2A9DA

Crystal structure of recombinant chicken sulfite oxidase with arg at residue 161
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
369
Chain Sequence
b'DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase
molecule tags Oxidoreductase
source organism Gallus gallus
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
total genus 94
structure length 369
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9dA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9dA01
2A9AA 2BLFA 2BIIA 4PW3A 1SOXA 2BPBA 3R18A 2XTSA 2A99A 2CA4A 2CA3A 2C9XA 2A9CA 2BIHA 1XDQA 2A9BA 1XDYA 3R19A 3HBPA 4PW9A 1OGPA 3HBGA 3HC2A 2A9DA 3HBQA
chains in the Genus database with same CATH superfamily
4NQQA 1IAII 4TM9A 4Y1AD 1E90A 1G9HA 3AS2A 2EYSA 3ZTDC 4F5CA 1UOLA 4GXUN 3IN2A 1YEFH 2P5WA 5F0JB 5FYJE 3VI4E 1UB6A 3TA3A 1TMCB 1TZOA 1U8LB 3II3A 1DTUA 4FQLL 4Y5VA 3ESPA 1TTUA 1TZHB 4U6VH 3V79C 3ALXA 3N0PB 4PWJA 1E5ZA 2ZPKL 1FZMA 4EJ1C 4NRXB 1A3ZA 4Y4KD 2F54B 3CFNA 4H25A 1BF5A 4KC3B 2WZ6A 2C7UB 4R9HA 5GS3A 5F1IB 1RP9A 4HJ1A 4RGNB 4NDMB 3G5ZB 2LLNA 2NR6D 4UNIA 4YPGB 3RVVD 3MV8B 3KPPA 4JRYA 4W6XB 4RNRB 5CCGE 4RMUA 1HWGB 4YHOH 3GMQB 3NZUA 4MA3A 1TZHA 1S78C 1S7QA 3T2NL 3LZQA 4O9HH 4OLEA 1KBBA 4YSPA 1R3HA 3V6ZB 4DP6X 5HHQB 3X3GL 4LNRA 4RWHA 1RZGA 4E0RA 3CDZA 3ZHDA 4NDMA 2WNGA 3HFML 1S8DA 4KMTH 4TUKH 1HAUA 2W9EL 1O7SA 3BVXA 1NCWL 3N1GC 3U7WL 4KX8A 1AI1H 4U1GB 5EOTB 2VLME 3P0VH 5JUEL 3ZXAC 4JLRA 1E4WH 1TG8A 4Q14A 1S9WB 2IGTA 3DVFA 5DJZA 5BV7C 4KFZC 5CJOL 2GSMB 4PYGA 4QXTA 4HAKA 1KSRA 3PF2A 5D1ZB 3DUHA 4LOUD 3UAFA 1B0RA 5CCKL 3BDBA 4YHIB 4BFRA 1XL6A 3SJVA 2JF1A 1FC1A 3A6CH 1W6LA 2CIKB 1CLYL 3T3MF 5B4MD 5C9KA 2VH5L 1KWKA 3B56A 4O2FB 1WIPA 4FQPA 5DJZB 3UBFA 2YQ3A 4KKLD 1RIUH 5LAXB 5EZJA 4M93C 4ALAC 1J05A 3D2UB 4TLSA 2H3NA 1HHGB 2EEXA 5DDHA 5CKAA 2X38A 4B6ZA 1ZHKA 4H2AA 1RIVL 3DLQR 1C7TA 4OUUA 1YHPA 5I9QB 5GRJH 4LOEA 2WBJD 4KZDL 3TU6A 1T20A 4JDVB 1H8SA 5E6IC 4AYGA 4Z0XB 2R1XA 4PJCE 2WXMA 2E59A 5LAXA 3HMXL 4PJDA 1J05B 2ICEC 4ONGH 4P3DB 5DDHB 3IU4H 4JRLA 1TJGL 3UGUA 4LCIH 3U1SL 1ED3B 1ZANL 3MRNA 4K73A 2RALA 4Z76A 1BAGA 1QUPA 3GSVB 2PYFA 5D8JL 2WYIA 4NZJA 3VYNA 2ARWA 5E8OA 1MHCB 1FORH 3GYRA 4HHWA 4P8QA 3C60A 3QDGA 3FQNA 4OCMC 1IEHA 3BRFA 3VQ2C 1UG9A 3DX2A 1ZLWK 1E27B 1UA7A 3EYUH 4KY1H 3F64A 2LVEA 1JZ4A 2XFGB 3DIFB 4RAHA 2YXMA 5GRJL 4E9TA 4KROC 1HJCA 3BSGA 2FBJH 4P3DA 2QGEA 2XN9D 2BW5A 3QA3A 4OAWA 4Z3EA 2XI9A 2BCKB 1F4XL 4X5XB 4WNQB 3LQAC 4NXKA 1E8ZA 1E9OB 1QFWH 4HEPA 3PS6A 1D5BA 3VDCA 3IYLW 3RPBA 1OL0A 5FO9A 1BFVH 2VMEA 4F24A 3MJ6A 1FGVL 5ANMB 4RRPM 4KV5E 3A6OA 4MNHA 5DRWB 4BQCA 3EH1A 5ICYB 5AUMB 4MD4A 3ZIMA 2ZYRA 1BOGB 3NJGA 4YXHL 1MIEH 3W3BA 5DMKA 1CYXA 2OMWB 3NQKA 4M03A 1X5AA 3QZWG 5DD3L 2OL3H 1L0PA 3ZHKA 4YDVA 1TEGA 4X5XA 2AXFB 5DTFA 3V5HB 5B39A 3G3LA 1A2YB 3D06A 4PRIB 2BZ7A 2AKRA 3CSYA 1KYUA 4U2YA 5TQ0L 1N6UA 1HHKB 2LOEA 2VZUA 1JZJA 3FQUA 3FB5B 2OJZL 4MNHB 5AVVB 1BD2E 2GJZA 2VL5B 4G9FE 1NDGB 1NL0L 1XSOA 3B83A 4CMHB 1E6JH 1U6AH 4CL7A 1VZIA 3O6KL 5DC9B 1A02N 3AG2B 3FCTA 3F7QA 2GSGA 4FFWC 4EZKA 5KBLA 1N5AA 4MTMA 4NJAH 4NUJB 4N90E 5EUOA 1A4CA 3M7OA 1YYLH 2OMVB 3TNMA 4IRJA 2IQ9L 3ZY7A 1XH3B 2VN6A 3CIQA 1MAML 3W0WD 1A2YA 4PRIA 2P5EB 2AKRB 3FSVA 5AAMC 3N04A 2O5XL 3FQUB 3L95A 1BGXL 1BYOA 5D1QE 4ZO8A 3BGFB 1OP5H 3ULVH 5INCA 1H3TA 2CRIA 2ZXGA 5J7CC 2FRGP 5CS7A 4YXKH 3HHRB 2BIQA 1FFNB 2CD0A 4XHJC 2C9UA 4XT1C 5E4EC 5CLTA 4CVXB 1WSST 1XCXA 3BVWA 1UCBL 2XZQL 5K39A 5HP5A 2GTQA 2HXAA 4FFTA 1ZMYA 5CJ8A 3HC3H 3ESVF 3DKHA 4QDGA 4EN3C 3RB5A 1AZUA 5DF0A 4P4RA 5IY5B 4PP2A 2GJJA 3KH3A 4L1HA 4WI6A 4KKPA 3HG1E 3JWNC 1FRGH 5B7EA 1RJLB 4WHYG 5HD8C 5I1IH 4UNTA 1I75A 4OFIA 1A3QA 4H26B 1KLGA 1ZAGA 3L3DA 5HHOB 2AITA 2G5BA 1CDCA 3BIAX 1TTFA 4H20H 4HJJL 4HC1H 4MQXD 4NQXA 1W8EA 5KANI 3BT2H 4RDBA 3BO8A 5IKCB 1PIGA 3LRSB 1SYVB 3KEHA 4JY6A 5K9KB 2FL5A 3EBIA 4N2LA 3VFSA 3SDCA 3PWPB 1U8NA 1A6WH 3AG3B 3UG4A 1E4WL 4I2XE 4XNXH 3QE5A 1WZ1L 4H1LB 1RJLA 4XO9A 3M88A 1EFXB 4JZJA 1TCMA 4R0LA 4MAYB 5HDQL 4YHNA 3V0HA 3V9FA 3AU1A 1WGVA 3LKRA 1J9TA 2BY1A 4N8UA 5ILTL 3ZMEA 4MHHG 1PDKB 3BP5B 5F3HB 5FGRA 1FZJB 3BWUC 3B37A 5C0DB 4W9EC 2J2ZA 