2A9CA

Crystal structure of r138q mutant of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
359
structure length
359
Chain Sequence
RVNSQKPFNAEPPAELLAERFLTPNELFFTQNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
total genus 89
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9cA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9cA01
2CA3A 2A9DA 2BLFA 1OGPA 2BPBA 2XTSA 2A99A 3HBQA 3R18A 3HBPA 2A9CA 1XDQA 1XDYA 2BIHA 2CA4A 2C9XA 2A9AA 4PW3A 3R19A 3HC2A 3HBGA 2A9BA 2BIIA 4PW9A 1SOXA
chains in the Genus database with same CATH superfamily
1V10A 2FT7A 4I0PD 2CLVB 3MR9B 3SE3A 3V2AR 5IVZB 2NNAA 4L9DA 2YUWA 3KYOB 2DEWX 4HKZB 4M62L 4KXDA 3EYVB 3SDCB 1KEGL 3BOVA 4EN2A 1UZ8A 3TBYB 3RPIB 1B6DA 4N0FB 2XZCH 1TLKA 5L2JB 2FNBA 2VW4A 4L4VA 2B2XL 2C9VA 4PW4A 3PAUA 4X8JB 3ARGB 3FMGL 4ZPTB 3U2SB 5E9DE 3DNKA 1NDGB 1WO2A 3HUJB 1T4WA 3KLHD 1MW0A 3ATBA 1QSEE 2B08A 2ZXCA 2BP5M 4FMKA 2XU9A 4YHLL 2XZZA 4IKIA 1WAPA 2W9EH 3SJVE 5JW3L 1PG7W 3OJDB 4L4JA 4LLYA 4GIAA 3MV8D 4GO9A 5I82A 4DUWA 2YC1B 4MMXC 2VGLM 5JW4Q 1DQQA 3MLUH 4GS7C 4NI3A 5FKPB 5HYJD 3S97C 2NW2B 2VQUA 4JQVC 1JDDA 4P2YA 4PGCB 2X1WL 3QUZD 2IQ9H 3M1BB 4OD1H 4FYRA 3FONA 3BUYB 3BVVA 4DPAX 1UEMA 1LMIA 2K4AA 2AK1L 1UM6L 5T5FA 3BH9A 5IEHB 1IM3B 4N0CD 3N55A 1ZHNB 3MVSA 2Q1EA 4G1MB 1Q9OA 4XGZA 3BP6A 1WFMA 1QO3A 4Q6IB 1GGUA 2YGPA 5SWSD 2D73A 3HNSL 2WLMA 4UZGA 4B9GA 3QULB 2KHAA 3KVDD 1UOWA 3RL1B 4N5UA 1L3WA 3OXSA 1P4IL 2PP7A 3JYCA 3CFNA 1MH5A 4JJ5A 4KOCA 3AITA 1DANU 4KH9A 3STZB 3V0IA 1IGFH 2H3NA 3IGAA 4ELMB 5GS0C 3UH8A 3U9UB 5EU6E 1K6QH 3NZHH 1E42A 4G3YH 3X1FA 1CXKA 3O6FD 3QR2A 4OBRA 3ZL1A 2AJVH 4IMKA 4L23A 2QVMA 3MBWA 4FFWC 3WHXB 3L8QA 5ISZA 3DOSB 1MWAB 2HKFL 3QNYA 4JN1H 4RETB 1T0MA 3RX8A 4DPRA 4I87A 3QXVA 4DEUA 1HHHA 4OM0L 5IHZA 3NIGE 5AENA 3H9SA 4PGDA 4WSKA 1S7RB 1KJVA 1I85C 1II4E 1Z0MA 4XN5A 5DYOA 4U6HA 5T33H 1MG2C 1GS8A 4LBAA 2CNZA 1TZHB 5IG7B 1JZ7A 4L8SA 4TPRH 4OGZA 4XXCA 1BJ1H 3AU1B 2VN4A 5ADOL 1KCVL 2EH8L 1CUOA 1JYWA 3B4NA 3CN2A 1ZLVK 3GSRB 4IOIB 1BP3B 4JM2B 1U3NA 5FYJU 1JVOA 1MFBH 3NH7H 3VFRA 4V33A 5ESAA 4NQSB 5TE6H 1SF3A 3IVKA 2NNCA 3U48A 2GTZB 4N68A 4AIZA 1T2JA 3FB8B 4AVJA 5HHPA 1FV1B 2EDDA 3D85A 4KJWC 4O02H 1K4CA 1RKRA 2X9YA 4UINH 4O02A 3GRWL 2A9DA 1GHFL 3ZTDC 4UT7H 4W6YB 2OKMA 3P54A 5T1MB 3KAAA 3S3CB 5JW5B 1JE6A 1DFBH 3V0VB 4NZJA 4Z7QB 2BSEA 1L9QA 3F58H 3S37H 4HIHA 3BN9D 4AEFA 4HIEB 3UC0L 2ZWNA 1OANA 4GKNB 3QQ3B 2F2HA 3TO2B 3EYFB 5FPIA 1Q1JH 3H3PH 4WEUD 2DQUL 1EA9C 2PWFA 4UQEA 2BLFA 3NFPA 2G3MA 4ELMA 4JN2A 3L48A 4P4KB 3D2UD 5CUSL 3KLKA 2BP8A 1FL6A 3ARED 2XTJC 3EJTA 4AE1A 1T2QH 3EF7A 5IBLC 5IJVB 1FN4B 5IVXB 4QOKB 2ARWA 1AGEA 3PE9A 5FOBB 1JUFA 1QQDB 2E6PA 5D9SB 3V8OA 3RVTC 5C0DA 3TJEL 5C71A 1BF8A 1QI5A 2X6UA 3EGSA 1XF2B 2R9HD 5I1CL 4IU2A 4OCYL 4TNGA 5DK2B 2YPLE 1PPIA 4NN5B 1T1XA 2VT0A 3TT3L 3O9WD 2DBJA 2UZXA 4CADA 2Y9RT 3KDMA 2B14A 2GTWB 3DROB 4KUCF 1FN4A 1FYTD 2AXFA 1MW2A 4JFDE 4TNFA 4ZXBD 4CU6A 3GMRB 3KPMB 5J6HB 3GBNL 1IKNC 4BSWB 5GZOC 3REVA 1QHOA 4PRAA 3RJOA 5GGSY 2X4TA 3GSNL 1TZAA 4JUSA 3I50L 2BVUA 5F97E 5EU4A 3ABKB 4FFVD 4DH2A 3A21A 1QPXA 1INEH 1I1AC 3ZKND 1KLUB 4KKCC 4AQAA 2A6IA 2Q20A 2OMZB 2QSCL 5FYKL 2EDBA 3M17A 1U8JA 3OKOB 3CLEL 5J3HC 2EEAA 5JA9A 3QZLA 5KVGE 4JZOA 3S96B 3D3VB 4S1RH 1SY6L 1IC5H 1L9OA 5CJ5A 5G4MA 4H8WL 2MRYA 4I3SL 2DYPA 4JHUA 4Y4KC 3BW9A 4W9KC 3RILA 1WYJA 3HZ3A 1JGLL 2Z7UA 3TA3B 1ZVYA 2FGWH 3ZU8A 4POYA 3U82B 2YGNA 1HQ4B 5F21B 5D93B 4NM4L 3TIEA 4TNVK 4Y1AB 3G6DH 1NCDH 3RVUC 5GRVK 1E6OH 2ADFL 5DC0A 1QA9B 1NUDA 4JVWA 3C60D 5J11B 1E2VA 2V9RA 4ZW8A 1DVTA 1JN6B 5FWRA 4CMHB 1YDPA 2VDQH 5HYQA 3NSYA 4UOJA 1Q94A 5I1EH 1JK8A 3FU7A 4UTBL 1KPUB 1HE7A 1P4BL 4DW2L 4JRYE 1CE6A 2E9WA 3IFLL 1ZLSL 3QXWA 4HDIA 1RI8A 3ESNA 3MYJA 1OM9A 1DJGA 5K1NA 4E41E 2CO1A 1BX2A 1MVUA 4OF5A 2M2DA 2A9BA 2BX5A 2DTSA 2NY3D 2DJMA 4AK2A 2E8YA 4G70B 2Q5BA 3T6QC 3ESVF 2MHAA 4LMQE 2H2SC 3H9SE 4BIKA 1E3ZA 4Q9QL 1MIEH 4KY1L 2GC7C 2YRZA 1YHPA 3NCMA 3WFDL 4AQ8C 3H55A 2JKTM 5E95B 1VIWA 2ISDA 4HJEA 2F0CA 3G04A 2QDVA 1JPTH 3GLEA 4JFEB 3B9KD 2BFGA 1O9ZA 1ZK9A 3QJHA 4JW3A 1HS6A 4L4VD 1N8ZB 1AE6H 5D2NE 3C2AL 3VI3E 2XY1A 3D39A 3MRRA 2C5DC 3JVGC 2WXMA 4BD4A 2AJ3B 3S3PA 1I82A 4FRWA 2ZKWA 4NCC1 1NC2B 1LEGB 3IMSA 4P2QD 2GJ6E 4WWKD 1EJ8A 3DBXA 3GBLA 5F1NA 5KJRH 4NCDA 5I15L 2N4IA 4ODUB 3TJEH 5H35A 2C9SA 4XX1G 3RDTC 3ARRA 2VL5B 2WCGA 2A74A 3NRPA 4FNRA 2H3KA 1XDTT 2JVUA 4XO9A 1U41A 4QTIH 2YEQA 1P7QB 3QWQB 1EV2E 3K6NA 1KOAA 2XTJE 1FAIL 4Z3HA 4X6CA 4G8IA 4M48L 2H7WA 4NBZB 4YK4C 1AQDA 2DKMA 2F08A 1KTCA 1KGWA 1MLCB 3MLUL 4F3FB 5LBSH 2N7SA 3G6AA 1A6TA 1TVBB 2GAZB 2R0LL 3QJHB 3LYRA 4WKXA 3SDAB 2P46B 4XN1A 4L3ED 4P2OB 1XR8A 1ETZB 2IAMB 4K2UH 3DSFH 5SX5K 3RDJA 4BFRA 3HVNA 3K4ZA 5HHOB 3F83A 1UXWA 2WVSA 3LS4L 2EH7L 4MMZC 1E27B 1NGWA 1J48A 4ISVB 2EVFA 1T66C 2VLLA 1NC2A 3NSFA 2V4LA 4DKEL 1GHFH 1KF9B 4PVMA 1N2RA 2HXAA 5AVXB 1BVNT 5EO9B 5F88A 3QFJA 4H8VA 1T03H 1FLRL 3Q43A 5DJ8B 2HUEA 2ZP9A 1U8OA 3LKOB 4G8EB 4HJUA 4MQXC 4DPCX 2XKNB 1NCJA 1TZIB 3HE6B 4FXGC 1HNYA 1RSYA 5EULV 4YHZL 3BKML 2EIBA 3PY9A 3G6JA 