GA 5FKAA 2CXGA 5AZEL 3TF4A 3F84A 2EE0A 1P9MC 5F0LB 2FL5B 4Q0XL 5FHAL 1IAII 5TJWK 3WS3A 2VXQH 3DVGA 4KK8D 5BS0A 4OZGF 1FE8H 1E3XA 3D39A 4JRWA 1Q94A 1JI2A 4CJ0A 3F6IA 4MJ6A 4FNPA 2FWOA 2X4NB 4N24A 1RFDL 1ZHLA 1NKRA 1TYRA 3UACA 5EF1A 3HAEG 5EBMB 2VIRA 3MUUA 3VUAA 4TQHA 3S88H 5CBAA 3TJPA 5BO1H 4QAWA 1JL8A 1HL4A 1X5MA 3DHUA 5CZRA 4M3JA 1XH0A 3TBSA 4KTEH 1DSFH 3TA3D 1RJLA 1YEHL 4CJ1A 5CIPH 1UZ6F 5DJ6B 5B7MA 2UZXA 1NUFA 4FG2A 2ITEA 5I0VA 4YZFF 1FGVH 4ADGA 1JZ3A 3G6DL 3PAYA 4EI5C 2D3VA 1L9MA 1KN4H 2XG5A 2DI7A 1I1AB 4YHZL 1GL4B 2MOQA 4PG2A 1YJDH 3REVA 1KCLA 3V9FA 2P1YA 1NCOA 2XA8L 3FN0H 4JFOB 5L88L 2EQDA 2DQCH 2Y1ZA 3TIDB 2L3BA 2HJLB 3SDAC 5SX5K 4DGVH 2B1HL 3LEVL 3WELA 2WQVA 1MFCH 3RTQA 2Y06L 1TOXA 4G1EA 3TCLB 5E6UB 5C07B 2VH5H 4AQ1C 2IQ9H 5HJBA 2A99A 2OZNA 4DP0X 5KSUB 3U1QA 2XTLA 3OKOB 2FX8H 5AAWC 2W1NA 4U3HA 3H56A 4K2UH 2DBLL 5J13C 2CO7A 3ILPA 4OLVL 4PMEA 4QJ3B 3TNNA 3FCSA 4NKDB 4KQ4H 4ADJA 1L0PA 3HAEH 3NTCH 4YHML 4IIQB 1NMBH 2WQ8A 3IE9A 2VDML 2R27A 4DESA 2BFGA 1Q9KA 2RCSH 3V95A 2JCCA 1D5BB 1KMGA 2EEXA 1KY7A 5CJ5A 3NJGA 2XY2A 3DDFA 5FGBA 3GUTB 1IKNC 4PTTB 2X6CA 1M7IA 3EYSH 5FV2A 4HUVB 1J5OH 3AM8C 1TT6A 2HH0H 3CZSA 2VRQA 2WLYA 2UVEA 4IHOB 1BLIA 2PMZA 3STLB 3QNZB 5C1MB 4YUEH 1RP8A 5I76A 3VNYA 4S1SH 3WAKA 3BKML 1ZKAA 4TQIA 2FEJA 3D2UA 5IFHH 3C6SA 5H8DA 1P4IL 3MRBB 4JCLA 4OGYL 3WGVB 1EEUA 4F8NA 1WS7A 2NXZC 4NO5A 1OF0A 1BV8A 5DJDA 2MNUA 3KJ6L 4JREC 2JQAA 3J27A 4PJDB 1KB5B 3WLWC 4BIKA 4WNJA 4KTYA 1HT6A 4RWHA 2LLNA 4LHQB 4PJ5A 2IDQA 4AVHA 2UUDH 5D1ZA 5FO2A 1UYWL 1ZDSA 3MYJB 5DVKA 3HZVB 1F0LA 3IGFA 5CIPA 4QHUB 1YCSA 4L2YA 3MRCB 2BWQA 4LARH 2AABL 2X9YA 1SOQA 