4WO4D 3L2MA 3VFSB 2EDKA 3EXLA 5F88A 5K5YA 1L9NA 1M6UA 3KPOA 4Y8DC 4HFWA 5KVFH 1BX2A 4YDIH 2YK1L 4QEGA 1L0QA 1E43A 1E3XA 2XFXB 2PXYC 1I9EA 2XN0A 5LN8A 2CRYA 4G6ML 4MS8C 3WS3B 4MBOA 3S5YA 4FULA 3D18B 1THAA 2YGNA 3F3HA 2GY7B 3SD2A 3ARFC 2J2ZB 4WSJA 4KZDH 3ARDB 4GRLB 1I8UA 5F7BA 2H1XA 5F88B 3BQUD 2VLKD 1FZKA 1BM3L 3C6LC 1DJSA 5DQJB 3EGXA 1N64H 3NQIA 2WVVB 4GQRA 1CF1A 2R0WL 2APXA 3LQZA 2WWKO 2ICCA 5EBLA 3HNTH 4BK5A 1B3JA 1Y0LA 1GZPB 5AD0A 4HH9B 1B4RA 2B14A 5KSVA 1KCKA 4RSYA 1V10A 1E5CA 4YIQB 2JQZA 2F5AL 1G9MH 2SEBB 3LMJL 1VCBC 2MOQA 1T1WB 1ET8A 4RAUA 2XBTA 1G7JA 5A6MA 2J88L 2YPLA 3TP4A 1KFGA 5CEZL 2UXVA 1WWAX 4LLYB 1IC7H 1RUQL 2PR4H 4PG9A 5GGRY 1QRND 1HKFA 3CDFA 1C5CH 5KBNC 4KGLA 3IXTA 4LPUA 2V33A 5MENE 1BF2A 4Y1TA 5IG7B 4GH7B 3FFOA 1KBKA 1MOEA 4UBDC 1UKSA 1MW1A 5GRVK 4JRWA 1N64L 3VXOA 1BEYL 5DJ0B 3DX9A 4L8BB 1TR7A 4BA0A 5KVEH 4KO6A 1NFDA 5GS2H 5GGQL 3MACL 1IT9L 4BCYA 2XX0A 5IT2H 1NEUA 3FQ1A 2XWJB 2F18A 3RVUD 5E94A 4CN1A 4M6ML 2Q8BH 1PZSA 4ONHB 5CP7A 3CX5K 3EHBC 2YQ2A 2V0AA 4JPSA 2X4QB 4YWGL 4E9RA 5CEZH 2W38A 2QR0B 2G75B 4MZIA 3DPDA 3DYOA 5DJ0A 3EJTA 2GK0A 3OLIA 3ZN6A 4EN3D 2QV2A 3ISRA 2E6QA 5DS1A 4KTDL 5E4AA 2VYRE 5AZ2L 2JKJA 4XPTL 4NOFA 4P46A 2XXFA 3GMLB 4M93B 4PB9H 3APFA 4LNVA 4URTB 1NDMB 1S5IL 3PFQA 5C09D 4TUJB 4CADB 1QQDB 3I84A 2AMUA 4GW4B 4LSVL 3T4YB 1FNGB 2AEPH 4GG6E 3BLPX 4U0RB 1ZEAH 4U6HB 1G5GA 1SHXA 2LLLA 4A2GA 5JW5B 1QSED 2CXKA 3ENEA 2R29H 1MIEL 2AQNA 5JW4R 1BZ9B 5SWSB 5DT1L 4BFGA 2HTLD 1X5GA 3WG7B 5AG9A 4FL4B 3N55A 4ZTPH 4Q0XL 4HPOH 2E74C 5CLXA 2A38A 1YPZB 2AJ3A 4IDLA 1YEDA 5EBWA 1KCSL 4N2FA 2X4OA 4FG4A 5ERWB 1CLOL 3NABL 5AYTA 1ZA3A 3QHZH 1ZLDA 3SO3B 1SXZA 4ZMQA 2QZQA 3TM6A 3X1EA 2PO6B 4OD1L 3SPGA 3I85A 4AT6B 3TURA 4AQ8A 4FFZA 3S37X 32C2A 1CFTA 1PFCA 5EO1B 3QQ3A 2AQTA 1I7RB 2IAMD 5AOMA 4HWBH 1S9VB 2PCYA 3VRJA 3L7EA 4LCWE 3BWUF 4Y4FC 1S5HA 2D8KA 5F0MB 2IXQB 3MJ8B 5EWIL 4OD2A 4GY4A 3VXNB 5D7LA 3NFSL 2FEEI 4IBUA 3SB3A 4EDWL 4R90L 4JFED 4P2RB 3V4LA 4DTGH 3L9BA 2GVYA 1RLBA 3D4ZA 3L5XL 4ADJA 4AE1A 4LEOA 5HJ3A 4QRRB 3WKPA 5BW7C 4TLUA 3IWUA 4XP6L 3V4VL 1DUZB 4X7CC 3T2OA 2Z1KA 1NAMH 4LOFA 4KJQC 2DM4A 3V6OE 4GBXC 5BS0B 5L8LB 4YXLH 3GKWL 3MCG1 5EF3A 4BZ1H 2VLJA 4O2EB 2CALA 3ELAT 4UOW0 5EZIL 4LBEA 1OHQA 5D7LB 4BUGA 1JHLH 3OLEA 1NZRA 2DH2A 2A4EA 1A22B 2EECA 4IBQA 4XP4H 2E9IA 3VGHA 3S35X 2ZTBA 3ZKMC 4TLTA 5LXGL 2A7BA 3AXLB 5LCVH 2APTA 2OR9L 3HE7D 1NTDA 4BZYA 1FNLA 5DEGB 3UH8A 4QTIL 5A2KH 3AT8A 4J23A 4UU9B 5IB5B 1SOQA 2WGXA 4TQHA 2NZ1A 1LK3H 4ZO9A 4LCYB 1ULVA 1E7UA 3L9YA 3QCVH 5ITBH 1KEML 2FBRA 1JZ6A 4AQZA 1JYVA 1LDPH 2X44D 4JHBA 4RRPA 3MBED 2BP3A 1A7QH 1KXQA 4FQ1H 5HHMB 3WFZA 1L7TL 1UKQA 1EZVX 1KXTA 3GBML 2WNXA 3QZOA 4P2RE 3RAJL 1YNKH 1WAPA 1ODAA 3QCTL 3KNBB 5EU7E 1S7TA 2OMXA 4JX0A 2BK8A 5BOZG 2X89D 4HEME 1ID5I 1MIMH 4FMVA 2JB6B 4JVPA 4KGJA 2JI1A 3GF8A 3O81A 1I7ZA 2ZG3A 4HFUH 4TQEH 5FGCE 1A7NH 2PWDA 2PR4L 1HHHA 5DLMH 5KSBB 4YDNA 1SHMA 1TSRA 3RY6A 3D85A 3PHOA 2EIBA 3SBWC 1Y18B 2R9HC 5KN5B 3BAEH 4DGVH 3TO2B 3O8XB 4BK8A 1RL1A 1TFHA 2AMGA 4OCRL 1N3NB 1GYWA 2IPTH 4U4IA 3VXQB 4GIAA 4N2GA 3X12B 4QKTA 4WJKB 5T1JA 1W0VA 3OKDA 2OXHA 3SD5A 5D55A 1HZHH 4IU2B 1P6FA 3GK8L 3RFZA 2OW6A 4BSVA 2O5ZH 5HYQA 4P04A 3AACA 2R4RL 3JWOL 4J3OC 1ROCA 4EF3A 3RVWC 2E7LA 3EOAB 3UBXA 2H32A 4ANWA 4L0ZA 4EQ3A 3HRZC 3D69B 2EQDA 3QIUA 2Q0ZX 4N9GA 3UBXI 4MJ6A 2P4AB 3GBDA 3MROB 3ZYIA 2GQHA 3ARGB 4QWWC 4PJHF 1I9RH 1HC1A 3C8KB 1I9JL 5ICXA 3JTSA 3O6FA 1JGIA 2L7EA 2VXQL 3HG1D 4FYRA 1N8ZB 2YPKB 4JGJA 2VR5A 4QTHB 2UXFA 3QUMA 4PJ8D 3WYRA 1XIWD 4HP5A 3GMNA 5M7QA 3UBXG 1U41A 3CN3A 2P5WE 5F0LB 3EUUA 4HCRA 3GBEA 1Y1UA 4JN1L 2B1AH 5F1SA 5F6HJ 5HGAA 4A63A 5HYJD 2OI9B 5ID0B 3MROA 4XXCC 1C16A 2LAGB 4L29B 4ISVB 5D4IA 4YSAA 3I75B 4H2CA 3US0A 2LFGA 4LHUB 1RIVH 4JDEA 5HYIA 4DJMA 1DBBL 5EN2A 8FABA 3B2VL 3UTSB 2YLKA 4JQIH 1NICA 1OOWA 1O5DT 4Y7MA 5C0BE 3BE1L 4NAJA 1DQLH 2HKHL 3P30H 4JO1L 4A2HA 4ANXA 2GSIB 5E8PA 3RVXC 2C4XA 3TVMC 3CZJA 3LKSA 4HW6A 4HA1A 1LEKA 2PWGA 4K7FB 1LWHA 1CI3M 1H19A 2WINA 2K9FB 3N6YA 3IDMA 3SGEH 4X8GA 3RDTD 3U1SH 5C0JB 1GZQB 1QSVA 4HGWB 1MVUB 4WTQA 4A7SA 4CN4A 1PKQE 4G11A 1SEBB 3UZEA 3BLBA 4NM8L 