3CFJA 1O9VA 3UZQB 2JK5A 3MBXL 3MV9A 2OYPA 4KKLD 4PB0L 3X1BA 4F92B 25C8L 3CZLA 4TOYL 2N1TE 5JXED 5IFJA 4NQSA 4NAQA 3BQVA 4BK5C 2VISB 1U2CA 4Y5XB 2R1YB 3GRGA 4HC1L 5IFAH 1KJMA 4QRRA 3ABGA 3CUPB 1KPVB 3O4LE 4J12A 1M2OA 5F9JA 3GNML 4PGDB 3ZYJA 3SBQA 4EZLA 1A4KB 4BDVA 4LSPH 2MCPL 1KIQB 4TULL 4MJ2A 4BZ2A 1KTDA 3HC4H 5L6YL 4XP9L 3QRLA 3WS6A 2QVFB 3V0AC 4JY5H 3DI3B 3M17B 3OKOA 4PJ7E 5KYUB 2H9GA 4KUCD 2ITCB 5AZEL 2P8MA 5ILTL 5AALA 3FQ4A 1I8MA 2YA2A 1Y18B 3HEIB 4FQIH 5FYLE 1BZQK 4TSAL 4FA8A 5DJ8A 3L3OC 3QHFL 2PLTA 1P9MC 1KGIA 1KXVA 2BIPA 2FT8A 1IIKA 1TZIA 3G6DL 5HY9A 4IEFB 4BK4A 2WSKA 3B9VA 2NSXA 3D4YA 1DVSA 1ETB1 2F7PA 4KZEL 3UERA 3GXPA 2B16A 5I8EB 5ISZE 1RK0A 2FQEA 4YFDB 2VJ0A 3GKWH 1ERNA 4UDTA 5IIEA 4PJXF 2KS0A 2XX1A 1ECYA 2E76C 2JH2A 1YEEH 3NSJA 3FCSA 3PS6A 4FFYA 3L45A 1CDHA 4Q6YA 2OL3L 3VI3B 2IAAC 3PP3H 5FR3A 5FFOA 1XF2A 4P46D 3B1TA 3OKEB 4UT6L 4GW1A 4WZ9A 5D2NC 4MTMA 7FABL 2DM3A 5HD8C 1JL8A 4W9DC 4MJ5B 3BFWA 2Z92A 3H9YA 3ESPA 3EBAA 4ZFFB 3L3JA 1HWWA 1TTFA 4RZCB 3AU0A 3MUGB 3ZY7A 4Z3EA 2Z31C 3QUYD 2V17L 5EEVA 4KUZL 3TESA 1NFIA 3AT0A 3CFKB 3QUXB 1BYNA 1JNNL 3BDXA 3LKRB 4ODVH 5KN5B 1BQLH 4LCWB 3KPQA 1E4XI 3MKGA 1VESA 3O4LB 1REIA 4ODHH 4OLZH 3I75B 3ERXA 4M1GH 2VZ1A 2BOLA 5HPOA 3C60C 5JIQA 3WU1A 4RESB 1CI5A 2RB8A 1KBPA 3SCMB 1OAQL 4OCYH 5JHDE 5KTEH 1DBAH 4GAJH 4PJBA 4PJ7B 2EIMB 3VG9C 4UDUB 4GIPD 5GZNA 1A6PA 3HC3H 3FUHA 1LILA 2R23B 3PWPA 2FWLB 2EYRB 1CL7L 3R19A 1J1XH 5DJ0A 1M71B 1AGDA 4OQ1A 1J05B 2EVGA 1E4KA 3K4DA 1DEEB 4Q0XL 4Q6KA 4AVHA 5AAWA 1TTUA 2EEDA 2KZWA 1EDQA 3GHEL 1U3JA 2Q87A 5AKTA 1X4XA 3RZCC 1BGXL 3ARBC 3SGEI 1BYOA 3TFKC 1SFDA 5J3HD 5BOPA 1NAMH 4X6CE 4UIMB 3F85A 2EO9A 3D0VA 3H7LA 3NDZE 2P3YA 2R29L 4LVNC 4I9XA 3MCKB 1GGIH 1TETH 1AKJA 5DS8A 3S3BB 4Y4FB 2MKWA 3JWDH 2DMGA 4LSQH 5F6HI 2AI0L 5ECJE 3L7FB 4XPBL 4J4PA 3OKMA 1SUHA 4YHMH 4ZXBB 4P49A 3VXNB 4B0MB 3IF1B 3C9NA 3VFNA 4M1DL 4O9HL 1OQXA 3F65A 2PCYA 1I4FB 2WVTA 2F53B 2VRQA 5AVQB 3MUHL 5HGHB 2EUXA 4Y5VB 1F1DA 1OGTA 5FK9B 1AANA 3B5HA 3F12A 3ZE2E 4EN3B 2RA1A 3L5XL 4IRZH 3RGHA 2D7TH 2XNAB 2JIXB 4JPWH 5HDBE 3NCBB 1F11B 1UT9A 4WI8A 1IEHA 4LSVH 4M7KH 3II2A 3QO1A 2EO7A 4MNQE 5J7CC 1T1WB 2NR6A 4P57A 5I5IA 1ZHLB 2YKLL 1OAZH 2OV0A 3LPFA 4IOFC 2WLLA 5ID1B 5D1ZI 2EINB 3MTXA 1W16A 3GD1C 3OD3A 4H0HB 4PWJA 5DMGD 1LWHA 2P5PA 4I3SH 2DS4A 3D9AL 5FA3A 4UQDA 5C7XL 2NXZC 4YX2L 4JGUA 1WIOA 1YG9A 3MA9H 1CGTA 1RJLB 1QNZL 1OE1A 4RGNE 2B77A 2WLNA 1L5GA 1ETA1 2EIJB 3CZNA 4D0BA 2ZUQB 4PRNB 4ZNEE 3HG1A 3WTTA 5AL8A 1ETJA 1JGIA 1FNEA 2IQAB 3A4DA 3D3VD 3K4AA 4NAJA 2YFOA 1B0RA 3CFQA 3MX0A 2WXOA 5FKAB 1N8OE 4AM0A 5DVNA 4FG2A 1CT8A 4U1HB 4OJCA 3M1CA 3QS3A 3ZHLA 2G75A 5FA4A 4XNMA 3GTTA 2VKXA 1KDJA 3RFZB 1TYRA 2COVD 1M7XA 3NDYE 4Q9RL 3FW6A 3KJ6L 5K9OB 1FNSL 3GHBL 2R2HB 4APQB 5B1JC 1E8XA 4P3DA 3TT3H 2NNRA 1YAZA 4Y2OA 3W37A 4E41A 1HEZB 4UMSA 1HL8A 3UBFA 2BY0A 2ENSA 2J7LA 2WO4A 3GWJA 5E9DB 1N0XL 2CMRL 5F0JB 2VZ3A 4BE6A 3NJNA 1E2WA 1H3GA 5CP3H 5EFIB 5DEFB 2NMSA 4XE0A 3HR5B 3MBED 4LHJB 1HQRB 1E4XL 3KL3A 3T08A 1ORQB 4HD5A 4LHUD 2UY7A 1FHNA 2W60A 5INCA 3B2UC 2IGFL 4PJDA 3U46B 3V0GA 3PGDB 3EYQD 2G2RA 2YZ8A 3C2AH 1FNGB 5IJBC 5DMIH 1QEWA 4GW4B 3FT3B 1IBGH 4GRLD 3OKEA 2OSLA 4LVOB 3ULVE 5FK9A 2YEZA 2XKSA 1SZNA 2DY2A 1J5IA 3V6ZA 3FPYA 5C2UB 3F05A 4HWBH 1YN7A 1VLXA 1JGVL 4MJJA 4PWIA 5AAMA 1AOZA 2CR0A 5IQMA 2E7LC 3A4FA 4PGBB 1CYGA 4AEHL 4KDWA 5H94A 4OI7A 2R51A 4NHCH 4HK0A 5GGRY 2X1QA 5I71C 4XB7A 5C9KA 2NTSP 4J6RH 4Z8FL 1JOIA 1JHTB 4FJZA 2X9ZA 4QCIA 3TYFA 2WXKA 2JJSC 4EUPH 4PIBA 1MQKL 4MNQD 2VDLB 5JZ7C 4L8SC 2CPCA 3QW9A 3VVWA 1KTJA 4KRNA 4DP6X 2ZSWB 4GI8A 3WHE1 2ZG3A 3D4ZA 4W68A 1XGQB 3LEYH 5BXFB 4IKNA 3VFRB 2ZXGA 1MI5D 1PCSA 2A6DB 4RZKA 4UM8A 4P3CL 3OKLA 2A9MH 4MXVF 4XPAH 4X5WB 3ZZSA 3RA7L 1NKGA 3UTTD 4DUXA 4I4WB 4X99A 5KYYB 4EIUA 3F6IA 4ZS6C 1RZPA 4K7PL 5GGTL 3BP7A 2HPTA 4XMKL 2V2TA 3FO0H 3UZQA 5DFVD 3K71B 3FT3A 4YLBA 2EILB 5E51A 5BXFA 5C6PB 3HAEB 4KV5F 1RJZB 1KGJA 4QWWC 1PX8A 4GUOA 5I5MA 1WZ1L 2KL6A 3ARVA 2J8UE 3CMOH 3K2MC 3PABB 1J0JA 2ZCKH 4JREB 2CAKA 3L3KA 3WE6A 2XIDA 3B2DC 3AZUA 3WSQH 1NWOA 1U8IA 1FGNL 4QDGA 3EJYC 2BNUA 4ZTOH 2OW6A 4JO1L 4B5ZA 1M1SA 4FQLL 4CC0A 1DR9A 1TETL 4PRHD 5K69A 1KY6A 5JDJA 2AKRB 4K15A 1MCIA 3ZE0E 2LE9A 1OP5K 4NN7B 3EO1A 3OB0H 1XGTA 4U1LA 2F74A 4JPKH 4LLWB 2JIXD 3C60B 1DLFH 2YD2A 4D8PB 3Q6FB 2NY5L 3MBXH 3SO5A 1MCBA 2XQYA 5E8EA 4Y0GA 4AGLA 5DQDH 1CPUA 4EBQH 3EJUA 5K1JA 1M2VA 3KLDA 1ZKAA 3IPFA 1XX9C 5AOJA 4V2CB 5D2LA 4AVIA 1BIIB 3KBHE 3U46A 4XT1C 3MV9E 4J3UA 4M7ZB 5H4ZA 4E42A 4Z76B 1IGFL 4JFHE 1WVZA 4MJIB 2O4EA 4J3OH 4Z9KB 5KJRL 1WC7A 1AVAA 5DYFA 5GS0H 3GDBA 5A2AA 4L18A 2XV6B 1JXGA 4AXWA 1DBAL 4X7CC 3ZKSD 3V7MA 5A2FA 5J6SA 2EH7H 2B2XH 2JFCA 1QRNE 4BHUI 3WTSA 3O2WH 4R90H 1A5FL 1FGVH 1CWVA 2BP8B 2ZWSA 2ZJSH 1U93A 3NEEA 1FFOB 2DWDA 4QOKA 1YYML 4R8WL 4L4VB 3O3AA 3PV7A 4WVRA 5HJGA 2XX0A 2HP4A 3U7WL 3IETB 1T80A 1Z2KA 4G6FD 3L5JA 2YPVL 2HRLA 3O4OB 3GMLB 4AUUA 1CC3A 3L4XA 5ILTH 2ZNXA 4K0OA 5I30L 2IGTA 3CIAA 4KHXH 4OFQA 2PP9A 1UJTA 1T0OA 1RJLA 1RZJH 2Z4QA 3EXJA 3IAGC 2BY3A 4D0BB 4HCGA 