5K59E 5B38A 1G9NH 4PRIA 1Q1PA 1UVQA 2ADIB 2C3VB 4JO1L 1DLHB 5F1NA 2R83A 2NSMA 2Q9OA 2VW6A 3B37A 3RG1C 2CWRA 3FT2A 4H8QA 3FYIB 2VLKE 4D7PA 3B4NA 4QTHB 2W88A 2CZNA 3SN6N 5I6XB 1RURL 1BAGA 1I7RA 4N9GA 4RMQA 3WAJA 1QBLH 3DIVA 5HHOA 4UUJA 3HRZA 2R56H 3KD4A 4JQXC 1OOAA 4ZW8A 1Z9LA 5T5FL 1CICA 4RGND 2H1PH 4NI6A 4ODHH 1CO1A 4JFDA 3CBKB 1SLUA 4RFNC 5ITFB 3EH5B 4M61B 3NIFF 2E0PA 2IH9A 3N2JA 2FVNA 3UBHA 3B43A 4Y4FA 5FWRA 3BPNC 3FB6B 5AKSA 1B9ZA 3QC5X 2MKWA 4RIRA 4G9DA 4HFWA 2J88L 4JFFE 4WWID 4ODBD 4KFMA 3K5SA 3EDKA 3QP3A 4S1QL 5E94B 2VSCA 1LO3L 3HAEA 2DQHL 3G6AA 1QD0A 2HFEA 4N0YH 1N26A 4NQVA 4U0QB 1V7NH 3LVTA 3RWHB 1LEGA 2GTZA 3VG9B 1PNCA 5DT1L 3NCFB 4JPIA 2IO5A 4AV0A 4MDJB 2YGQA 1J0HA 2PYFA 5AENA 3FCTA 3RFZC 4Y4HC 4OGXH 1NCWH 2BNUA 1JGDA 1QACA 4ZJ9A 2EABA 1N64H 4RNRB 3BP6A 4YR6A 5SWSE 2YAHA 4R0LB 3OMIB 2NUPA 5DZLA 3TT1L 1H15A 3UP6A 3W39A 2P8MB 1RMFH 2NQCA 3CIAA 3GQFA 4Q2ZB 4QRSA 4WW1B 3E7JA 4NKQB 4WWPA 2O61A 3DUSB 3OX8A 1E9OB 3QHFL 3MNWA 3GMLA 4WTWA 4PJ8A 4IDJH 5B1JA 1U8PA 1FZJB 1AD9A 3II2A 3KLAB 4WHTA 1JGVL 3S9DB 4G5AA 2E9JA 2O5ZH 4WRLA 4WJKB 1EO7A 1KJ3H 4FADA 5G2NA 1KTLB 2NT1A 2VABA 1J9RA 2IPKB 3P9LB 1NCDH 1T7ZA 4X4YB 3IFOB 5FUZH 5T1LA 1NJ9B 4BA0A 1ZV2A 2X1PA 4RDQF 1TJHL 4U6HA 3MNVB 4XNXL 4RGNB 2OQJB 4D0DA 4HUCA 3T4YA 3C6LD 4HHWA 3L95A 4JG0H 3R06A 2EYRB 3FUDA 2R1WB 1VF5C 2YGPA 3LD8C 4FYSA 5F72S 3QUMB 3BDYL 1OGPA 2XN1A 4ZMOA 1DDTA 5C6PB 4WQOA 1W6LA 4AH2A 3ES6B 4IBZA 1U95B 2ZWKA 1OWWA 3CSBA 2VL5B 2JFCA 4KZCA 1HEZB 1JPEA 1AGDA 1KYDA 1RKRA 4TNVF 3F04A 1PVHA 5D2NA 1X4XA 5KVMC 4NYLB 5LHDA 3Q01A 4DP2X 1USZA 1E3FA 3FCBA 4ES8A 4ETYA 4FRWA 3T08A 1RK1B 3DX3A 5L6YL 