2IAMA 1XGTB 2AQRA 2VWEE 4MWFB 4RISH 4PJEA 3SPCA 2NXYD 1CT8B 1L9MA 1JZFA 2ZUSA 4XXDB 1AR1C 4LVNB 3LKQB 3CVIL 4QHPA 4BEIA 3TA3B 2NX5B 3OB0K 2EZ0C 2Q2LA 4Y5VB 2EC9T 2VW6A 4XPGH 5KYNA 3MRMB 3I9AA 2WK2A 2DAVA 5I1EL 2IBZY 2D7TH 3B3IA 3T1FB 1FZMB 1T7WA 4ELMB 1KNOB 2AGJL 3IMTA 3OG4B 3PPSA 2ZXBA 4RVBA 4UM8B 4Y88A 2QQQA 5I74B 1SEBA 5JHLH 1ADQA 3DO7A 4M3KB 1JGLL 2AF2A 2CMRL 1Y6KR 4LLWB 1I1FB 1RZ8B 2FIKA 2ITCA 3FO9A 2OX5A 2DEXX 3VFPA 1CICC 3QPXL 2B1HH 5AOIA 3NSFA 1IFHH 4N2OA 3ZTNL 4WF7A 4WO0A 2W88A 4X7TB 3AT9A 5GGRA 2QSTA 5HDBE 1S7QB 3IPFA 4ZQTA 3R4RA 2XWRA 4PWGA 3T71A 4MA1C 3QDME 2EYTB 3VI3E 3IDJA 4G9FD 2DKUA 4X7FC 4E5XA 4FFZL 3FL7A 1EHKB 4E0RB 1U8IA 4I4WB 2VSCA 3NSXA 5C6WH 1I1FA 4N0YH 3PCYA 4G70B 4XNZC 2GBVA 1MH5B 3OJ2C 3ZKQD 3T65A 3AM8C 2F8XC 2Q3ZA 1Q9KB 4NBYB 4XOEA 5B38G 4G6AD 1G9NC 4M1DH 1E8XA 1EIBA 4NCC2 5E1AA 1E8WA 1AGDB 5DWUH 4RMSA 1OARH 4ES9A 1OAZL 4ENED 2FYYA 1GJUA 5D2LE 5SX4H 5FUZL 3VXSD 3ILEA 5D1ZC 1W6WA 2ZX8A 4UTBA 1A7RH 1HT6A 1HCZA 1JWMB 3ZZ1A 3VDAA 2X4RB 3NP4A 1LDPL 3QNXB 4YE4H 3PGFL 5AW2B 4WTXA 1FWXA 3KPNA 4NRZA 3MTXA 5B8CB 5CLWA 4LQFL 3T65B 3EYQD 3ULVE 4NQCA 5ALBL 3GXUB 1R0AL 4Y5YA 1XTMA 4N0CD 1MJ7L 4MAYD 5TDPB 3S35H 5HBBA 3AZUA 5EIVA 4LLUB 4PY8I 3UTSE 1JRHL 1NCCL 2BOCB 4K3DL 2PO6C 1HHGA 4NXSA 5DMGC 5IESL 3ZKND 1JCVA 1ITCA 1NPNA 3RUGF 4IIQA 2XG4A 4NYLA 4FKHA 3UBHA 3GMMA 4WHCA 5HVGB 3UZVB 3K2UL 2DEWX 4XNDA 4HFUL 4TQEL 5I9QC 3B9AA 4IOFD 3Q8BA 2JH2A 2YMXL 5DLML 1Z66A 2GHWB 4XPBL 4Y5YB 1RJCA 3GLAA 4LHJB 2BWDA 1LILA 2GW5A 3OJDA 3LY6A 3U6XS 3L9EA 4PAZA 5CEYB 3VRIB 3WFBL 1JZIA 3AU0A 1ETZA 5JW4M 1OT4A 1WPCA 2XQYA 4I18A 4JFUA 3V7AG 2VQ4A 4FA7B 4QLWA 4IOIA 4QRTA 2VR9A 1M1XB 3CVHB 3FO2B 4M7ZC 1RULH 1RERA 4Y1SA 5FYKH 2QKIB 1PZAA 2ZOLA 5EUOE 5K1VA 1DVUA 4K3DH 4FJYA 3NCXA 2O6EA 4GW1A 1MHCA 2H0EA 3EZJB 4GSUA 4JFXB 1NANH 4BUQA 1CI5A 4R5XA 5AB2A 1OTTC 5D6DA 5B39G 3DMMA 1ZXQA 1ETZB 2EEBA 4I18B 5DD5L 5FW8A 1KGYE 5DJCB 5KEZA 4HOXA 1XR9A 3M8OH 3REVB 5BZZA 5KJ4A 1ZVNA 5JLZA 3DROB 2OM5A 5CZRA 1F6LL 1BXXA 1RZ7L 5IJKA 1SY6A 5AW3B 1T83A 3S9DB 1PSKH 1BBDL 1FSKB 5FO9B 3WNJA 3CLWA 1QR4A 3KXFE 5EEUA 5DRWA 3T0AA 5I0XA 4NLHA 5CIPH 1HSBB 4Y5XC 1DBJL 4AEEA 3HEIB 3DMMB 2P45B 4Y19D 2XZZA 5JO5B 1K6QL 4IGBA 5DJCA 1T89C 5FKPA 1UKTA 1EEYB 1QSFA 2ZX9A 2D73A 2NY6C 1CE1H 5DUPH 4C4KO 4ZS6D 1G6RH 2OI9C 4PIRF 1MJJA 1CLZL 5GIRA 3V5HA 1QSFE 1SDDB 3FUKA 1HNGA 4RA0C 4B9FA 1BZEA 3FTXA 2FNBA 3WL9B 3APCA 5CFAA 1N19A 1RZKL 2QQKL 4JRXB 3CIAA 4JE0A 2R8SL 2BWQA 3KR3H 3PUCA 5IMMA 1A4JB 5KVMC 4XP4L 4DKAA 4ETQA 2EDEA 2FDBP 5L9DH 3DTUB 4XE5B 1JTPA 2ICWB 2WZPD 3IAQA 2I69A 4XMVA 2N7AA 1M4KA 4RFEA 4LSRL 1DN0A 1PX3A 2A5UA 5E6ID 3IDGB 3JV5A 1JV5B 5LBSA 5DURB 3H2WA 4NNPL 4D9RE 5HYJA 3PGCA 5INCB 2BMKB 1VACA 1AR1D 2UWEA 4LCVA 2W5PA 1E6OL 2IO5A 1IC5H 1A65A 1N68A 2AXHA 5CKGA 5EU3A 1XIWA 1T2XA 4YDKL 4FGMA 3VI3A 3ZDXF 5FOBB 3T0DA 1JDDA 1F3DJ 4L48A 5KVEL 2X6CA 4KK8D 2DQTH 4NUPA 5B3NA 1HL4A 1UH3A 3SCMC 1MCKA 4UB0L 1TVBA 4P4RB 4WUUD 1KLFA 4BUHA 3A4EA 1VPOL 3CSTA 3MKKA 1FVEA 4YVNA 1HE8A 3NN8B 3L81A 3KAAA 4I77L 3EZ8A 3DV6B 1NBVH 1QFOA 3N3EA 2VKXA 3QG6B 4W4NA 2YAPA 3C12A 1KLGB 4XPAL 3K8MA 4YUEH 5FOBA 2FO4B 1XWVA 4GSXA 4NO3A 4XNUH 5IEHA 4PJ8C 5IFAL 5E2JA 3JUYA 4Q52A 4XPTH 5A2AA 2I5YH 1TNMA 3MJWA 1GTFA 1TO4A 4FE9A 4Z3GA 1ET5A 5GSRB 1AY1L 2JKWA 4OGXL 3B2UC 1G0XA 2QSCH 3B2XA 3KPLA 2NW2A 3P9WB 5IW6B 1ZJBA 4AYFA 1GZHA 1K4DB 3LVEA 1PKQA 3UXFA 3WELA 4D9QD 3WCYA 1ID2A 4IS6B 1P7QA 2WZ5A 3UO1L 4AZUA 5IMKA 3PWUA 4FFVC 5FYLH 2Z0BA 1FL3B 4FQJH 5DT1H 4HF5L 4AL8H 2DDQL 2NY0B 4FYQA 2NZ9C 1KB9J 2WSDA 1TVHA 1MHEA 2MWCA 4GFXA 1EEQA 5KSAB 2B9BA 1DJIA 1IBBA 1XXFC 4N0CC 1BFOA 2OZ4A 3Q7JA 4G8IA 2XZCL 4QLRA 3QUXC 2DYPA 1XF4A 4FQIH 1Z5YD 2J12B 4TSBL 4WFHE 4QWWD 1FFTB 1OCWL 1ZE3H 4IS6A 2WQVA 3M1BB 3BUDA 3VD0A 5D7IF 2DWEB 5TQ2H 1IUZA 1EZLA 1K4CA 1K8DB 1ZIBA 2JIXD 3E8UH 3NA4A 1V54B 4YGVA 4OCSH 3QHZL 3V5KB 5KVDH 4HISA 1TVHB 5GGTH 1LO5A 4NBXB 3UO1H 1DJYA 2YXVA 3ZR5A 4OI8A 4NQVB 3FPXA 2XTJD 3EJPA 3C5JA 4WUUE 4EI5A 5ETUA 4HF5H 1X9UA 1NKOA 5I74C 4JUSA 1RVFH 5BRZD 4QHNA 1MUJB 2K1MA 1IM9D 4OU3A 3ZYJA 3VGAB 2X10A 3T1WA 2EIEA 1RXLA 4JPKH 1ZTXH 4FP8L 4X80L 4CC4A 