2NY4B 3D5OF 1MCKA 2HH0H 1AR1B 2OXHA 1C8PA 2AVFA 1ZVSA 3OMZA 4U4BA 2B5IC 4WW1B 1PZBA 3SDDA 1MCLA 2WZ6A 3K8LA 3L3KB 1OE3A 5D7KD 1CU4L 3N0AA 4JE4B 2OAAA 5AOLA 2AGJH 4MD4B 1FORH 5DUML 3ZDWA 4PUBH 2ALAA 4MQ7A 1T5XA 3EGDA 1AKJB 4R4ND 2PYED 3DMMA 5EIVA 3G04B 2A0LC 4CJ0A 1MCWW 4B9YA 4IQHA 1BEXA 3WIIL 2O6DA 2WB1A 3WLBA 4ANVA 5DURD 1USZA 4XPAL 2J6EA 4LSVL 2VDRH 4K3JL 2ZWLT 3CK0L 1NGXA 5LGHH 2FH6A 3W5MA 2X4UA 1UCTA 1NBZB 3P77A 5JW4M 3LKSA 4FG0A 4M5SA 3OZKA 4U0RC 4OZHA 1A14H 1MY7A 3EJZD 3UYRH 4H1LA 4WI9A 3ARYA 2RACA 3HHMA 3LZFH 2CBQA 4MMXA 3AQDA 5F7EL 3SGEH 1FC2D 5E0QA 4ZFOB 3KPOA 3NP4A 1HILA 3S6CA 3DO7A 5FLUA 2C1PB 1LO5A 3HIZA 4MWFB 5I73B 2MEJB 4MQTB 1SLVA 3QFDA 3GMPB 1J0IA 2X4NB 1D3CA 1NBZA 4N2HA 1YN7B 4RAVB 4IRSA 3VI4B 3BQUD 3BD5A 1X9UA 3KDPB 3V0WH 3GXNA 3KLHC 2CM5A 1VCBC 2FD6H 4LEXH 4LQ1A 5SWSE 3S9DB 3IRPX 4R7DA 3IRZA 1H3VA 2CBMA 2GEQA 3FUEA 1XH3A 4MCNA 1H8OA 2UY7B 4KI1A 3DV4A 1N0LB 4BSVA 4I3RL 5F9AC 2LTQC 1FI8C 3KHOA 1IIIA 4JY4A 4IYKA 2ZG2A 4FP8L 4FQXD 3OXSB 4P5KA 3UIYA 1GZHC 2H8PA 3B2XA 3EDEA 4KPHL 4L4TE 4QRSA 4QRQB 4Y2LA 1H0DB 4FXLA 3U4BH 3H0TA 3FSZA 1U91A 2X4SA 1PQZA 3T4AC 3DVGB 5ERWA 4BK8A 5FO2A 2YGQA 3LD8C 1EEZB 2L7JA 1BV8A 3GZOA 3RJQB 3ZHFA 1T4KA 2GBAA 2OFQA 4OD1L 3QIWA 2ICWA 3GZPA 5AAPA 5FYKH 3PHQA 3FT4B 4WY7H 4GW5B 1C16B 2AK4A 1R0AL 1SJHA 1D5ZB 3F5WB 1OGAA 4W9HC 4FCHA 5ACZB 4L1LA 4Z7QF 2OZNA 4U0QB 4HF5H 4YGVB 2M8XA 3L3IA 12E8H 4FYQA 1DLFL 5DWPA 2BHFA 5IHWA 5KAQG 1T20B 2AK4D 1ZGLM 1TSRA 5D7LE 3T1FB 5DQDL 2YPVH 4PU2A 1CF1A 3TASA 4LZKA 2ZZUT 4OF8A 3RE0A 2W81C 2OK0L 3MNWB 4U1LB 4HBQA 3UBXB 3I9GH 3DDGA 3QHZL 2VXQL 3MOBL 3DX3A 2WSPA 1F4AA 5EU6B 1RZJC 2YSSB 4FQQA 4XMLL 3APNA 2DLIA 3O6FC 4BFBD 1UWFA 4UDTB 1GTFA 1WAEA 1Z9OA 2HB0A 1LE9A 3T4YA 4YFEA 4NNPL 2XVBA 1FZMB 1YZZA 4DSYA 5EOCH 1U8IB 1JZ8A 4A7QA 5GSRA 1QTYT 4L3EB 4PG9A 3IWUA 4H0GA 4KJYB 4FI6A 4C56B 4AYGA 1JERA 4OLXL 5K93A 4XO4A 4O02B 4YPGB 1PJ9A 3IJSA 5AQ0A 1ZE3C 1IGYA 1QLEH 5LB1A 1V3MA 3TO4A 4BZ2H 4LCIL 4K7PH 1NFDF 1E6JL 2FO4A 4JHWH 2VM4A 4IIQB 4KO9A 5DK3A 1DZ0A 1N10A 4MNGB 1NGYB 2B5IB 4R5VA 4ZOEA 4UAHA 2GITB 1K2DB 3S2CA 4JRFA 3QXDB 4H20L 4KY1H 4OAWA 4WJG3 2O5YH 5I8KL 1GRWA 3ME0B 3ENEA 3CHPA 3G5WA 4IGBB 2J12B 3OPZL 4AI7A 2NQCA 3LRGA 3MRIB 2CUHA 5J12C 3HJEA 3P9MB 1EHLH 4XPBH 4F1ZA 3MRMA 4G5ZL 1AO7A 4WJ5A 1KJVB 2VLKA 1NFKA 3CFTA 3C6LA 4XPTL 4NWUL 3RRQA 2PCPA 3FN9A 4KK9C 4JZJC 3LKQA 4LGPB 3FUNA 1YEFL 2YD9A 4KRPD 4TN9A 2K6YA 4EI6B 1PF3A 4JR9L 4AYSA 1NEZA 2IIJA 4JM0A 5BVPH 3LHPL 4BK5A 4MKTA 4P9HH 1IB5A 1HHIA 1MCOL 4HLJA 4JFDA 4NKQB 4K55A 1SJMA 2GUOB 3FL7A 3KBPA 4YGAB 5FUZH 3MLWL 1V3LA 1ACZA 5EUOE 1NBCA 4ZUWA 1E0OB 5DMJB 5IQ7H 4B9ZA 1WICA 5GGRB 3QBTB 4WWOA 3DSNA 1C1EL 5DT1L 4UTAL 1OGSA 4NQDE 1E5YA 1HSBA 1I8KA 2HFGH 1BQHA 1KWKA 4YSUA 4PLKC 3I2CH 4R7NB 4IOFD 2AK1H 1U8HA 4LOFA 3WTVA 1Z7JA 2EVIA 3HBPA 3WV0A 5KJ7E 2WIMA 4PSPA 4PJ6A 3B3IB 3TXAA 1OTTC 1A6AA 4OM0H 1UATA 2WAHA 1UT2A 5I0VA 1OHQA 3OPUA 1PG7L 3T4AB 3K6IA 5L2KD 1UASA 3BPNB 4R7VA 1KB3A 2MPAL 3QUXD 2AS5M 4LL9A 1ES0B 5I30H 1EX0A 2FIRT 4NYLA 4I9WE 4FFYH 3QZWB 1RZJL 3QDJD 2BPBA 1TT6A 4PRPE 3IETA 3L95B 3DIDA 4AVKA 3L17A 3C5ZD 5F7KC 2X6BA 3ZKXC 5KVEE 1BQUA 2QHLA 4JDEB 5JUEH 4HCRH 3GBNH 4Z7NF 1ZJBA 4GAGL 1MHEB 4L0ZA 2BZCA 1E50A 32C2A 1AD9A 4NT6A 2VMEA 3WXVL 6FABL 5EO1B 5F7DA 1ZTMA 1R5VB 3CFEB 1C7TA 5EBWB 5A2CA 4Q58C 4NUJB 2MQ3A 2H32A 3KWVA 3BP4B 1NDGA 2IH8A 3QG7H 1JRHH 4P04A 3QDGB 4WTWA 4L1SA 2NY1D 5BMFH 3LH2H 3KXFE 4MDIB 3DI2B 1N5YH 5MEQA 3DIFA 4DN4L 3R4RA 2P5EB 2Y07L 5D2LB 2NR6C 3EO0B 2BRQA 2JIXA 2ITDA 3GO1L 5DMYA 4MXQC 3RNKB 5DI8B 3T8VA 3RA7H 1N59B 1S9YA 4CN1A 1P4LB 2NY2C 4OQTA 3FHQA 4AIOA 1HHIB 3ASOB 5FYLH 1R1CA 4RBPK 4Y19E 4QHPA 1MHCB 3ULVF 5EUKB 3TH3T 1XB6A 4LCUA 1JXKA 2VKWA 2YAMA 3UYOD 3VD1A 3BDYH 5CP3A 4PRPD 1HHGA 4IRZA 1QI3A 2GHWB 2R0WH 5LBGA 2QQNH 3VWKA 1U8NB 2A73B 2I7OA 3AS2A 4QXTB 5HVHB 1SHWA 1YECL 3KEDA 1P1ZB 4AUJA 1R34A 4L29B 3CJJA 2CKNA 3NJKA 2XBTA 1F13A 4KVPA 4Z7VF 4NZUH 2DLGA 5IROD 1DL7H 3QCVH 1BLNB 3LAFA 3AM8C 5CMAA 1E9PA 2EC9U 2UZPA 2K3TA 1UOVA 1MHHA 3INUH 4MRCA 4O2EA 5IMOB 3L6FA 1R4XA 1AR1C 3O3BA 4KRMB 4S1DD 2ROXA 4K3EH 2YUVA 3SYPA 5DMGC 3UIZA 4HPOL 3B7TA 1KYOJ 1RPQA 5TE6L 4YHZH 1T03L 5DHDA 2DTML 1KBBA 2IADA 4OLUL 3ATFA 3LRMA 4N8UA 2DJUA 5GIRA 4EKXA 3SDDB 1NMBH 5FX3A 1AGDB 4YWGH 2H47C 2IALA 2RQEA 2ZOKB 3ESMA 4PGBA 5TE4H 1BFOB 3FTGA 4HU8A 1EDYA 1CU4H 5F7FA 3A6BH 4LNRB 2FBJL 4LVEA 1AOHA 1CFTA 4WCYH 4LCCA 1UWGL 3NABL 4N2LA 2Z35B 1JNNH 1CF8H 1LE9B 4BUGA 4XBEL 5D7JD 2ZUQC 3B6SA 2EVHA 3MC0A 5T1KD 4LP5A 4BCXA 3PL6D 3V5DB 4OD3H 1XT5A 4RFOL 3B5GA 3GM8A 3L9BA 4WFGE 1TFHA 2RD0A 2MPAH 3AAZA 4JFVA 4LSTL 2OMVB 4DEWA 5IROC 4H2CA 2OMBA 3CWGA 4ZTPL 2D9QB 4XHQA 4ZODA 4FNQA 3UTSA 4FFYL 5JORB 2OI9B 5J13B 1CLVA 5JQ6H 4WKZB 3LQMA 4OCWH 4XCNB 5GJTH 3MRHA 1PLGL 3MLVL 4GSDH 5JO5B 3S4SB 2BSBA 1F58H 4OIIH 3UAJC 4KDTA 1AG6A 4HIJA 1UXSB 2YK1L 1G7PA 3N06B 1HCYA 4AC2A 3GMQA 1V55B 4XOAA 3OC8A 3MV7D 5TQ0L 4MD0A 1JNLH 1PD1A 4HJJL 4PWKA 3QJZA 3SKMA 4KXBA 1O5DT 4J8RB 2HG5B 5HHVL 1QZ1A 5SWSA 3MHZA 1BAGA 3UDWC 3CZFB 1NPNA 