4P46D 4WJ5A 3MRRA 3BKCL 4M6NL 1NCTA 3WJMB 1Z0MA 1DBAH 4CL7A 1U8KA 1NFIA 4UTCA 2IVFC 2DL9A 5HPMA 3MGTA 5JZ7C 2AXGB 4RAHA 4HIXH 1GTFA 1Y0LA 2J1YA 4P23D 1U8OA 4ZO8A 4HZAA 4NEHB 3KPQA 1NH6A 1AQMA 4Z5RB 1SN5A 3II1A 4WF7A 2ZXCA 4X8GA 4MJ4A 3CZFA 2NTFA 2QDVA 3WN5C 3NESA 2F6AA 4HAFA 3GF8A 3B5HA 3EYUL 2CKBL 3I6KA 1XAUA 1KWGA 2XBZA 2FJGB 1K5WA 4LGRB 2K6WA 3UDWC 5E8OA 2B14A 2FZ3B 5I17B 3V4VA 3W9EA 2ODIA 3F5WA 4LSPL 1BLNA 5EO0A 1G1KA 4BCYA 4OZIE 2J3SA 3VXQB 3CN1A 2QPSA 3FUNA 3VA6A 3P0GB 4ZOEA 4F8QA 4QWWC 2AC0A 1KCSL 3P30H 1DFBL 4G8GD 1NAKH 2YPVL 4Y1AA 3TEUA 2WK2A 4XRCB 1X7SA 1NBYA 2PUQT 3F7LA 1SBSL 5I23A 4WWOA 2VLKD 3E2HB 2VXUH 1U2CA 5C0BA 4NM4L 3EH4B 3S34L 2ALWA 1BFOA 5AWNH 4TSBL 5GZOA 1HOCB 2ESVA 3ZYIA 5ACLA 1A7NL 4HEME 2BIQA 3VMNA 2FHFA 5KJRL 4HBQA 1DEDA 1GMIA 2AK1L 3B2PA 3B56A 1HCZA 3LEYL 2WM0A 1UT2A 3FAXA 3L45A 2HFFB 1HH6A 3QDJA 4YX2H 3NUKA 2OK0L 4ZG1A 3QUGA 4CC0A 3D33A 2GEQA 3T2LA 2CH8A 1S9WA 5D2LF 4HCRA 2DQGL 2DYSB 5DJZA 4HWEH 5DR5H 3AB0B 5DVLA 2F53A 2DQFB 1YHPA 1A4AA 2XQBH 5CJQL 3VJ6B 3ECUA 4JFFD 1MCWW 2CLRA 4HFUH 2EEBA 1TO4A 4G7VH 4OB5H 2UY7B 4P23B 1ACZA 4PYHA 5DZ9A 1HKFA 3GMMA 3AVEA 3BKJL 3IJSA 3OVUB 2QQLL 4KROC 1EQWA 5GRJL 3NFNA 5CZKA 4A66A 5HXMA 5JW4R 3MRGA 3O0RH 5D70H 1ZLVH 2BVTA 2CPCA 3KW8A 3QIWC 4ANXA 3VQ1C 4LOUC 2APSA 1N7MH 3DSNA 4LCVA 5E2UL 2DMKA 4QHPA 4KAQH 5SWSD 2HJFA 2YN5A 5KOMC 4NN7B 3TVMD 5K9JH 3BXNB 1NDGA 3MA7B 3GI8H 2NYYC 3GTNA 2O5XL 5L4IA 1E27B 5DD0H 1FUNA 4XP9L 2Y0SA 1G0XA 1NBVL 3R1GL 3BPOB 1I9RL 1YYLH 4DN4L 4RMWA 3N91A 4AYMC 3PWLA 3B9KC 4H8WC 2JI3A 1NC4B 4M9PA 4LSQH 5CEYA 2VLKB 3RPKA 1DHKA 5I16B 4M1DH 5INCA 1B4RA 3RWGB 4NUGH 