3WE6B 3FOMA 4PV8A 1V27A 4MMXA 5IGXH 5KSVB 1CZ8H 3L5HA 3FUEA 5CAYB 1J10A 4MDIA 1S9KC 4XPFL 4TNVK 4FQXB 4WSKA 5T1KA 4HWZB 4Y1AB 3IFNH 4WK2B 1BDYA 5I82A 1R5IB 5AB1A 1P84K 3EYOB 2XNAB 2AJVH 3F7VB 3QXAB 1FL5B 2PMZA 1KTDA 2AW2A 3FQ2A 4JO2L 4N2IA 3V0EA 4YXHH 3NCYS 1L0YA 4UQAA 4L8CB 2VJXA 3UFIA 5TK2A 2UXGA 1BG9A 1OT2A 3RX5A 4BV1A 4MJ5B 4WJG3 5KVGL 2ATAA 1I4FB 1BW8A 5T3XE 3V95A 4JFDB 3QDHA 1F42A 4WK0B 1ZGLB 5F9OL 4P9MH 4Y1AA 4ZD3L 4NZDA 1KJMA 4AKQA 4RZCA 4P9HH 1EXHA 3HZ3A 1SJEA 1CZ8L 3NAAL 1ZGLP 3RPIA 2Z8RA 3DX4A 3EYOA 5EUOF 5A6LA 1FLTX 2B39A 3HOGA 4MZ2A 1KEGL 1J1PL 4Z3FA 3CGTA 2JWYA 4M5ZH 2XZQH 4NT6B 2Y7SA 4UTAH 4P5SA 2Y24A 5FX3A 4A2DA 3QEQE 2FT6A 1NIFA 4AJ0A 4Q9CA 1ZLUH 5HGHB 2LV4A 1S3KH 1CGYA 2DTML 2IAAC 1MAMH 4F1SA 5L6YL 2CLZB 3GI8H 4NO2B 1FHNA 3MI6A 5GZOD 1V3JA 1CDGA 1PD1A 2QVIA 5HDBF 2CK0H 2E47A 4YEEA 1T7VA 2GT9B 1JNJA 3DX1A 1CR9L 2JIXA 3TN0C 2AK4D 1KCWA 2JLLA 1DBAH 4HC1L 4TVPH 1CL7I 3U0PB 2EUVA 3MLZL 3IE4A 3UG5A 5BQDA 2CR3A 1MLCB 3GSNB 4G8FA 1ROWA 1P0SE 4Y2DC 4N0FA 43CAB 4KRPC 4YSQA 1A1NA 4BCZA 1D2OA 3T8XA 3ZKSD 5I1LA 4D0BA 5C08A 5CJQL 1FIEA 1FNAA 3UTSD 4AYBA 3OZKA 4LHUG 5T3XL 5DD1L 4RDQF 1NCUA 4H8VA 4MAZA 3GSWB 2HKFH 1UJ3C 1F6AB 1XAUA 4FXGA 1CK0L 2Z65C 3C6SB 3NRPA 1IGFH 4MYPA 2FUQA 4P46D 3B3BA 4OF7A 4R8WH 5EBGA 2YN5A 3D12B 4JFEB 5HDRA 4HYTB 1JD7A 3VCLA 3U46A 1PG7L 1RZKH 4X0NA 3P4NB 5DEFB 2P3YA 2VDLB 2ZT9C 2H32H 2ZP0T 3A6CL 3T8XB 2R29A 4XPHH 2X4UA 1XF1A 1U3JA 2FD6L 4HJJH 4YE0A 3WGUB 1NQBA 2DMKA 3NIGB 3SKJL 4KK8C 3U6XA 4YHYB 2VAAA 4NUMA 4E9LA 3BEWA 3RNQB 3PAZA 5I6KA 5JQ6L 3LXUX 1LEGA 2R59A 2CH8A 1F02I 1N10A 4Q56A 1I3GL 1J8HD 1QASA 3QJTB 4KY1L 2YWZA 5T5FA 3O2WH 5HDQH 2YPLD 3NPSC 5HGDB 3VMOA 1JFQH 1KIUA 2CCLA 2F58H 1P7KA 3DMMD 4HV8A 4IRSA 1G7LA 2V2XA 1LK2A 1XZWA 2Q5BA 2RACA 4LVEA 4WTWA 3V4VA 4N1HB 3RWCA 1P4BL 4P2RA 1W16A 4M7LT 1EO8H 2GABA 2MOGA 3EJYD 5GGVY 3HMWL 3DPBA 1KULA 2YUZA 2V4LA 5SV4A 5FXCH 1PIFA 2XTSA 3CDGA 4HS3B 3WLWD 5FB8A 3JUZA 4KVCH 2EXYD 4Z8FH 4L1DA 4I7ZC 4KRMB 5BS0A 5HGDA 2IFGA 5EV7A 5JIDA 1C8PA 3ZBMA 1UFUA 4ACTA 4X9FA 4S11A 2UY6B 3RWCB 3FTGA 2FNWA 1C5CL 4PCTA 1YNTA 4MASA 4JE4B 5C0IA 4OLUH 1R3LB 1ZS2A 1LEIA 1HCYA 4ATTA 12E8L 3V7MA 1H6TA 1W15A 1ML0A 1U6AL 3FO1B 3W56A 5EU5B 4UU9A 5IB5A 4EKJA 4KHXH 4WKZB 2TRYA 4MS6A 3F04A 4PJ9D 4JRFA 4GG6A 1IVLA 1IJ9A 4N0RA 2P7TB 2E7BA 4NAMA 4AQ1C 2YMXH 3FSWA 5I71B 2X6BA 3CHRA 3G5VB 4TRPL 4XOBA 5F7MC 3SKOB 5C0IB 5IK3A 3ABLB 3QWRA 1JHKH 4OQTA 2P26A 3ZDXB 1F4WL 1J7VR 2PW1B 4BFEA 1KG0B 3DUSB 5C0BD 5E51A 4FA6A 3COOA 3BGAA 3QO0B 5C0AA 4QT5A 1UEYA 4XMPH 3ETSA 2A0LD 2OMXB 2Z92B 5ITFB 4ODBD 4OM1L 2ORBL 4BFIA 2WXGA 2XTJC 3ZO9A 4KV5F 2UZXA 2IAND 4U1KB 3BJLA 4RBPK 2X9YA 5ESQB 1NUGA 2Z9TA 4CVUA 2XKUA 3I74A 4ETYA 4YHPB 2YC1B 5ANME 2IBBA 4PGDB 4A67A 2YWYA 5IB3A 5MEOA 2UZIL 3F12B 5INDB 4AVIA 4TNEA 1TPXC 1M7DB 3LN5A 3PG2A 4FQXC 5DD5H 3L1EA 3UC0L 1FGNH 5C0AB 3FN0H 4DGWC 4K8RL 4ZFFB 3HZKA 3INOA 1I1AB 3SQOH 4BKSC 3LNGA 3B8SA 1U95B 3T77B 2SODB 3SPJA 2AV1B 1FDLL 1YDPA 3BC9A 4G1EA 5HYQB 4C83B 3U4AA 2IF7A 4PP1D 4Y1AE 4YHPA 3EKCA 3MODH 4K07A 1JZHA 1XB8A 3CHSA 1P2CB 1IBZA 1HX0A 1R3IH 3P3TA 3X3FH 1ZGLM 1UXSB 5DVOA 1ZIAA 4YSEA 1FG9C 4L5FL 4M7JL 4B9GA 4JZNB 4PBWD 4HUXB 1N8ZA 2YPKA 5C97A 4KI5D 1YDPB 3QUMB 3MLTB 5J3HD 1CDHA 1XO8A 2H2SC 2HLFC 5HI3D 3CFMA 4J1UA 2I9LB 1PZ5B 2OULB 4B53A 2AVGA 4YZFF 3PWJB 4FX5A 5DFAA 2XWTA 4F2EA 2FB4H 5DJ2A 4HPOL 4P5MB 3IDUA 3WY2A 1D5MB 5EZOH 1B0IA 3RBGA 5FF6B 1N2RA 3HNSH 4Z95L 3CQQA 3CFDA 3NMEA 3PWNA 4WVRA 1AD9B 4JVWA 4PLKD 5CEXB 4AH2A 3FHEA 1DO6A 2Y5TA 5FK9A 4FQQB 4F8PA 5BZWA 2ADIB 5KUKA 3CZNA 3CZLA 2OTPA 1YMHA 2LTQC 3P0GB 1PZ5A 5IEKA 4TNFA 4AV5A 2BVOB 3BZEB 3I6SA 1NLDH 2GC7C 3QIBD 1YUHA 1HXKA 2AK4E 4PJBB 4Q6IA 1EH9A 1UJ3B 4HIQA 4OZHE 3IJ7A 2X7LA 1CVSC 4P59H 3OF6A 3DGGB 3JYBA 4Z7AA 3O4LE 1XGTA 2BVQA 2IG2H 3NIDE 4MWFA 3O0LA 2GPZA 3NEXA 4U6XA 1W9XA 1IM3D 5EDXA 5J56B 4GIPD 3WN6A 2CKBL 1GYAA 4JFZL 1TETL 1IFRA 3BKYH 2NQDA 4JFOB 5I6LA 4PJBA 5T1KD 1QW9A 3VMPA 3LN9A 4MJID 5I1KH 1FCCA 3HBGA 4K94C 5C71A 2Y7OA 5CD3B 1I3RA 1X5ZA 2X7LB 4PY7A 1AGFA 2PETA 2AK4A 4HWEL 15C8L 3RVWD 3QYNA 1JHLL 3IBEA 1O5PA 2OX5B 2AEQH 3IF1B 3MV7A 4NQTA 