2G5RA 4UTBA 2F54A 1QLFB 3EBGA 3WFDH 5JOPE 3APCA 2UY6B 4P9HL 3SE6A 2WYZA 4GW1B 1JPTL 1WT5C 1IGMH 3RGVB 5GRXG 1GSKA 3BPCA 4DAGH 2A2QT 3QISA 3DTXB 5JW5A 2GSIB 4EPSA 2NW3B 1UH3A 3QIBB 1U33A 2G9KA 4NQUA 5ACMA 3WJLA 3NN8B 3FT0A 5GS0D 1P84J 4H7VA 4EI5C 4NXKA 5HYJA 2NY6B 4YSSA 1ZOXA 5GQBA 4F2MA 1DVFD 1P84K 3IMBA 4PP1C 4YDVB 4OZFH 3IU3A 1QVOA 1AZUA 2A83A 3Q8FA 3FKUS 3WLWD 2BOCA 4JB9H 1BVKA 1EZUA 3IDIA 3EYUL 3P9LA 5BS0D 3FHEA 2DQMA 1SJXA 3H56A 1BJMA 4LLVA 4JEGB 2MIZA 1FV1A 4QHUA 4KGLA 4WU5B 5E2TL 1R9FA 4K3JH 3C75A 1U8PA 3C6SA 1RUML 2DIBA 3KLAB 5GRJH 2VN5A 4IBWA 2NCMA 2CLZB 2Y0SA 2G9HB 2D31A 2ZG1A 5JPNB 2ZSWA 3V6BR 3MV9B 4HPOH 2EEFA 3RX7A 2IH3A 3KH4A 4PRDB 5D1ZC 4XTRD 5I0WA 2L7QA 1LP9F 3MXWH 5DJ0B 3KCPB 3V4PA 3FULA 4P23D 2JI3A 3DVIA 2Y2YA 1OCWH 3PWVA 3UJIH 3DSFL 4NRYA 4OQTL 3S96A 5L4FA 5HYFA 1MZZA 2FH8A 2R0WL 2JXMA 4HJTA 1S4IA 5IB4B 1RZKC 4V1DE 1YECH 2VN3A 3WFCL 5IBTH 2CA4A 4K2UL 5T3ZH 3AS3A 4K3DH 3U7AA 5E56A 1IGIL 3HFMH 3O4LA 3VWKD 4M7LH 1XZWA 1KIPB 4IIQA 3WD5L 4N1CA 3T2QA 1TJIL 3SHSA 4S1QL 1NWPA 5FW8A 1U58B 5MEQB 2MOVA 3JYBA 1K8DA 3M8OH 3DETC 2Q0ZX 3GO1H 2PF6A 1I1CA 2E27H 4PJ7A 3VWJB 2ZCHH 4FQCH 1IFRA 4UZUA 3SDDC 1V7MH 2AEOA 2I26N 2K6WA 4JKMA 1QLRA 4GFTB 2AMUA 3U79A 2UZXB 5F7UA 1CFBA 1WJ3A 5F3BB 3HZMB 5J06A 3PRZA 2I25N 4OD2B 1MUJB 1IGCH 1OW0A 3S5LA 1VGKB 1SM3L 5I1DA 1LO2H 4G83A 4IBVA 1JRHL 2P26A 4YLQT 2K7QA 1G9NC 3B34A 2JKXA 1MY5A 4F8LA 4MJ4A 2DQHH 3RHWK 3QDME 4PS7A 3QWOB 3OAYK 5AW5B 1YJDC 3PU7A 4PWGA 5C0NC 5BO1H 2JJTA 3FBQA 4OVVA 3GIVB 4IRJD 4ODSL 1NL0L 1ZV5A 1NA8A 1UVQA 4I9WD 1WFNA 4ZUWB 4ZFFA 1FAKT 2CGZA 1KWGA 2DBLL 1MJUH 3G9VA 4A63A 1NBQA 4LPXA 3SOBH 4QRRD 1MFEL 4MAUL 2VO8A 3DURB 4G6KL 4KRLB 1FCGA 1X5ZA 3NESA 3QYMA 2R0KH 5C7ZA 3S34L 1NDTA 2XQBL 1SEBB 1AAJA 4WI7A 2F5BH 3NFSH 5D6DA 1MZYA 1MWOA 1KENH 1OTSD 4LPUA 3WUWG 1KFAL 1A0QH 4WHTA 4XR8C 3NJVA 2XFGB 2BWDA 3BEWA 3LVTA 2VH5H 5BVJA 1UZ8B 3KNBB 5F0PB 3VAEA 5FHBH 4LVNB 1I1RA 2PTUA 2YD1A 3KYKH 1XIWB 5CSZA 3KPLA 5JHDA 3ULUC 4N90E 3O6MH 5AG9A 1EHAA 4N1HB 5CXPA 3TH2T 4FXTA 2FEDC 4MMZB 3DPBA 2VC2B 3O3BB 5CM1A 4FQHB 2QMKA 1RZKL 3P0YL 4TUUA 2HFFB 4U1NA 3WLBB 3K1KC 1ZSHA 1MFUA 1OIOA 4BSJA 1YMME 4Y9BA 4DP7X 3WFBL 5CEZD 1BOGA 3PWPD 4WI5A 3QAZB 2B9BA 5ICZB 3TPUA 3V8CA 1EUUA 4PJIE 4J7RA 4J6RL 1Q9LB 4Z8FH 4J27A 2X6VA 4JMXA 1GZPA 3H6AA 3PYCA 5LWYL 3TBVA 1FO0A 1KC5H 1U8KA 4NHCL 2ZONA 4FQXC 4URTB 1B3JA 1SOSA 1DYZA 1HXKA 1NCWL 1J8RA 3LKOA 4G8EA 5ISZB 4YPGA 5KAQF 1QWHA 3EOTH 1P4LA 2AV7B 2PXYC 3G6AB 5AW3B 5SX4I 4F2ME 2J44A 5TK2A 1EQWA 1CICA 1DVUA 5DF0A 4KKPA 3SO3B 2VLJA 1UVQB 1T5XB 3EGDB 4NO0D 1QLFA 3HZYA 4JKPH 5EFIA 2CWRA 3D25A 1P6FA 4G80B 4F7MB 4Z1PA 4XMZA 1EVUA 1MHPL 3FCUB 3RNQB 1XR8B 2IAMA 5CO1A 1YEHH 2NTFB 3QUKA 1N4XH 4R3SA 3DX0A 3EO9L 1AMXA 1UXWB 4XVUD 1THAA 4OZIA 2C8NA 3D0AA 2CDGA 3QZOA 4B9FA 4E9TA 3LH8A 2DQDH 3KJ6H 4KRPC 1ZHBB 4CGTA 3OGCB 2XQYG 2VXTH 4MFHA 4HIPA 5F1SA 1A2YB 4ZQKA 4U1KB 43CAA 4HETA 2Y5EA 5FECB 3ZKQD 3ULAB 1ITCA 1NJ9A 2QPFA 1JV2B 2RMNA 3IKCB 4FQ1H 4NQXA 5EEYA 1E9OB 3EGXA 3H6JA 2YAFA 3GXIA 2J1ZA 2ZF8A 1GW0A 1MG3C 1D2PA 4LK4A 4OFYA 5CEYB 3DX4A 3FO1B 1GYCA 5F8QC 5C6TH 3OR7B 1XGRB 5MERB 2ICWB 3VXMB 1XF4A 5B8CC 6CGTA 2FAUA 2VXUL 2DAVA 3T0EB 1ODUA 4LLWA 2E46A 2VABB 2YGVA 6PAZA 4JG1L 3WJMA 1OSPH 3ETTA 2X89D 3GEFA 1FG9C 3HZVB 2PUQT 4WFED 5EO0A 2NUTA 4ZD3H 5BV7H 2P4AB 4ATTA 4PJCA 3V4UH 3TFKD 3KLLA 3KBFA 3ZYOA 4ZTOL 3EOAA 1F3DH 4OQTH 5D93C 1XXFC 4G7QB 3D69B 3FQUB 4XBMA 3HMWH 2CG9X 3FDWA 5D1XB 5E9DD 1K9TA 35C8H 5IWLC 4LRNL 3SDCD 1OCRB 5D7IA 1RZQA 1TEYA 4ZTPH 1RU9L 5JIPA 5EF1A 2FT6A 1COBA 4P3CH 4PH8A 4UAOB 2HRGA 2IWFA 3HE7C 5DEZA 3BZEB 3QDMA 1Y1DA 3QJFA 1ULVA 2VE6B 1XTLA 3GSRA 5ICXA 5IREA 4F5CE 1I8IB 2HVJB 5CIPB 4BDVB 5JIHA 4ZPVA 5T1JA 1OLLA 5C09D 3UAAA 2Y7LA 2XZQH 5CJXA 3OXRA 2GW5A 2OMTA 5LCVA 1DE4B 3MZGB 4GP4B 4W9GC 2MQ0A 3HS0C 1SYVA 2Y22A 3ALPA 3E1ZA 5IM7B 5HBBA 1HYSC 2WLYA 5C08A 1RUQH 5HYJB 3K72A 3VXUB 5JXAH 4CW1B 2CJUH 1E3FA 1ZIBA 5C08D 1EHNA 2HH0L 2HVJA 4GI6A 4UINL 1GW6A 1T0NB 4PTTA 2ZCKL 5E1AA 2PW2B 3BP5A 1W6LA 2VQ4A 4ANWA 2ADGA 3EADA 3KJ4C 1F56A 2VWEE 4FEIA 4YNYB 3FS9A 1NGPH 1NIBA 2ICEB 2IMNA 3HBZA 4FKKA 5EZOL 1AQKH 1J8KA 1PFOA 4PTUB 3DUHA 3U9UA 2WBJD 1EGJA 4NSKA 3ZDYE 4NC1E 4KNSA 1S9YB 5EO9A 5FGBA 1KMGA 1HL4A 4DESA 1CGSH 1BA9A 4M6OL 1LHZA 1E4XH 3QIBD 3BISA 3DO4A 2XTJB 1RZIA 4JPVH 4QRPA 3MRBA 4PW3A 3VSTA 1KY7A 4K7FB 5DQ9A 3C08H 4PY8I 4Q4IA 3FUDA 1U3ZA 2VYRE 3HG0A 5B7EA 3K2UL 5TQ2L 1B88A 4M7JH 3VFPA 4X5XB 3A4AA 3WMPA 3HLKA 2NUTB 2XJKA 4AYEC 2FHBA 3FH5A 5C0DB 1HJBC 2EACA 3FU0A 2PWEA 3DA0A 5E2VH 5KSAB 4YDJB 4J5VA 4CUCA 4NO0B 5JPMC 2DBLH 2Y7OA 4X5LA 1T5KA 3ARDA 4Y2DB 2LU7A 5GZNC 1VACB 3X3FH 5JQ6L 4JDEA 5CBEA 4QHKJ 4ICWA 3BO8B 3BT2H 3MJ8A 4U7SA 2BIIA 4KMLB 5ITBH 2H41A 2YC1A 1I9IL 1O7DE 1IARB 1UCBH 4XP1H 4G8FA 4Y19B 3L2NA 2J1WA 5KVDL 1RUAH 1DQQB 5FKPA 1CI3M 1CK0L 3CXHK 3VRIB 4M4RA 1VDGA 4MAYB 1C9SA 4OU3A 4JE0A 5GJSL 4JM4L 4B9JA 1FNAA 1KV7A 1OP4A 3IJHB 3U9PL 2CJTA 4G42B 3VRLE 1LTXA 4FP8H 4HX1A 5B3JE 1JZHA 3ZIMA 4JFUA 2NY4D 3NCCB 1PKOA 3OSKA 4Z7IA 1BQHB 1HZKA 5CEXA 