1MHHB 2ZCLL 1C1EL 3GXMA 2PLTA 4H4NA 4N0CC 4U6VL 5GGVY 4DO5A 3KLDA 3Q3GB 4KVCL 1DJSA 5D7KE 1H9DA 3EFFA 2HG0A 2K70A 3PDDA 4M6OL 4HIEA 4G6ML 4LHUG 4NNYA 3PIQA 5T3XE 2CR3A 5MEOA 1E90A 1YUKB 4KK5D 1G7QB 3WKMH 4DETA 3X3GH 3VGAB 3H54A 1WH0A 4MXQD 4JB9H 2ADGB 2HSIA 4JGJA 4O2FB 1R5WB 1S46A 2X12A 1NDTA 2DDQH 3GBLA 3HB3D 2EDJA 3EHBD 3MRQB 4JFFB 4RGOL 3SIKA 5DDHA 3AUVA 1ZSDA 1C5BH 2WIIA 5HDQH 2EE9A 4APQB 4PY8I 4XAKE 1NFDB 2ZXQA 5E4EC 4K5OA 3P54A 4UYPA 4NRZB 4E2OA 4KZDL 4Z7OF 3EFOA 2ICWA 1XTLA 1ILSA 2Q7YB 5CJXA 2O6PA 1GA2A 1MAKA 2HKHH 1Y18A 3F7YA 2NY2D 4XO4A 1KFAL 2YFOA 1NCHA 1YMMB 4Y5XB 5SWSB 4QJ4B 4M48H 3TVMB 2ERJC 2HRGA 4S2SB 3VQMA 4LAQL 4MZ3A 4HZLA 1P1VA 3IBOA 4Z78B 3VFMB 5KVEL 3MRFA 3ARBD 3K2KA 3L5WB 1CZ8L 1GH7A 3KWUA 1CGSL 1YYML 2YRBA 4AIXA 3ECQA 4XOEA 1F6FB 1TTGA 5HVWA 4P5MB 3HZMB 1V54B 3ABMB 1MG2C 3OL2A 5DD3L 1AO7A 3D0LA 2XN9E 2OYLA 8CGTA 5KWYC 1QHOA 2YA2A 1UB5A 1TKWA 2IMMA 2WJ5A 3EXJA 5FXCH 3MRNB 3PWPB 1KTCA 1WP6A 3KLHD 5GRZA 4Q97A 1DL7H 2VUYA 5E5MA 3T77A 5C0AA 5KAQG 2ARJB 3EO0B 1RUQL 3ULVF 2CO6B 2DIJA 5DJ8B 1U8JA 3BE1L 3LQZB 5I6KA 2FB4H 4PRHA 1BVLA 3KPRE 2VLJB 3FO0H 3QQXA 2HVBA 4X98A 5CSZA 4I3RH 5K9QI 1JZFA 4M7JH 5JQIB 2FIKA 1KBBA 2H8PA 2GUYA 3EHBB 1T4WA 4LDOB 3CXDH 4IBLT 3IDGA 5IBUB 5F88A 2IANE 3MRKA 1T3FB 4X6FA 3PWVA 3UBFA 4UIMB 5IG7B 5T3ZL 4FZ8L 4QO1B 5DJAB 5ES4B 1YEDB 2ZONA 4PSPA 5F96L 1HNYA 4P2RA 1JSYA 5KYNA 3C60D 2ZCHH 2OTPA 4DQAA 4HAKA 1NAMB 4Z18A 3RGVB 1PCXA 1F4YL 2Y7MA 4LLVA 3Q1SH 1QFWL 1ZLVK 1WAEA 4EN3D 5I9QC 4DAGH 5EEZA 2FQEA 1PZUB 1EPFA 5EC2B 3RY6A 1CLCA 4FI7A 1SFDA 3ARBB 2OYPA 5DHXB 5IBTL 2CMRL 4LCYB 1CLYH 4KGJA 1FQ9C 3TPUA 5CWSA 2E4FA