4UINL 2VZOA 5K59F 3TGXA 1CFNA 1E30A 2P8LA 3DSNA 1AQ8A 4BQ8A 2C1OB 2XA3A 1BIIA 4OJCA 4GSRA 1OAUL 5C6TL 1O75A 4B3VA 4JAMB 1KT2A 4Z7WE 2DI7A 2RBLA 5ISZE 1KPRA 1RUPH 1TTAA 2C5DC 4JS7A 4M8UA 5F1OB 5IM7A 5E7BA 4NCDA 4F33A 3VFTA 1QWNA 4JFYA 5EUKB 3KPRB 5DEZA 1TT6A 3D3VA 4QJ4B 5AAPA 3C8DA 3WEAA 2GYSA 4ERSL 3B9KD 3O0RH 2V17H 3D3VE 3HE6A 1IGJB 3L3GB 4PBVC 4I9WE 1UQSA 1OTUC 1YNKL 4KJQD 4BINA 3HMWH 4AEFA 3BKML 4K8RC 5DZPA 1Q9OB 1CXKA 2QPDB 3MYJB 1DLHB 4D7PA 5TE4L 2Q2EB 3UROR 2EJ1A 2EDXA 4J3OD 5HYJE 1C5BL 3R18A 1TO5A 2WXNA 3DETD 1A6UL 4F2ME 2R23B 1KDIA 5FKAA 4PUBH 4N9OB 1CIDA 4DO6A 1HKLL 3V9CA 3GBNH 2YAHA 2BNUB 3CZFA 3LEYH 1WBYA 4ZUSA 3BPLC 1QSEE 2WLYA 3G6JE 3GBLA 3O2DA 4LPXA 3LD8B 4F15C 2AS5M 1U3HD 5DZNA 2MCG1 4G8EA 3LOWA 5I19L 1AKJD 1SYSA 1WFOA 1QWUA 1TTCA 2V2TB 2HKAA 2EH8L 2O5NA 4LB8A 3BIKB 3F05A 4ANKA 2NNRA 1A7PL 1MCSA 5ICUA 1T1YA 4EI6A 1HHIB 1MCLA 1R3KB 2XTJB 3LXBA 4GKSB 5E9DB 1FGNL 4PGZA 4P5TD 1JZ2A 4H8WH 2APWA 5JXAH 3RJOA 3VMNA 1M1XA 1KY6A 2BHZA 3MGTB 3N41B 2A77L 3EFDL 3MRLA 4JUTA 5D4JA 4B60A 1O9WA 2FWOB 3BZ4A 2RIKA 1P69B 3OR6B 1ZV9A 2P42B 3ZRFC 1IILE 3OXSB 3VGFA 1QHOA 4LQ1A 4U49A 1WAAA 4Z7QF 1VRSA 2VN7A 2VMJA 4WW2A 3T2PA 3FH8A 2Y7MA 2O61A 1G7QB 4KTEH 1IX2A 2Q3AA 3BP6A 3NSDA 4U1SB 3MRCB 3GIZL 3CFKA 3MCKA 3OJMB 4WUKL 1MFVA 2Y3NA 1YYMH 1S3KL 3S3SA 4YH6A 2DWXA 1L7IL 2DQUL 3PDGA 3NJIA 4GSQA 5J9PA 1CIUA 4I3GA 4JRYB 4RNRA 4EIBA 1ND0A 3QARA 2JJUA 3GMQA 4CMMA 2KPNA 3BH4A 4KROD 4AIOA 2WP3T 4NQED 3TV3H 3QJFB 5I73B 1P4BH 1GOGA 3BAWA 3Q1SL 3QUYD 2X1QA 4E41B 2V8MA 3O9WB 2DBJA 3IGAA 2V2WB 3EJSA 3E8UL 3FRUB 3FRPG 3QQ9D 4ZT1A 1BHGA 3D39E 3ZW3A 2I9TA 1HSAB 1SDDA 2NXYC 5T8IA 2EKSA 3TWYA 3BPNB 5C6PB 2NLJB 2WNKA 3P77B 3CUPA 3UAJC 3DHPA 2WOBA 4YHOL 4HWNA 3GKWH 4JLRB 1BYNA 1TQTA 2C1PA 4X2UA 4M61B 4NS0A 3TYFB 1L7IH 2A9AA 4B96A 5DUML 2VLLA 5AFAA 3ZYZA 4AQAA 3K4AA 1R4XA 4BFFA 2CBPA 2D9QB 2E5EA 5EF0A 4NFCA 2CKBB 2ICWA 2MKLC 3E2HB 3LPWA 3ZDYF 3FQTA 1T6VN 3FCSA 1FV1B 5FM8A 1MNUH 4BH7A 3QEGH 3KBPA 4FJ6A 4TTDC 4OGAC 5C0EB 4X83A 3AG4B 2NYYD 1QTSA 1DCEA 3WJMA 3NBNA 2JJTA 1NMBL 2MPAL 1DSFL 4OFYA 4N22A 3QRGH 3BSHA 1SEQH 1OSEA 4HIXH 4PTUA 2MTPA 2V3FA 2WUCH 4IQHA 1AC6A 1R5WA 4PJIA 1L6ZA 1XR8A 2E6PA 3QHFH 4GKZB 5F1NB 5TDOA 3VGBA 3RWJA 3PGDB 3AAZB 4LDOB 5C8JA 2J8UB 3ECQA 4PJCA 3SCMB 4HU2A 1TVBB 2OS7A 2VRKA 3FZUD 3GK8H 1PQZA 3V4PH 1IVTA 3FO0L 4OKVA 4NQDD 3VH8B 3C2AH 1QKZL 2DJMA 1UXLA 2R1XB 1P5UA 2ITDB 3T08A 5B1BB 4CVWA 3D3VD 1RZIB 1A9VA 3CFCL 4FOMA 4HUCA 1SDAB 1XGPB 1UD8A 4WDIB 5F1NA 4NQDE 4XOCA 2A74A 4HGMA 4KI5C 5HHVL 3SDCD 2I60L 1DQKA 5GRYA 3GXIA 5ABAA 1ZHLB 4ZSOE 4P4KD 2M1KA 2F53D 4HUKB 3EYSH 5CZVL 5EO0A 4HUMB 2ZJSL 2NQCA 2PCFA 2IOOA 1LP9F 2BP0A 1RZIA 4RZKA 1JPEA 2YJLA 3P69A 3FC8A 2BCKA 3SPVB 1TENA 2A74B 5KJ7E 3PQYD 5A2CA 3MUUA 5BUPA 3BQUC 4QRSB 4PRPA 1FE8L 3KYAA 3ILPA 3PWVA 1MFUA 1DQQB 3TBYB 2Y7NA 3EO9L 3VFWB 5B7MA 1IMHC 5EO0B 1H5BA 3NZ8B 3MC0A 3MUY1 3X1NA 1XF4B 1INQB 1OAJA 3OHXB 3U1PA 4GSDL 3FQWA 1PZCA 4XN9A 4PV1C 1CDJA 3QO1A 4XMPL 2AXFA 2FJUB 4WZ9A 3TIEB 1J1XH 1SLXA 4GG8A 1MDTA 3W9EA 1E4XI 3POCA 4UNVA 5IVXA 1TVDA 4QAWA 2QT6A 5ISZD 3BH8B 2ZWYA 4HMDA 5LCVA 5BRPA 4UTBL 3ZE1E 1UC6A 2CDGB 3JSSA 1BD2D 4QHKJ 3NZ8A 3BT0A 3KPTA 1G1CA 1GGBL 1RU9H 2VITA 1AD0A 3SDAB 3JT2A 5DD6B 3HJEA 2Y3AA 3JXAA 4OCYL 1A6AA 1MFMA 5JPNB 1NCIA 4LVNC 3N1FC 3LPPA 2XBZA 5D1XC 3S37L 1HL9A 3KD4A 4P3WA 2X3CA 5AVRB 5TQ0H 4MNQD 4UOJA 1G1YA 3KWUA 6PAZA 1E9PA 1F0LA 4GRLC 3LS5H 1Z9SB 4WWKD 3KM1A 3W39A 3KL5A 3K1DA 3WIIL 4P4KB 2NY3D 1R5IA 3WDJA 3GM8A 1IKFH 1CLCA 1YC8A 5KVEE 2ICES 4Y4HD 2HWZL 1K72A 2PP9A 1A6ZB 4OFDA 4U1NB 2E7MA 2AK1L 1IAOB 4LL1A 5LBVA 4L8CA 1HXYB 4ANVA 2YD7A 3F00A 2J7LA 4UCFA 3BHBB 1BM7A 4FXTA 4M6OL 3ZO0A 1HCFX 3OAWA 1KDJA 2FK9A 4G7VH 1KFAH 1CFBA 3S88H 4KWUA 1JE6A 4N5UA 3QS3A 2HAZA 1VGEL 5I26A 2XN9A 3HS0C 5DK0B 3PQYA 4Q2ZA 2HVJA 4IYKA 2Z93A 5I16A 2EC9U 2I32A 4JJ5A 2B0SL 2CJUH 2A9MH 1NSNH 3KDMA 5BQ7B 1SXCA 5DZLA 4XNQB 3KLQA 2IGLA 3BHBA 4GMSH 3HNSL 3UGXA 3OWRA 1YEKL 3MLSL 3CWGA 3DX7A 3HC3L 3LRSA 3ATDA 4C56D 1X7SA 3FUFA 2FL5B 1VPOH 4XH2A 1X7QA 3CVDA 5I6XC 4FADA 5CIPB 3OB0H 2HYMA 4PJ7A 1U8CB 2JB5L 4JFTA 3LRKA 3O3EB 4AYEC 