3MRRB 1XL4A 5KBMA 2WMPA 3IXTB 2HKHH 3RZWA 2V3FA 3MLTB 4EN3D 3DMMC 2YAOA 1V7ML 2NY5H 2PPAA 3VW3H 1SBBA 2HT2C 4WHYG 5FUOL 3SE9L 5CFHA 1PFCA 2P5WD 4AJVA 1PDKA 4JRXA 4PGZA 4U6VL 2KZKA 1BF2A 3WGUB 4KGJA 3DRTA 3RY6A 2WNXA 3LN5B 4PJ5D 4Q89A 1URIA 2IVFC 1TQSA 2CKBB 5JR1H 4MCZB 2Z4TA 2G4EA 2HVBA 4WEEA 4HFUH 1DVQA 4M3KB 1J9RA 2QV4A 2G3XA 3RIAK 1M7UA 4ZX4A 1FVCA 5BS0E 1AIFA 1MW3A 1ZA6A 4JO1H 4OGXL 4AV4A 4MMYA 3IFLH 3QXUA 2I24N 4L9LC 3QDGE 3ATEA 2EDQA 2P44B 2O5ZL 5FO7B 2D3LA 3AMLA 5T1DH 3EOYG 1A4BA 3FPXA 2AK4E 3KM2A 1F42A 1QACA 1IAIL 4B96A 5F7NC 3KYKL 2ID5A 2CDFB 3N1FC 4EDWL 3L1OL 2XPGB 5TDPB 2O6EA 3IGAB 3O3UN 2A7BA 1M7DA 1IGYB 5D7HA 2KMWA 2WBKA 3R06A 3MV8E 4RGMC 1AD0B 3GK8L 3GJFA 5DD5H 5H94B 4BRVA 1P7HL 4G8GE 3ULUH 1I1AA 2DQIH 3Q8BA 1S7RA 3MFFB 1CO1A 4WENB 3G5YA 3QGVA 5IEKB 3WL9A 4L4TD 5ICXB 4ZX6A 4O58H 1EWHA 1G5AA 3A67H 3S36L 4PJ7F 2ZYHA 4JCMA 5IUCA 2O93L 4S1SH 3BWUF 3GUTA 2YSSA 2GSMB 4AQ8A 2FEJA 1R3IL 3BEVA 4PJ9B 3VWKC 1JP5A 2OCJA 2ZPKH 3OHMB 4B53A 1HQRA 4CMMB 2H2SD 3TCLB 1RZ8B 5L7XL 2EUWA 4ODSH 2NT1A 3W81A 1KXQA 2OMYB 4HUUB 2FJGA 4KQ3H 3N42F 3K6FA 4P4KC 1XCQB 4A6YB 1JF1B 4ZQTA 4E41B 2CH8A 5HHMD 1ADQL 1FL3A 4G8IB 2AJZA 1I8AA 1JWUA 3NVQA 5KYXA 4HIJB 1TJGH 4FNTA 1RIHL 4BV1A 3FSVA 4V2BA 3UROR 4PJIA 3NRFA 4IJTA 3RB5A 2WBWB 5GS0L 1H8NA 2CXKA 4BKLB 2C9AA 3U4BL 4R3SB 5KSAD 2ED7A 4KI5C 4FG4A 4JDTL 2CDGB 4KU1A 1TTGA 3M45A 4FDWA 5DA0B 4KNQA 1B0RB 5KYXB 3B83A 1I8KB 4UV7L 3ILPB 2CIIB 1RIUL 2MSPA 3O6LL 2GFBA 3K3QA 3QI9C 1RK0B 1XF5A 4F7MA 1K4DA 4L3CA 4MB4A 3AY4C 1MCOH 4BH7B 3FSWA 3JTSA 1D5BB 1YJDL 2X6AA 3BGMB 3G08A 1L5GB 1FVDB 3V0EA 4AJYV 5AZEH 1MOEA 2WXGA 1G7JB 1YPZA 4YFLF 5EBGA 4I8DA 1GYAA 1L7TH 1PAZA 2B4CH 4Y1AE 1S5IH 5F1IB 2JXMB 1NCHA 4L37A 3D09A 4MKMA 3TN0A 5BO0D 1EANA 3CNKA 3U6XS 1HESA 2VSKB 3R18A 1A3LH 1TPXB 3JVGA 1A7NL 2ESVD 3VFTB 4N20A 5E8PB 5IMMB 3GBEA 1GPOH 1EHLL 4IS6B 4RAHA 1VPOL 2ZYRA 4Y5XA 4YLCA 5I0DA 4NNYB 4LFHG 5C0ND 2IH1B 2V2TB 4QNPF 4D7PA 1KPVA 4EVNA 3NIDB 2CLZA 4KDTC 4L3AA 3TEYA 2UXTA 2ZKXA 2WXLA 4DZ8A 1NEPA 2GTZA 5TJWK 4YNYA 3UJJL 5KYUA 2DQCH 3SE8H 5EF0A 4QRFA 4B50A 5HHOE 1HHKB 5CJOL 1X5XA 4PCSA 4DP9X 5BQ7A 3RWEA 3V6FB 3RFZC 4P2OD 4JO4L 2QQLH 2WLJA 1HNFA 4HS6A 4RMVA 3POCA 3NUKA 3ARDC 1HH6B 2APSA 3P4OA 4JFPB 5KVFL 4WK2B 2NPLX 2EZ0D 5EU5A 3D3VA 1G7IA 1QI4A 4JM4H 2WKOF 3E6FB 3BFOA 3L9EA 3I6GB 3BPCB 2CHDA 1BFTA 3FF8A 5EUKA 2KQNA 3KD4A 2R29H 4EAEA 5F8RC 1UJ3C 1YNKL 2ADYA 3WIHL 1M6UA 32C2B 3SKJL 3UX9B 5I66A 3PIQB 1ZT7A 3BZEA 4JANB 3BH8B 3N85L 4DVRL 4G6ML 5CJQH 4ZS7H 5F3HA 2I60L 3U9WA 1EXGA 2VDOB 5E4OA 4KJWD 1GYVA 5IJDC 2OZ4A 3VXOB 1KUMA 3QEHA 4N5EC 3FRPG 5DJCA 4KHTL 2X0WA 1BFVH 3BUQA 1F3JB 2EADA 2AQQA 3ECQA 1FDLH 3WG7B 2X4PB 1UZ6F 4K8RC 3CC5B 4N9OB 4AYID 1K8IA 2JCCA 3U9PH 3VWJD 2ZYSA 3VRIA 1MELA 3SQOL 1XTMA 1IKOP 2N7AA 2L4OA 4POZC 4PAZA 1XV8A 4FF9A 4F7CA 3LNGA 1XWVA 3PP4L 1Y1UA 3JWNH 4M1GL 3TX4A 1QFHA 2C3VB 1KB9K 6FABH 1AQ8A 5H2BA 5EU3A 3K8KA 2KLRA 1YEDB 4L48A 5TF1L 3W2DH 3FO9B 1KTLA 4KK5D 1FL6B 4XVTH 2EE0A 1GJIA 3V5KA 2XIBA 4UU9B 1EGJL 2OS7A 3Q1SL 5DJZB 1KGCD 3CAFA 4JFEA 4PJXB 5EN2A 3WO4C 1FP5A 4F7CB 4XNYH 4OCNC 5EPMB 1AS6A 5A3IC 1NCCH 5C0BE 3V5DA 3SE4C 3Q6FA 1J1OL 4XN7A 2BVQA 3HHRB 3RWHA 3TBSA 4YUEL 3U83A 1A7QH 2JKWA 4AEIL 1JGEA 1JXJA 1TKWA 3P4MA 4QYAA 9CGTA 5KSBF 1S3KH 4KVNH 1HAUA 3HN8A 5HGAA 4R4NC 3ULSB 3FQNA 1SYSA 5DD5L 1AD0A 1XHHA 1ACXA 4KX7A 1D5RA 3MFFA 1U0QA 1J0KA 3GKWL 3SE3C 1BZEA 2XZCL 3T0DA 1OCZB 4UQ2A 1OAZL 4HCIA 3STLB 3ZT6A 4AH2A 4RQQA 2YD6A 1SQMA 5AD0B 1J10A 1XBRA 4WHYH 3GLAA 4YQXH 2GK0B 2Y1VA 4H8QA 1AZVA 1CFNB 3FT9A 4KVCH 4LCIH 3BUBA 4FGMA 3P4NA 3LSOA 3ZE0B 1TOXA 2QPEB 3BZFA 3G5VB 3BIKB 3L4TA 5DRZA 3CVIH 2YD5A 2NYZA 4HLZH 3TA4D 1SLWA 2CGRH 1S8DA 3KLQA 1KCVH 3SDXF 2K8MA 3S88L 1RUQL 1OAXL 5DYOB 1T1ZA 3JWOC 1BXXA 2B1AH 3K81A 4JFOA 4P99A 4XP4L 2WUCL 3BI9X 3C5SB 1P1VA 4JQVA 4PJ9C 3ULSA 3T77B 2GSIA 5HI3D 5E94B 3ZN6A 3B5TA 3O45A 2W88A 5GRUL 2KH2B 3GMMA 3NN8A 5H37G 5LAXA 3A24A 2EIZA 3QSKB 4OKDA 1AXSA 1LVEA 3HLAB 1KCSH 5D7JC 4HAFA 5T3XL 5IMLB 3KPSE 1S7QA 3ROLB 4AH2B 3TEZA 4ZUVB 1OLZA 4B41A 4NKMA 3VXME 1DEEA 2QTVA 3FUMA 3T1FA 1HKLL 5C0RL 2R15A 3KNBA 4HOZA 3F04A 4M43L 3FRUB 5JYMA 3BUTA 1PKQA 5LGYA 1IRAY 3H42H 5T1LA 4JL1A 1FUNA 2HJKB 3H7BA 4I88A 4UQIM 3TZVB 5CCGE 2BJMH 3NJXA 3EYSL 3GSXA 3O0RH 3WXVH 3SPVB 3HNVH 1O6SB 4G7VH 3ZUCA 5HP5A 4LSDA 1A6UL 1A3LL 3GJEA 1EO5A 4HUWB 4OIIL 5GJTL 4PJIB 5CFAA 1R3LB 2X1XR 3W9DA 3S34H 1KN2L 3GBDA 4D3CH 4U33A 4BKLA 1G7LA 4I7ZC 3UGEA 1NC2D 1UB5A 3RVWC 4QRTB 5AB0A 4LGRB 2HLAB 3UTQB 3V0HA 4S1DC 3U36A 2OYKA 4E42B 3KGRA 3UBGA 1M3JA 3CVHH 3I02A 2AJ3A 5K33A 3ZZQA 4CSSA 4OD3L 5I18H 1R3IH 5HI5C 4ODTL 4HPYL 3N41F 5L7XH 4LOUC 2ZX5A 3W3BA 3OGCA 3Q1SH 4WK0B 5F7YC 3TA3D 3UTSB 3OM3B 1UUSA 1LO4L 2TSBA 1S7VB 1ZT7B 3UAJA 4R7DB 3P9WB 3VJ6A 1D5XB 3TO4C 4PS3A 2DF3A 5DRWA 2DPKA 1NMBL 1ZVNA 3RWJB 1RPKA 1BDYA 3U6XA 5I8EA 3GSXB 3SQOH 2G5BB 4DERA 1XO8A 5IIEB 1XMWA 4P5KB 1H6UA 2L0DA 3NFPB 4MA1B 4OCRL 5JHLH 3F7LA 3VTTA 2JCCE 3OHXC 1JTTA 2GUOA 3QI9D 1J5CA 1MIMH 3O2DL 3AG3B 1GMEA 4PRID 1D6EA 2QLYA 3N1MC 