4PIBA 3D6GA 4JZJB 2DQIH 2EH7L 3QT2A 1KCRH 1T0MB 5L4FA 2Y07L 3SY6A 1VGEH 4NQUA 3QJUB 2Q6WB 4G8FB 2NNCA 4G5ZL 1U91B 2VR8A 4N24A 4D0BB 3E9UA 4X9BA 1X5IA 1RZJL 3BEVB 4JO5A 4JL2A 4HPYH 3WS6A 2FR4A 1YEKH 3GSWA 3WO4C 1KN4L 2QGBA 2JXMA 2LQRA 4A6YA 3W0WB 5BVJA 3OKMA 4HJUA 5I1AA 3QW9A 2IDTA 1JK8A 5HVFB 4LGSB 3FT4A 4L8SA 1M1SA 3ARBD 2AJZB 2V9TA 4GXVH 4F57L 4K5OA 2VDKH 4NQDA 5KYYA 2BSTB 1G7MB 1ZWIB 4Y2LA 2NY2D 1GGYA 1D5XA 4TS6A 3W2DH 5BXFA 1IAKA 5IJDC 4KKQA 4OTXL 4FHKA 1MRFL 4TXVB 3TEZA 1HTYA 1S7RB 2OP4L 5JHMA 4JBSA 4Y8AA 4J39A 3MODL 1NCCH 4K23H 4U33A 5C0CA 5F7YC 2IBGA 1PTZA 5IESH 4AMWA 2QKIC 3FT4B 5D7IB 3ECBA 4H4NA 2CJTA 4F1ZA 1RH8A 5KYYB 2BINA 4L4TE 3BN3B 3V10A 4LF3B 2Q7YB 3O6LL 1T21A 4LLVA 3CTTA 1HILA 1F86A 3BRDA 3FT1A 3B1TA 1JERA 1KIUB 3QNYB 3ZDWA 4ZDHB 2WYTA 4XO4A 4YR6B 1NGQL 4JN2B 5AOKA 4JKPH 2VZ1A 2HRGA 5C0NC 3MUJA 2R1WB 2Y72A 1PJWA 3H9SE 5FECB 1CC3A 2AQ1A 3QWOA 2IOMA 4LLYA 4M43H 4V33A 3L4CA 2ADJB 1UWGH 1W80A 3NEEA 4HS3A 3W11C 4K15A 2J73A 2F8VA 3NCBB 5AL8A 5L2JB 1A9EB 1WCQA 3DURA 1QPPA 4LHQB 4J6RH 4QOKE 4U2ZA 4RCAA 4JPIB 2CO6A 4Y5XB 2KMWA 1XD0A 4OB5H 5TK4A 3S3DB 1MAJA 1DZ0A 4N68A 3BZFA 5KYUA 1V7ML 4BQ9A 4GRWE 3BKCL 4ZBJA 2B77A 4LCCA 4LLDB 4AYID 2PNDA 3NZHL 1AHWB 2IQ9H 4HUVA 3NK3A 2DWTA 1ACXA 4Q9RL 4EAEA 3TPUB 2ADJA 4NQEA 5B3SB 1UA6H 4OLWH 2O5XH 3GINA 3C5XA 1EHAA 4K3HA 5L2JA 1SLVA 2G75A 1NCBH 3ESOA 4AIEA 5KS9A 4NHCH 1ZTXL 4RWYL 2FHBA 1XZ0A 4ORGA 2WQUA 3I3DA 2V37A 5DZOA 3IJYA 1JDAA 1G7PB 3TFKD 1PZBA 2E7HA 3RWFB 4IK7A 2V6HA 5FUCC 5T3ZL 4XAWL 4LVOC 3QDJE 3VXUA 4FHJA 4ZFOB 3O2DL 3VFVB 3KCWA 2PW1A 3CZKA 3FUNA 1BLNB 1DEEB 2V5YA 2YOAA 4HLZG 3QUYC 5KS9B 1HNFA 5L8JB 3V0GA 3KPQA 5B21A 1ASQA 1JXJA 1U8QB 3IM1A 4X6BB 3HPJB 4C58B 3BWZA 3MBWA 4Q4IA 1WZMA 2A83B 3FU0A 2Z35B 5E9DD 1XBRA 2GUOB 4NM4H 3NOIA 2DV6A 3R7QA 3RL2A 2HFFB 5FYJD 1Q1JH 3CXHJ 1NIBA 3BT2L 3KPRD 2CBQA 4KO7A 1J1XL 2XX1A 3CN4A 3EHBD 1YYCA 3RGVC 3D25B 3QFJD 4ZMXA 5TFSH 5CJQH 2GB2A 4HIIB 2EDTA 1RUPL 2I26N 4H8WC 2UVFA 3AXHA 3MBWB 3BWAA 1J12A 1I9RL 4N8VG 2ICEA 2F61A 2PPFA 1D3CA 4LSTL 4UV7L 3W82A 1OO2A 2X1XR 3SE6A 1ESOA 4J27A 1BQLL 5T33H 3RWGA 1P2CA 1H8NA 4HIEB 4L37B 3FBQA 1GC1C 1IAIH 4FNLH 1ORSB 3BD3A 3RTQB 1F00I 2BP5M 1G4MA 3FO0H 3MJGX 4HIIA 3Q5TA 3W9DA 3EJRA 1MJ8H 5BMFL 1Q38A 4XP5L 4M5YH 5D8JH 1AXTL 1FYTD 5J6HA 5PCYA 3OAZH 4KI5F 3PHQA 3L3OC 4L0YA 2VDKB 4F2MA 4IKNA 2I7OA 3T6XA 4LZKA 4CGTA 3P2DA 3FONA 3GGWA 4MXVF 3HE7C 2CSPA 3U6RB 2XWTB 3QC6X 4M6AA 3RHWF 2PUQT 3T0EE 3WSQL 1P7BA 3BE1H 4WFFE 2DWSA 4QD2E 1R17A 3HKFA 4JHWH 3LZLA 3GBMH 4APQB 2Z31A 4LBEB 3WFCL 1RZJC 5IHZB 3ETBF 4MXQC 4U3XA 5JOPD 1OCRB 1WUNT 1HEJC 2MCPH 1JMXA 5LGJB 3CU1A 2CA3A 3MUGA 4RDQG 2WVUA 5KVDL 2EIKB 2GK2A 4FNPA 2VABB 3DRTB 2HX8A 2XWBB 3SGDI 3QBTB 1PYWB 5DEGA 3KS0H 3G04B 3ZMRA 1MFBH 1RQ5A 2A9NH 2B4CL 2BSDA 5ISZA 3TZVC 3WN5A 5F7UA 3IWVA 1KGCD 2YR3A 4ZOEA 3WXVL 3BVNB 4K7PY 4RRPG 3QHFL 1BREA 1T80A 2JCCA 1Y07A 1JFQL 1KV3A 4AMXA 3DGGA 1AHMA 2R69H 5J57B 5C09B 5LGJA 5T1MB 2BRQA 3L5WB 4OQTH 1U36A 2WQWA 3KYOA 4HCGA 2O93L 3OMZA 3DX3A 1PYWA 1Z5LB 3GMPA 2IEPA 4NC1C 4DCQA 1ZS8A 2E0PA 2F74B 4K71C 1U8PB 1AZVA 4EVNB 5HPMA 5DHVB 3Q3GA 2I27N 1AQMA 1YYML 1I3RB 4TVUA 4R96B 3BWSA 4KK5C 4ZXBB 1MHHB 2AK4B 4PJBE 4WY7L 4Y16C 3QQDA 5C0GB 1NCJA 4RFNC 1ZE3C 2VDKL 4WLCA 3KYOB 1SY6L 4HBQA 5F8RC 5CR1A 4YS4A 2BSSA 4UT6L 2FWSA 3D85B 3PHOB 4Q0XH 3LKNB 1J9SA 5HY9A 2KKQA 2BVYA 3WTSA 3L54A 4PHXA 3E1F1 5E5RB 1Q72H 4G82A 4ZUWB 8CGTA 2OP4H 2D9CA 2FYVA 1KTKE 3EIFA 1DQMH 1ZHBB 3MV01 3H9ZA 5CJXA 2ICWI 3TA3D 5D7JB 4XBPB 1P4LA 1D5RA 1BVLA 3FU8A 4Z7OF 2FQGA 4HEPG 5T1LA 4I48A 1OWRM 2V8LA 1QI4A 3AREA 5JIIA 1QNIA 5IQ9A 3WJJA 4Y4HA 1I1YB 2ZKHH 3BUYB 3V8OA 4JFYB 5EUKA 3WHE1 1IU1A 3JWNH 3FT2B 5JHDA 4IBYA 3GSRB 2E46A 4MJ6B 4OCWL 4U6YA 5HY9B 4AGOA 3VSQA 2IOIA 1SY6H 1FL6A 3ARYA 2NCEA 1P1ZA 2DJUA 1KJ2L 4QHMB 5D5ME 3S88L 1HQRB 3CC5B 4H20L 3HUJF 3CHOA 1BVZA 3RKDD 1T03H 4G6FB 3QIWD 1KPUA 2Y7QA 1H9DA 3QWRD 4R0LC 5IR1B 1H3PH 2F7OA 2VMDA 3V7AE 3RVVC 1EUUA 2ED7A 5D1QC 4XBGB 4R5TA 4RMBA 2BOBA 1G87A 1SXNA 4XNXL 4L4VA 3CQPA 3HE7B 1RFDL 4P2OD 4F3FA 4QHLB 3APMA 1F8TH 3VX0A 2ZNWA 1I9JH 5FEBA 3T8MA 3VRLE 2WXIA 1UA3A 