2IDQA 5LAXB 1QRNA 4DVRH 1QFWI 4YXHH 3BH8A 4Q9CA 1IAIH 4J8QA 1OF2B 3ECBB 2YPKA 5CHNB 4DZ8B 2BIQA 2IJ0C 3HHSB 1GGBL 3FB7B 1EHKB 2XWCA 1A3RH 4XVJH 1K5NA 4C4BA 4LIQL 5MENB 3ZR5A 2VDNL 1Q0YL 3D2UB 5C08B 2WM0A 4KJQC 4GEIA 3O9WC 1DQDH 4NWTH 1NLBH 2MNWA 3B9DA 4GQPH 1A4KA 5IB2B 4JRYD 4MA7L 1ZLVH 2EXWD 1MCHA 4AGQA 4FNSA 1JGVH 2N7BA 1OEZW 2DMCA 1XBDA 1FVEA 2EYSB 3G5ZB 4FXKC 4G6AC 5F9OH 4GAYB 3U0TB 2Y06H 2HX7A 1NGYA 4N0YH 3NQIA 4A2FA 3ZZLA 4UB0L 2KPNA 4JCLA 3IGKA 3BKYL 1HOCB 1T3FA 1CR9L 3AADB 5JQIB 4Z5RA 1G7QB 2ZOTA 3CU1A 4NRZB 5IB5A 5GRJL 1MXGA 4X80L 4EIZC 5GRWA 1I8LC 1S7UA 5E8PA 3D07A 3JV5A 1YUKB 3UZVA 2GABA 4P46C 3KYAA 5IW1B 1VPOH 1F58L 2BVQB 3RWHB 2EIDA 5F7DB 1SJEA 1SM3H 4M00A 1YSOA 4ZMPA 1PEZA 4MASA 2G3ZA 5CZXC 3DXAB 3FYEB 4MX7B 2X7LB 1UM6H 2JQZA 3TCTA 1D7BA 1TXKA 2W95A 2JSFA 1ZLUK 3KWTA 5DI8A 4F37F 5I28A 4HWEH 3WN5A 1IBZA 1EGJH 4K4KA 2QSCH 2GTQA 3LRHA 2JF1A 1HOEA 3DJZA 4RZCA 4P9HC 3ARFA 4XB3A 3QO0A 5AOMA 2ZT9C 1FFOA 3M6DA 3PGCA 3GMOA 1IC7L 2VDMH 8PAZA 5E4EC 4M5ZL 1R0AH 2Z65C 3L1GA 3HG1B 3QA3B 1T7YA 1YQVH 5LXGL 1SXZA 1F3RB 3ZQWA 1PAMA 1PLCA 4AQOA 3FT4A 3RVUD 2A0LD 3I9AA 2Y7QA 3IDXL 3NCEB 4N26A 5CLYA 5KZCD 1RFDH 1F4HA 1KCKA 3FONB 4PJ8C 3FUFA 4B95C 2PABA 3MCG1 2DLHA 3NFNA 1PY9A 4PGCA 3HNTH 1PW3A 1AE6L 4Y9EA 5D96B 3TZVA 4Z3TA 2ODHA 1UKSA 4Q8BA 1T2QL 4JY4B 1FNEB 5G55A 3ARBD 1BXVA 2O5XL 1NUNB 3HC2A 3WN5B 2ETWA 2AXJA 1PLAA 5C6WH 2F1EA 2YD3A 3V0WL 2QGCA 3P4LA 3D52A 4M7LL 5I74C 4IOSA 3WD5H 3L2LA 1K85A 5DD1L 1I1AB 2FO8A 2WSDA 5E9NA 1A9BA 1EAQA 3ZDZE 3IBEA 5DMKA 4MCYA 3VH8G 3GPEA 5ANHA 2C4FU 3P0VL 5I1JL 1AHWC 2XWRA 4MMYB 1BFOA 5J9PB 1BSIA 1ZGLA 4IGBD 1HZHH 4X4MA 1H3TA 1FC1A 1UH4A 2J6WA 3ISRA 4A67A 4NWTL 1XEUA 3UAJD 2P24B 2EDMA 2G60H 3NA9H 3GRWH 1T7VA 5B38G 3WTWA 1YNLL 2MWCA 1K2DA 2V2XB 5FYJH 4CU7A 4DKDC 2Z34A 1IM9A 3MRKB 2WWKO 2MCMA 3X2QB 2DQCL 3SE8L 3QRGH 1MREL 1P5VB 3DX6A 2WWNA 1D7FA 4KZDL 3HMWL 3GM0A 3DV6B 3DX8B 2AXHA 1CGYA 4N2IA 4AITA 2WUBH 3MRQB 4X9FA 2BXYA 5FYJD 1EBAA 1OT2A 4PG9B 2ZUSA 3S3DB 1HDMA 1HNGA 1W72B 3VXQA 5F88B 1YRKA 1AXTL 1UQSA 3L7EB 3TN0B 3JWNE 3WO3B 5IT2H 1ZS2A 1HHJA 3BWUC 3DOSA 3QNYB 2E4TA 3AQYA 5BV7L 5G2NA 5FDWA 1G6RH 5IHZB 3HHSA 5B22A 4HZ1A 4HHAB 5LNGA 2VXQH 1OT1A 4PLJD 1Z5LB 1A9VA 3TLRA 4E0RA 1UUNA 1INQA 5BRZE 4CKQA 3S8GB 1U2YA 3ZBMA 3B9EA 4JRYA 1ORQA 2UXFA 4BH7A 3DHMA 1RERA 5DD6B 4KJPD 3L3HA 2DWYA 1OAKH 1TITA 3CC1A 5GISH 4NEHB 5ISZD 4RA3A 2VXTL 4MBRA 4XCYB 4Z0BH 5ACZA 4DGVL 1MDTA 2PW1B 2L7EA 1BZ8A 4YPJA 1TZ8A 3C5ZB 3ARZA 5AW0B 3NIFB 4L8BA 4Q7DA 4X9IA 2YR3A 3ZQXA 1WG3A 5ITFA 3IM1A 3UFIA 3DWTA 3BPOC 3T2PA 4EI5D 4N6RA 4PRIA 4YHIA 1YN6A 5F6HJ 3VI3A 1IGCL 1C5BH 4MJIA 4YSCA 1F6AB 3OHXB 5DT1H 4Z23A 4HUWA 4P5TB 1OSPL 2ZOUA 1YY9D 4P4KA 1WEJL 3MLSH 3KYMB 4XMXA 5FKAA 3RWFB 3RQ3A 1F6LL 2ARJB 4FLSA 3CV5A 1X4ZA 2OK0H 1JNHA 1XMEB 5IR1A 2K9UA 4LSRL 4NQDA 4F2EA 3K0YA 3AQXA 2GJ6A 5D70L 3KPSA 2D8KA 2JLLA 3IWVA 4X6EB 3AG2B 2X4RA 3FTSA 2BK8A 1F90L 3RIFF 3DXAA 2V8LA 3EO1B 2W59A 4K7PY 3SGDH 1VENA 2FX7H 3EYFA 1F41A 5MP6L 4FFWD 1TIUA 1IL1A 4PJHA 2YQ2A 2HX8A 2BRRL 5FUCC 4GSUA 4GOSA 1W2KT 3FQWB 5IB4A 1CDBA 1D5MA 5DGQA 1Z3GL 1A4JB 3IFPB 4OBSA 4QGTA 3N42B 5A16A 4ZAKA 5GGUB 2K4WA 4DPBX 2ZUXA 5DO2C 4J2QA 2ZXQA 1Q8MA 3TWYA 1N4XL 4AQEB 5GS1B 3ZKMD 1IEBB 3V0FA 1UQSB 3BSHA 5I1GL 1T66D 3FQXA 3EG9A 1MN4A 1YUHB 2BWIA 4I1RA 5HY9B 2D7QA 2Y5TA 3CQPA 2A9NL 4NP4L 4PRDA 4WO4A 4WSJA 2RH0A 3U0TA 2XHNA 5MENE 2XJLA 3UEZA 3VFOA 3VI4E 1ZA3B 4AW4A 5I1IL 3OJVC 3W38A 2UWEA 5DTFA 5DZJA 2BSTB 3U30C 1A4AA 5D7LA 5K59E 3FOLA 3R1GL 3SJVD 4ZUSA 1JI2A 1KTKE 5K1VA 4ONGH 3BW9B 1GS7A 3MCKA 4Y19D 2HT4C 1BVKB 3IDIB 3VWJC 1WWWX 3PWPB 3SEPA 1UWXH 2WUCH 1DJYA 4K73A 4KROC 3ARFD 2MFNA 3F84A 3T8MA 4JRXB 1CFSB 2V7HB 1QUPA 2RAMA 4AK1A 1GZQB 5IQ9A 1YPZB 3KWUA 1U8CB 4LLAA 4Z7OE 3BGAA 1LO0H 2LT9A 3QIBA 3GSWB 1NLDL 4BRJA 3KBEA 1NBVH 1PIGA 2NRDA 1OGPA 5D7IF 5CSZB 3L1FA 2QPSA 1F4XH 2XETA 1VADB 3E8UL 1XAUA 3NSXA 5DQJA 4GUCA 1RUPL 1MAML 4TVPE 4PJXE 4AQ1B 5D7KE 2HX9A 1DJSA 4GSXA 4B6ZA 2X3CA 1J9TA 3F00A 3D0LB 3OMIB 1FAIH 3T71A 1QLEL 4F2FA 2TAAA 3QCTH 2HJLA 1UACH 5D1ZB 4UT6H 1EAPA 4ORZC 4NKDA 4NN6C 2ZOWA 5DJYB 3MLRH 1ZVSB 5CAYB 4V1DD 5HTSA 1GC1L 5EF3A 4C83B 4N9GA 1A9EA 1RHFA 1QWNA 2E8ZA 2IDUA 3DC0A 1W72H 3LRLA 1IM3D 3BVXA 1DQLL 2F58H 2KZBA 1NOAA 1EO8L 3I9GL 3OKDB 4K94H 5F72S 5B1KA 2FJFA 1NANI 4Y4KD 4KTGA 3VQ2C 3U0WH 2WP3O 1EAPB 4P5TD 2H0JA 2V8MA 3ESUF 3U6RA 5JUEL 1NKRA 5AB9A 4JO5A 5D8JH 1Y7VA 4HPYH 1BQLL 3TGXA 4DGUA 2CR3A 5D5MF 4Y4KA 3D87B 3LIZA 2PCXA 2UZYB 1I7UB 3PDOB 1FBIH 4DNLA 1UA7A 5GHWH 4DT2A 5IQNA 1D5ZA 3F5WA 5FEBA 5LBVA 4M9PA 3NSCA 4S1SL 2OYMA 5KSBE 1TQWA 4N90D 3EHBB 4RFOH 1ZJAA 2XTSA 3HUJA 5DUPL 2OJ1A 1NBYB 3UO1H 5BJTB 4DETA 5E2WH 3ZO0A 5LG6A 3FU6A 3ABZA 2HJKA 1CGVA 2EDKA 4G5AA 3ECUA 3NGBB 1U95A 2F1AA 1U8HB 2PKDA 4V1DB 4FHJA 4U1SA 1W72A 5EA0H 4AL8L 4GSRA 3QB7C 1RXLA 1HHJB 3JV0A 3RUGB 3BKJH 4ACPA 4MZRA 4BKTC 2PPFA 4NFDA 2IALB 1IEAB 2DKSA 3D4GA 5CLTA 4P5SA 4HWUA 1U42A 5IJKA 4PRIE 4OTXH 2WJ7A 2AJYL 5DJAB 3GRBA 1QUNA 4E9LA 3LRSA 5I5JA 1AJ7H 2CU9A 3K6DA 5BPPA 3O8XD 2X42A 3NJHA 3VA6A 3IDNB 2DQFB 1FNLA 5DK0A 5I19H 2KC0A 3FUIA 1LD9B 4YOKA 3B2PA 4UOW1 4EIBA 4NZUL 3V4PH 2OLDA 1XFPA 4UF7C 3UBXI 2Q3XA 4X6BA 3ILEA 4DO4A 4F8QA 3FTXA 4TTDC 4OKVA 4QCIB 1XL6A 2BSSB 4ABQA 2VR9A 4R4FH 4XAKE 1B90A 3QQ9C 3BAEH 3KYNA 3QVAA 3QT2A 5SWZB 1ET7A 1QD0A 3P73A 4ZFGL 4KTYA 1DQJA 2O6CA 1WISA 4ZO7A 3BDYL 4TF4A 4NUPA 3BUDA 3TBSB 1HVXA 5I5RA 4HXBH 4GXUM 4UYPA 1JZ4A 1B4JH 3V7AG 3FFDB 1U36A 2I7SA 2LU5A 5CBAB 1JWSB 2ITDB 2KT6A 1DSFH 4RCAA 2HKHL 5HDBB 2CPUA 5J1SC 1C5CL 4KJYA 5CD5C 1QUNB 4D0CB 4YE0A 2ENJA 4J3OC 1GYUA 3X3GH 2GJ6B 4NNYA 2X4QB 1OOWA 2F7RA 3PGFH 1N5YL 4JQIL 1VEOA 4OVUA 2QT6A 3TS8A 1UXLA 4M1CC 3TTSA 3QDAA 3SGJC 2WC7A 3L54A 1FZJB 4R90L 4H8HA 2NNXA 5MI0B 2W91A 1P5UA 4QD2E 5HDQL 1GGCH 3K46A 4J3OD 2B8OT 2NY3C 4OV5B 2HUHA 4BQCA 4LQFH 2UWEE 5AVZB 1WITA 1SXSA 3E6HB 4WW2A 5HHNA 3TYGH 3UJTH 2NUPB 5DUBB 3GSOA 1IGJA 3RDTA 4H5SB 4GSDL 4LOEA 3SKUD 4LLDA 2FDBP 4KI5F 1C12B 4OLZL 4ZX3A 4UQ3A 2H45A 1XGRA 4AEIH 5I6XC 4J1UB 4FD0A 4PV9B 1L0XA 2X10A 1YLBB 3T0EA 3H3PL 2QKIC 1B0WA 1S9VB 2Q76A 4FJYA 5E6RB 4EUPB 4L8CA 1BIIA 2ZXWB 3GMNA 5EIQA 3L3HB 5LN4A 2OMXB 1OP5H 2EXSA 1IGIH 1WZLA 1DVFC 2J72A 3HFML 4PRNA 1R5IB 3EYOB 4KWUA 1A5FH 1NCOA 3CU7A 1JVLA 3LB6D 5BZDA 4WUUE 3UC0H 5E8NA 5I0ZA 1ZHBA 1OK8A 3DX9B 1JWMB 5JOEA 1QR1A 2J2ZB 2OTWA 3J2PA 3IMVA 5EOCJ 4XP6L 2HRHA 2P42B 4F57H 5DJCB 2DQIL 1U6AH 3VFPB 1Z0NA 3D0LA 3D25B 3BX7C 1AP2A 3QFGA 1F86A 3RZCD 2FLMA 3KG5A 4ZBJA 4YWGL 2F8XC 4JFFD 3VNZA 2MOQA 1P9MA 5T1LB 4N8PA 1NINA 1T5WB 1GOFA 4XHJC 1DANT 3L3GB 4F7TA 2BW4A 4ETQB 1XD1A 2F5AH 1H5BC 3HB3B 1Y6KR 1UURA 3ZDZF 4NP9A 3P30L 3RFRA 2B1HH 4YHPB 2ED9A 4PB9H 3R7RA 3UTSE 3T6ZA 1KLGB 1KN4H 3FUJA 3TN0C 3RHWF 1ZSDB 5F9WB 3F6LA 5IW1A 2NQDA 1QNZH 3FB6A 4CW1A 5DC4B 1HZHL 3MCLH 3QCUL 1LQBC 4HBCH 1W8NA 4NM8L 5D7SH 4PJGE 4TSBH 1GTNA 4QLWA 2ODIA 4LU5L 1OAYH 3P0YH 2XG4B 3D0VB 2ALWA 2QQLL 1L7TL 4LAQL 3X1NA 2LU3A 3F7RA 4WO0A 4ABUA 1R75A 4JFFB 4HT1L 4OZGF 2UX6A 3LIUA 3MV7A 4O02L 2HKFH 4JN1L 1K6QL 1CMOA 2CO4A 2A6IB 5J5EA 5CIPA 2DQJL 3SCMD 3H85A 2AJVL 4FNLL 4WI4A 1XR9B 3BYYA 3OMAB 2E9JA 3TVMD 4OJYA 3RNKA 4EF3A 4NHUB 3O6KH 2W8CA 3IFOB 2F7OA 4OZHE 2PPEA 1P7KB 5KW9L 1RUKH 4PLKD 4W9IC 2GJ6D 5IOKA 3SQBB 5L2KE 1E30A 4FERA 4XNBA 3TBCA 3ABLB 5SWZD 5JPMA 1SUJA 3BEWB 4WAFA 4YEEA 3IGLA 2WXIA 1HHGB 2XZAL 4HX1B 3NEXA 3NFNB 3JZ7A 2ZF9A 3FB6B 1Q38A 1G7HA 3ZE2F 5AW9B 1JPFB 1DBJH 2YPKB 2FBOJ 3D4CA 4HEPG 4KKZA 2H32B 3HI6L 4C57C 3CQFA 3L3OA 2APTA 4XPGL 4X7SH 4BFEA 5LCVH 4RMTA 5EWIL 3MU3A 1YMMA 2J56A 2VLME 4ZDHA 2IQ9L 2Z4QB 3GF8A 4PYHA 4GQ9H 3SGDI 1IFGA 3GTNA 5BV7C 4KO5A 5TF1H 3W2DL 5IHHA 1UA6H 5JTWA 4YR6B 1JV5A 3MRGA 1NSNH 3QUMB 3T6VA 2ICWI 5HDRA 2W0KA 2GT9A 2R1XB 2XG5B 4TUKH 4G42A 2GTWA 3DROA 3ARDD 1WPCA 3B7SA 3LQZA 2CSPA 2ZJSL 3O8XC 2W9EL 5JXEC 3BGFB 2NT0A 3H4HA 2YAPA 1DZBA 5D2LE 2P5WE 5EIIB 1QSFE 2HFEA 1AMYA 4HJ0C 2AXGB 4IIQC 2GCYB 3ULUF 2A9AA 3IDGB 1JGUH 5DVOA 5FYKD 3WL9B 3H9ZA 3NJGA 4YAQA 2GT9B 2R1XA 4F15C 1CS6A 1PKQB 1NMCB 2NY7L 2WLLB 5ID1A 1Q72H 3ZMNA 4ENEC 2Z1PA 5F2FA 3BO8A 3MJ8B 5AKRA 1S2EA 4OV5A 1GXEA 1M57B 4FQIL 5A6IA 5DQJB 4NUQA 1DCEA 1Q0EA 3RU8H 5INDB 3BEVB 3P3UA 3E2HC 4OZIE 2RFXB 3QC5X 3TCLA 5CUSH 3IJEA 1K8DB 5I18L 5PCYA 1WAAF 2I60H 2BVOA 3PFUA 1F2XK 4QOKE 5AWNL 3NIGB 2V6HA 2JCWA 4F58H 2GI0A 1E9QB 2FYVA 4MB1A 3MRFA 4M8UA 1YEFH 2HFTA 4PG2A 1A1OA 3W39A 5M94B 2O6FA 3QH3A 1IKNA 2AABH 3LZPA 5EORL 1G7MB 1JF6A 4G8AC 4HMEA 2P24A 3MCLL 3QCUH 3BLPX 3EYSH 3O0RL 4GRLC 5A40E 4I0PA 4X6DF 4NFBA 3T2OA 3TU6A 3UZEC 2H26B 4Z3JA 2F18A 5BZZA 3X11B 1TQCC 2TRHA 4DHLA 2HTLC 4F33A 3LS5H 3I74A 4TVPH 4KI5D 4QF1A 3NCYP 2NZ9C 1BBDH 4BFIA 4AYFB 1I8IA 2JNZA 2Z1KA 1BD2E 5I17A 5HYSG 2RCSL 1CDYA 3CFJB 1L9SA 3N40F 1MPAL 1ZCRA 3KMDA 2HAZA 2GITA 4N87A 1CFNA 2I85A 1W15A 2VLRE 4YC2B 4WU5A 4UV4H 5HHMB 5B21A 4HK3N 3WIIH 5B7MA 1FORL 4S10A 1NC4D 1LP9B 2QPDB 3NIFE 1ZA6B 1FFQA 3CUPA 1IC5L 3OTTA 3T3MB 1W0WB 3UOAB 1A4JA 3IFPA 3MRFB 5AVWB 2VN6A 3GSUB 4PSRA 1N2RB 4PBDA 4ZAKB 1NLBL 5L88H 3A22A 2WXRA 2OR9H 2OTWB 2WXHA 3FB7A 4HW6A 4AEHH 2LQRA 2XZQL 2JK5B 4NQEB 4TKWA 4MNGA 1L9TA 1N70A 1QBLH 1S7WA 1DJIA 3FJTA 3QEGH 3MA7B 5CKAA 2WBJB 1WS7A 5TD4A 2YWYA 3MMEA 3JTSB 3X1GA 4OUOA 5J4MA 1CICD 2GFBB 2X1PA 2XBZA 3ARGD 3L3GA 4F7TB 1YEJH 2NY0D 3LEXA 2H3NB 2BP0B 1F1GA 3VE0B 4R8WH 1CD0A 1DJWA 5BO1L 5KBPA 2PYFA 5C08E 1FIEA 1ZWIB 4R0LC 5TGBA 1ZDQA 3LZQA 1S6NA 3RVXC 3GZKA 4WLCA 3FU3A 2VRKA 1S5HA 2X12A 3UG3A 1D9KA 3QQNA 3WBDA 3AW5A 4FQXA 1O75A 4MXWL 1HEZA 4LOVA 4BEIA 2C3HA 4WNQB 2O6PA 1E8YA 5E8NB 3WDIA 1XH0A 5CCJA 1O6SA 4FQJH 5F89B 4Y16B 3WGVB 3UO8B 1GAFL 5F3BA 4JPVL 1I9RH 3OLIA 3PCYA 4KPHH 3KGUA 2Z0UA 4I3RH 2W07B 2WB7A 3NZSA 3ZT5A 4AC4A 1M6OB 4NKIH 5AVVB 4EI5A 1U91B 2X4SB 2J4WH 1ES0A 2N0KA 5EBMB 4C4KO 1WSST 3MQIA 1CLOH 1S9VA 3EYQC 3PAVA 4G9FB 2QADC 1E90A 1CR9H 5HHME 1CICB 1HYSD 4GKNA 1J18A 2X7LA 4ODTH 4OLYL 2F74B 1I31A 4YHOL 4AQ1A 2WWOA 2SODB 3WFEH 2CHXA 3MLZH 5DO2D 5HHNB 4WY7L 2NUPA 1MCDA 3MRJA 3E6FA 1UB6B 3P40A 1T7WA 7FABH 2BH0A 2QQKH 1G84A 3SB3A 4OLVL 1RP9A 4J3OF 1FFTB 3MBEC 5L2JA 1H3WM 2CCLA 4UT9A 2CKBH 5FF6B 3T3MF 