3VD2A 1B4JH 5DI8B 4ZX6A 3VU1A 2F6AA 2FECL 2QKSA 2ZAHA 3H2PA 4LO9A 4X6CA 3UTZB 5BS0D 1KENL 3ES6A 3UJIH 4V11A 3V5DB 1QG3A 4TNGA 3GJFH 1ZLSL 4MD0B 4YXKL 5HI3C 5B8CC 3OHXC 2GI0A 4G9FA 2EYSB 3UAEA 3ZHNA 2BOBB 4E36A 1BZDA 1UM5H 1ZK9A 4E9YA 2P5WB 3C2AL 1YY9D 2XETA 2MTAA 4KPHH 1ZT7B 3H0TA 3NA9L 4RQQA 4XCNB 1HIML 1JCKA 1WD8A 2WINB 4KZEH 1LK3L 3AY2A 1NBQA 1FJ1A 4DTGL 1G9MC 1QLEH 1JWUA 1IQWH 5I18H 4WJ5B 2Y6TE 5DI8A 3OKOA 3VXPB 5ITBL 1U3HB 4FKEA 5FUOH 3UERA 3MRPB 4MX7B 5EU6B 5I8KL 2CLRA 3ZR6A 4QXGL 3DXAD 2J5LC 2Y36L 3OSKA 3I6LD 2CHZA 4WU5A 3O6MH 2OQJA 5HYEA 1KB3A 1DVFD 2EIDA 3UJIL 2NW3B 2Q87A 2DF3A 3PQYE 4JO4L 1L9QA 5E6RB 2FJHB 3B3IB 3T1FA 5G4OA 4PRID 2BXYA 4FN0A 4XVTH 2EACA 4ELMA 1JWUB 5LQBH 1L6PA 4WJ5A 4UM8A 4NIYE 4NWUH 1CTOA 5B38B 4GT0A 4E9WA 4K94L 4AITA 5A3IC 3TASA 2EE9A 3HC2A 3EDKA 1IKNA 2OMZB 1ADQL 3EJQA 4JM2A 4FCHA 1P6WA 2WJ7A 2OTUA 2FQDA 2HVBA 2F7IA 2OZNA 3N40P 2PPAA 5K9QG 3C9NB 5BZDB 4QHKI 1EVUA 1MF2H 4PWHA 1CBVL 5IROA 2YFNA 1NLDL 4QXTB 3DXAE 4RLDA 2K4AA 5BRZE 2XIIA 3DVNA 5IJVA 3JT0A 1IAMA 1Z3RA 3FRUA 4S0TD 5B38A 4OQ1A 4KVNH 4HX1A 5I2IB 4JHZA 4MB5A 5J1TC 4MXQD 3MV9A 4NZUL 1KIRB 2ZSVA 4YDIL 4AKPA 5T1DL 4JM4L 2VKWA 3SE3A 4UV4L 1W72H 2HPOA 5BMFH 5T5NG 7TAAA 2BLFA 5K69A 4M61A 5EH1A 4AGMA 3CU7A 1T04A 1QFWM 3APNA 5H94B 3IRPX 4PR5B 4AQAB 4XC1H 4LDCA 3NZHH 2HLAB 4NN7C 1WWCA 3DVNB 5HHQA 2X4RA 3GHEL 4MAUL 3E2HC 3QISA 4HX1B 5I2IA 1O6SA 3QJVB 3CDZB 2ITFA 2K6ZA 3N44B 2ADYA 2PP7A 1RK7A 1QBLL 3RL1B 2D31A 4YDKH 25C8L 4XO5A 4K4KA 5A2JH 5DYFA 1WEJH 4P99A 1FGVH 4P5TC 4QKXB 5HVHB 5CXPA 4PWFA 1UUNA 4QRPB 5FA3B 5I30L 1DJXA 4HPHA 5E24E 1Z1WA 5L4MA 4HWUA 3KLDA 4MZRA 3ILQC 4U1JA 3TH4T 1DR9A 1DBBH 2HH0H 3B8YA 2IWGA 2XPGB 5J6SA 3M86A 1R5WB 4G59C 2XG4B 5TDOB 1PNDA 4EI0A 1CFSA 1DHKA 2NYZA 3RWJB 4EE2A 5BJTB 3MRRA 4HKXA 4YHIA 1BXUA 2W65A 3F2LA 2YXFA 4JDZB 5E8OB 1Y6NR 5TGBA 2ZG1A 4PJ5A 2VXQA 4RMRA 4P2OC 1EUTA 3KVPA 2HTKD 4X98A 1SN2A 3NSJA 2DLFH 1EJOL 3V2AR 4LAQH 4I0PB 2A6KA 4P23C 4TOYL 2D4DA 1OV8A 3O0RL 4ZAKB 5F9JB 1SM3L 4O2CB 2P47B 5I66B 3T6QC 5IHLB 4AQ8C 2B15A 2R1YA 2XC8A 1KZYA 1ZHKB 1U3HC 4QF1B 1E9OA 2YGOA 2XYBA 3LKOA 1OAQH 4BSWA 4WQOA 1NH6A 2G9KA 3AC0A 3H6AA 3HG3A 4OCNC 5D7EA 5D7IE 4EZMA 4Y4FA 1TUPA 3BUBA 3PL6A 5EZPA 1SPDA 2D3VA 3NGBB 1OGTA 4KUCF 4DEUA 2A6KB 3MXVL 4NN5C 5CN3A 3S8WA 3QDJB 3RGHA 3MJ7A 1YAZA 4UT9A 4JQXC 4X4XB 3VUAA 2VIRB 3QEUA 5KOMC 5GGTA 1PW3A 3U25A 3WDHA 4NP4L 2CPCA 1UH4A 5FGBA 3VXTA 2RFXB 3F58L 1GHFL 4ZZKA 1E4KC 1JNNH 4WFFD 1ECZA 3FB5A 2NTFA 1QFHA 1JXFA 1BJ1J 4L9LA 4WEEA 3L4UA 3ZTNH 1HSBA 1N0LB 4PRHD 4M5YL 5E1QA 1AQKH 4HBCL 3GIVB 2A1WL 3WNOA 1QHPA 1NCAL 1DANT 5FKPB 2VUYA 4OZIB 3B9DA 5KVGE 4MQXC 2A6JB 2Z31D 3IMUA 1AXSB 1RZ7H 3M17A 1QBML 3MNVB 1R3JB 3C75A 4XOAA 3SKUD 5E1IA 2F8IA 2IGFL 2IIJA 4HG4J 3BP4B 4K3JH 3L95B 3ATBA 3QJQB 5BUAA 1GGCH 3BH8A 3ULUD 4E42A 1JGEB 5E5LA 1AOZA 3VXSB 1FPTL 1TTRA 4ETQB 2F15A 1PY4A 1CFQA 5K1JA 1M71A 2ALWA 5JOFB 3RDJA 4CBPA 3WXWH 1HDMB 3KCPA 1JHTB 1ZA6A 4ODXB 3H9SB 3QUZD 1DYZA 5F71A 5GSVB 3ZL2A 4ADGA 2YKKA 3VSVA 1EFQA 3D39A 1MCCA 1ES0A 3BP7B 5TTRA 3UJTL 1YMMB 1WS7A 3KBFA 2J1YA 1UB5A 2ZG2A 3CPLB 3U9UA 1Z9MA 2RB8A 4AMKH 4C4UA 1PBYA 2APBA 4X6EA 1A1MA 1NMCC 4P4KC 3ZTJG 5HVHC 1RUAH 1SMDA 3LXCA 3IGFA 1PY0A 4A68A 1CFQB 1QWHA 3PAYA 1A6TA 1UVQA 3OR7A 1QFWL 4R4FH 3IBOA 4N2HA 1QUNB 1HDMA 3KCPB 4KMQA 1VFOA 3PL6D 4U05A 3WO3B 3QPQD 3RWEA 2GC4C 4LSRH 3VGEA 2P5EA 1NOLA 1MVFA 4B9ZA 5FUZH 3TFBA 4GKLA 4O02L 5C86A 4PJAE 1BVKA 2DD8H 4W9CC 4OFVA 5IBTL 3GB7B 1WHOA 2E27H 3QDJD 5DD3H 4DKEL 4YBQD 1EJFA 4I0PC 2W91A 1CUOA 2ZNXA 3BAEL 3QG6A 4S2SB 1NCBL 2R2HB 5FM4A 4PLJC 4DERA 1QUNA 1LE5A 3CJJA 3GSNH 3ZU8A 3WY4A 3RX7A 3GUFA 3LDBB 4Z7UA 1GOFA 5B1AB 4XNAA 1YUKB 3NTCL 1HEZA 5CIPA 2VDQL 5C3LD 3N5AA 1KTRL 1U3NA 1IJNA 2WLNA 4FRWA 4JFHD 3AFLA 1T2JA 2W9LA 5B1JC 5AVQB 2G2PA 1SMOA 5I75C 5DVMA 2Z8VC 3NDZE 1JK9B 4NKQB 3QUKA 1M7UA 4L1BA 1T0MA 1U21A 2EXSA 3HAEG 1VERA 1HH6A 2HKFL 1YEJL 4XMLL 2E27L 1C1EL 1NCNA 2EDMA 1OOAA 2WIIA 1DQJA 3ULSB 1OQOA 3P73A 1BQRA 5LG6A 2ADGB 1MRCL 2COQA 1M6OB 5D5MB 3X3GH 4AXWB 3A4FA 1D6EB 2L7QA 5LBSL 1NEZA 1XB3A 3WUWA 4BQBA 3KYNA 4H1LA 4WV1A 2IALB 4JRXD 4WUUB 