4UILH 3BYTA 2FQGA 1J5DA 4U3SB 4BFNA 3N43F 1YDPB 2HMID 2WGNB 3K7UA 3D48R 4LESA 5CZVH 1CE6B 1KTBA 2NXYB 3LTVA 5CKGA 3S5ZA 1HH9B 3QEQD 3PIQA 4N8CL 1SN2A 4X99B 4XNZC 3RWEB 3KLAA 5AAMC 3V6FA 3L5IA 5SWQB 2X9XA 4WSGA 2ZICA 1B4JL 3PJSB 3FOLB 3L5WA 3BP7B 4M6ML 5DD3H 3TONA 4F9LC 1TUPA 3BKYH 1BVLB 5A7BA 1AZCA 5IHBA 2JKJA 1TEGA 4OLXH 2J88L 2GBVA 3MBEA 1X5IA 1KTDB 4UMGA 1NGPL 1FVCB 7TAAA 3IU3B 4K8RD 5TPWH 4LSUH 4TQHA 2J6EL 3GS7A 3QI9A 4GH7B 4X4XA 4Y16D 1QOKA 5CCHE 2A1WL 4KAQH 1FHGA 1O7VA 3JWDL 4I89A 4Y4FA 3D30A 3N50A 3FTYA 5D1XE 3LPGA 4HXAL 1I1FA 1SYSB 5ALCH 5B3NA 4MA7H 5DZLA 3H4FA 1F02I 1X5GA 3QR1A 4R84A 1KYAA 4Z7NB 2FWOB 3LZNA 1FSKB 1IV8A 2J1KA 4Y7MA 3CXDL 4A6YH 3CVHA 5JDSB 1R24A 4TQ8A 3ATAA 2LLGA 3MI6A 5D7IB 3WNLA 1KCUH 1BEYH 3EDJA 4P5RA 2D4FA 1UZ6E 2Q9OA 3UBXG 1DBKL 4PRAB 2O5XH 2G0LA 2FJUB 2RFXA 5T3XE 4YXHL 3NCYS 3F7VA 3O4LD 4FL4C 4ZO9A 1ROWA 3QDMD 1KPRB 3QDJA 5TF0A 3RI5F 1RU9H 4NUJA 1R47A 4IU3B 4MA3B 1TJHH 1LNUA 1A6VH 2HSIA 3QDGA 5EZIL 3CDYA 1RZFH 3T2NH 3QIBC 2JQAA 4KXZI 1JGEB 1TKWB 3P4MB 4HG4J 3H8NA 5IEHA 1TCRB 2YARA 1XIWC 4WUUB 4BFFA 5IK3B 3QHZH 2R39A 3BVUA 1A6TB 1EAJA 2JB5L 3SKNA 3HRPA 1VZIA 2YO3A 2B4CC 5CWSA 3V4VL 1LNUB 4A6YA 5C07D 2VQTA 3F01A 1HEJC 3MV7E 3RWIA 2OL3A 3T09A 1MF2L 5DSCA 4AENA 2ZCLH 1CT8B 3OKDA 4UT6A 3C5XA 3OAWA 1EEZA 4WGWB 15C8L 4BWWA 1ZGLP 2A74B 3ML9A 5KSUB 4XMTA 2JI1A 3UEQA 4K94C 4TTGA 2QGDA 4YBQD 1RK1A 4FN0A 3VXSB 5F70A 3RBSA 4X6DE 5BOJA 4JDVB 5C2BH 1DHKA 3EUDA 1KGUA 3P2DA 1OAJA 4ABWA 4MXWH 3WKPA 2J5WA 1M05B 4X6CF 4JFOB 1MEXL 4YJZL 5C0CE 4MSWB 3MRQA 2FJGB 3MLWH 5E99L 3FFCE 3ULVL 2WINA 5DRXA 3X12A 2J8UB 3N9GH 1HDMB 1U3YA 1UWEH 2AJSH 5AUMA 3NJJA 4HUNB 5GGQH 4XVOA 4ZYKB 3CZEA 1WAAE 5CSGA 3MR9A 3APMA 4R2GD 4AOFA 4OZ4A 1LK3H 3EJRA 4M3JA 5E6YA 2OSWA 3L9RB 1IKFL 3L4WA 3ZJAA 4DEPB 1MRCH 4POZD 3PXHA 1ZANL 3BESR 4GXVH 4HMCA 5DC2A 3VXPA 2Z7YA 3EYUH 5D4HA 4P2RD 3WUZA 5FC9A 2CRMA 5HYJE 1MVFA 4OIFA 1OP9A 2E7CA 3KYNB 5B7FA 4PJFF 2R2CA 3STLA 5DZAA 5IF0B 4F2MB 2AANA 5ETUB 3FTVA 2GB2A 1O9WA 1QBML 1AXTH 4QY8A 3HE6D 4JO3L 3CDCA 1YMHA 3DX7B 4GKOA 2W80C 4KMTL 2WZPD 3RVWD 1KSRA 5A1AA 1T83C 2OJEA 4OJFL 1CVSC 5L0QB 5D4JA 5FYLL 4MJIE 4LGSB 3P4NB 5EMYA 3VFWA 2VDLH 3MPCA 4LASH 4DAGL 2AP2A 1FVDA 1GSMA 4OY9A 3AB0B 2BVOB 3INOA 3KPRB 4Y1AA 3RGBA 5FWQA 3FH8A 4N8CH 2A9NH 4OGQC 4A2LA 5JHLA 3QFJB 5GRZA 1QRNB 2RCSH 3HNTL 4AV0A 5BCAA 1WFJA 4J28A 5DD3L 4XAWL 4E41D 4L2YA 1YNLH 4J3BA 1IEAA 1N6QL 1QBBA 1JNHB 3DXAE 2LFEA 1JNLL 4HJJH 5JPNC 3SN6N 2NYYC 4RIRA 4YXLH 4JG0L 2QMJA 4IBSA 1KJ2H 3FTZA 2A4EA 5KSUA 4XPHL 2YUXA 4FMFA 5I1JH 2P9RA 3JWOL 5HHOA 4MDJB 2H0PA 3SKOA 5E23A 4IU2B 4GAGH 2Q86B 3R0MA 2YOCA 1IL1B 4QHNB 1QSFB 2Q8BL 1KIRB 5DJDA 5BS0A 2XXMB 3HPLA 5IHUL 3ZE2B 2CBOA 3ZTNH 1MFAH 2DQUH 4APQA 1OSYA 1JBJA 1F3JA 3LDBC 4RGOH 5C8JB 1T7ZA 5FW7A 4EI5B 1P5UC 1WZMA 2YD0A 4YHOH 3KLSA 1NCAH 3QIUA 3TV8A 5EBMA 4XRCB 3MV8B 2VITA 3ILPA 2VRAA 3HG5A 3TT1L 3D3VE 5KSAA 1A6WL 4UQ3B 4A2DA 5I76B 1CF8L 4YX2H 2MCAA 3P3SA 1D9KC 1N12A 4I13B 4ZMYA 1PMYA 3RGVC 1X9RA 1NICA 1LWJA 3H3KA 3HC0A 2NR6D 5EZIH 1LDPL 2JKSA 1WV7T 3KL5A 4XVSH 3T3PF 5FCUH 1D9KB 3V0VA 4FABH 4XNQA 2WQWA 5E6UB 3B2VH 4HQQL 3MRHB 2BNRB 4D0DB 2RR3A 5C0IA 1MI5B 2OBGA 1A7PL 1JPFA 3VGDA 3ZHKA 3TBWA 3UPCA 1JZ2A 4MA3A 5D5MB 5DQ9B 2YRLA 1EZSA 1ZD6A 1P5UB 4N1EA 1HH6A 2Z91A 3VG9B 2AJUH 4X6DB 3LEXB 2JKRM 5KANG 1M2VB 3S5LG 3CVHB 2ICES 4RGNB 5LQBL 2YAEA 4HUCA 2ZCZA 1GZQA 4NRZA 2BIOA 2NY1C 3EDKA 2HWZL 4X0KB 4ZMNA 3UGXA 1YNKH 1LM8V 1U9KA 4HXBL 4HUMB 3C9NB 1G7HB 4JFFE 2EDLA 3B2UD 4LVHB 4FTVB 4ACTA 2F53A 3EH3B 5T33L 1CFQA 1J1PH 4KKBC 4GAAA 4GAYA 4GMTL 4OZIF 1D6VH 3MGAA 3S36X 2FIKB 4OM1L 5BQ7B 1CLZH 2F54E 3P3YA 2W9DH 1F11A 2P45B 4JFEE 1ORSA 4U2YA 5IZ7A 3GHEH 1NIAA 1JZJA 5AVUB 1MHCA 2VE6A 1ZY9A 3TIEB 1G9EA 5I9QB 3MXWL 3I6SA 3MJ6A 1FLTX 1X5JA 1NCTA 3ORJA 4P3WA 1RPUA 1GCFA 4X7TA 2AJYH 5KS9B 5E6ZA 3JWNG 1BW8A 4JZJB 4OFDA 1SFHA 1KXVC 2ZP0T 2YN3A 5T3XD 2Y07H 3Q13A 3FUKA 4PS8A 3HNSH 4OTXL 5BRPA 1N0XH 2CMRH 4WHTB 2JJVA 1OB0A 2DWEB 3I84A 2FX8L 4ETQA 1HINL 5CEZH 2DH3A 1SEQH 1Q1PA 4L37B 1FZKA 4MCZA 5I1HL 1ASOA 4YAQB 1S78D 3VXSA 3MNVA 1ETZA 5HI4C 2R0KL 4LKXA 3ASWA 4RDBA 5CZRA 4M29A 2D7OA 5E5MA 1TJGL 5C6TL 5AKVA 1MFEH 1UEYA 4QGYA 4JQIA 3L2MA 4KC3B 2VXUH 5CSBA 3A23A 3KPRE 2QZQA 4NENA 2W5PA 1FJ1A 3QJXA 2D3NA 1CFVL 4EEEA 2BZ7A 3L95A 2GEEA 3T5WA 1B4LA 2XKUA 2ZKHH 4S11A 1RURL 1XCTA 4HS8L 5SV4A 3V55A 1ZS8A 5CILH 2H1PL 5DSCB 4UANA 3T0VA 3FO9A 4ZOBA 4WNSA 1GY1A 1ACYL 3LH9A 1CD9B 5B1BB 4OI8A 4X4YA 2JV6A 3OJDA 4LLYB 2FSEA 5JXEA 4Q6IA 3D7PA 5ICYA 4I2XE 3RAJL 4NC2B 4QRTA 4OZIB 2VZTA 5HDQH 1F97A 1L9PA 1D5IL 3RKDD 3TYGL 1ZS8B 1DBML 2F61A 4HSCX 3WNJA 4PRBB 1TO5A 2WN3A 5HGGS 1XDQA 1IJ9A 1HIMH 3F3HA 5JPMB 1GCYA 3MRNB 4KK6D 4OF3A 4YDIH 2ZKYA 2BS9A 4XNXH 2EKJA 3L3JB 2HT2D 4LKCA 1XGPB 2W0FA 1OTSC 1SF5A 5FUZL 2VDLL 4LASL 3B6SB 5DJXA 4BUHA 5LWYH 3RUGE 4IRJA 1RH8A 3VQMA 2CA3A 4RSYA 1RMFH 1K72A 1QWUA 1YC7A 4G72B 4TRPL 2K8QA 1B9KA 1KIRA 2V9QA 3C12A 3F12B 5FUCE 1H15B 2E75C 2FB4H 1E4JA 2UZIH 3TH4T 1BMGA 3U0PB 4Y2NA 4YBQC 4RH4A 3OB0K 2BNRD 2EE9A