3EGXB 2OMUA 1EFXA 3C2SA 3SKJH 2WN2A 2YPVL 1JK9A 1F3RB 1VENA 6FABH 2AJZA 1FNFA 1CYWA 1AANA 4HG4K 5IW3A 4PG2C 5BNXD 2BSTA 1BZ7A 4MA8L 1B2WH 4HH9A 4P49A 5I1HL 4PWIA 4PCKA 3MV9D 2VDRB 3SGJA 1YEJH 4XMLH 1S46A 1LLAA 2VM9A 1DUYB 1YQVH 2OMYA 3UZEC 2IAMC 1A9BA 5FS5A 3ILQD 3BDYH 2OJZH 4NRYA 1UWYA 4LEBA 4DWHA 1GA2A 4L3ED 3BZ5A 4RFOL 2EUXA 5CBEA 5EG6C 3WS3A 4B27A 1T21B 4LLVB 4GNKB 2HRPL 4MVBD 3VM5A 1WO2A 5FW7A 2YPVH 4M5SA 3DX9B 4G5AA 3CBKB 5E4IA 1LO4L 1FYHB 5I1GL 1IGMH 3C5ZA 1YPZF 4FYSA 4HWZA 3F83A 5DFVC 1DP0A 2PCPA 3P9MB 1H8LA 5GZNC 2Y6SC 3LB6C 2R2EB 3L08A 5EO9B 2NR6A 4G9DB 3QG7L 4L1LA 5EEZA 4ICXA 2BERA 1JXDA 3OX8A 5JHDE 3X1BA 1CICA 1Y0LB 3I6KA 4U7SA 4ZMTA 4MA3B 5AZEH 2GJRA 4QI3A 12E8H 1BP3B 5AW0B 4WEUD 3BZFB 2VDRL 4KKRA 3X13A 5KYUB 4LSUH 1CLOH 1HWHB 3NABH 4RZCB 1F5WA 3EJYC 2KDGA 4AC2A 3SO5A 3GEWB 3LIUA 3QXWA 1FO0L 1NKRA 2AK1H 2DOCA 3L5IA 1DSYA 2LU4A 2M2DA 4BH8B 2VC2L 3DJ9A 3MNMA 1MZYA 3P4LA 1XCQB 4H8HA 1I8KA 1UXMA 1ADQH 1AYOA 1IQDB 4BD4A 4JQIL 5E5UB 1GSMA 3FF8A 2HB0A 5KVGH 2MQ0A 2L3BA 2DMCA 3HW7A 3SDYL 1XZ0B 4ORGB 5CWSB 3VQMA 4JCWA 1WISA 1N26A 1RUML 3SOTA 4Z23A 4OZHA 1LO2H 3KXFA 4NO0D 4PJ9A 4Z3JA 3LS5L 4IRJC 5C0FB 3TESA 2YJQA 5DK2A 2ENJA 2ARJA 5F7LB 4JG1L 4NGHH 2X9ZA 5IB1B 1JV2A 3WEMA 3KGTA 3Q5YA 3VWKA 5I17B 2CDFB 1QR1A 1E5YA 4KXBA 3D05A 4M5ZL 3IJHB 4PGEA 1NBZB 1MWOA 1S7SB 3WXWL 1DEEA 4ILDA 4QAMB 1AHKA 1UWXH 2DS4A 1AE6L 4RMVA 3KLSA 1U8QA 4X6BA 3ESMA 3PWLB 2GK0B 5L2KB 5HHXH 2AABL 5HHOD 1OPGH 3ULUC 4AEIH 3BMVA 3D2UA 4Q97A 1IC7L 1RUQH 3U9PH 4OZHB 2PO6A 1YEHH 2X2JA 4PJ9B 1F6AA 3FAWA 3F01A 4FXGB 4M56A 4YSCA 5DK2B 4JKLA 5C0FA 2ARJB 1VFMA 5I17A 5E99L 1OKEA 1NBZA 2IJ0C 3B7UX 2HA1A 2UY7A 1NSNL 2DJ4A 1F1GA 2HFTA 4NENA 2CBTA 2GI7A 3GSXA 3S5LB 1PY9A 3QEHB 1G1OA 3NGBC 5D1XD 4PJDB 5JHLA 2ICEB 1IAIM 4NN5B 2ZF8A 4F37K 2JKLA 1J87A 1LEGB 3VB8A 2EADA 2GFBA 1IGFL 3FFCD 3GSVA 3VXUE 2DLGA 3T0EA 3RDTA 4JKMA 4LSPL 4FQJL 4GO6B 5F97E 1EWHA 1ZHNB 2CNYA 3PIQB 4FQ1L 2UWEE 4JPKL 2J5LB 1BD2A 2VLRB 4TSCL 3KLHC 2YEZA 1MCQA 3SQBA 2FH8A 5KSBF 5MI0B 4ODSH 1LK2B 2RD0A 4QHUB 4XC3H 5KS9E 1WAEA 1JN6A 5C9JB 5FLUA 2D3JA 5GS0H 3QA3B 4OAWB 1HE7A 1XGRB 4D0CB 1RHHB 4PW9A 4ZPTB 1YC7A 3CFCH 4UMGA 4XHQA 5M95B 4GI8A 1JGUL 3RDTB 1OAQL 3D8MA 1ZHNA 3PIQA 4WI2A 4JDTL 3RHWK 4FFWD 4IJ3C 5ANMA 5HHVH 2O6PA 3MRJB 4QCIA 5MEND 4XC1L 4APQD 1B88A 2PCXA 2YEZB 5EBMB 3SQBB 3D4YA 5DJXA 1KF9B 3MTRA 1P9MC 4EBQL 2YRLA 4NNXB 1J8HE 2LU7A 1MI5D 2ROXA 1MCPH 5JZ7C 3EYSL 2HVKB 2N01B 4KO9A 4HOWA 1PSKL 1QZ1A 5EU4B 4ZTPL 5HDWA 1A6PA 4X6FA 5C0AE 1JUFA 5K9OB 3S8FB 1B6UA 1E4HA 1GMEA 2IMMA 1UATA 2NY1C 2EYRB 3ROOA 4DKFL 5CGBA 1PU0A 2CRMA 3B43A 4LEOB 5HJ3B 1ZVSA 3F58H 3GXTA 3NJMA 2WO4A 4YHZL 1X5JA 5LWYH 1DUZA 2VERA 3MRFB 3Q13A 5EOCL 2HH0L 5IQ7H 1S7TB 4ODTH 2DZEA 2BSED 4AEHH 4MD5B 1CMOA 1UZGA 3BGMB 3FCTB 4KK6D 5IFJB 1Q8MA 3VWJB 3BXNA 1KYOK 1IBGH 2CLVA 4HZLA 3VGGA 2P8MA 4NJ9H 1FLRL 1A66A 3S34H 2ZAGA 4N25A 1IIIA 1Z5LA 1Y18A 5D71H 5GHWL 4K71B 3G08B 4NPYB 4D2NA 4EVNA 1A14L 1SM3H 3NIGE 3L3KA 4DT2A 1RIHL 2WLMA 3NFSH 7FABH 3KL0A 4MD5A 1ZLUK 5AVWB 3MLXL 5ECJE 4G6MH 4DKDC 1XSJA 4JFEE 1O9ZA 2ODIA 4PVMA 4GAAA 3OKLB 4DAGH 4L0PB 3S36L 5FDWA 4N26A 1KCUH 1GSKA 3QUML 5FA4B 4RGND 3EYVB 5JPMA 3JQOB 2K4WA 1BQHG 2F53E 3HI1B 1LP9E 4YXLL 5AWNH 1NC4B 1F1AA 1JZEA 1PCSA 2F1EA 4NJ9L 1D9KC 4PP2B 3MA7A 1XGYH 2N0MA 4XWGL 3WBDA 5JR1H 3VNZA 1ZHBA 1WFJA 3RY4A 3FQXB 3H42L 2PPCA 1C8QA 4FNTA 4XP1H 1NLBH 4PP1C 3DETC 4G1EB 3MLZH 3ZTJH 4DF9A 1DBJH 4JM4H 3P0YL 4JHAL 5EORH 1SFDA 2J6EL 3G5YB 5AKTA 4KKZA 2BDNL 2KYIA 4ZAKD 1XSKA 1YQ2A 3REWA 3DIVA 5E03A 1C5DB 3CBJB 4PJ7E 2H9GB 2J4WL 2CIIB 1WZKA 3HMXA 1KCUL 3OGCB 3O4OB 4IMLB 3OAZK 3DUUA 4QHMA 5DD1H 4OIIH 4LHUA 2J43A 4MXWL 3X12A 3CC5A 4I3RH 3FQXA 3BZDA 8FABB 4NP9A 4E9VA 2OSYA 2L0DA 5JW3H 4OJAA 4YHNB 5IR1A 3ARGD 4G8AC 4J28A 4MCYB 2X2UA 4L4TA 2FQFA 1IAIL 4FNLL 2DQJL 3RUGE 2Y1AA 1USQA 2B59A 1JGVL 2FJGB 1GIGH 1IM9B 2FCBA 4OGYH 2PW2B 2VDRH 3RTQC 4LSUL 4A6YL 3KMDA 2NSMA 3RZCB 1HOCB 2AEIT 3KBHE 4Z7UE 1GZQA 5I28A 2AJXH 5IREA 4OZFB 1TETH 1QI5A 3M45A 1OK8A 2KERA 2VDNB 1OPGL 4U7KA 4XN4A 4M48H 2YHGA 5ABZA 2WLIA 4PJEB 2B5IB 2ADIA 5IJBC 3QDMA 2XRAH 3WAKA 5DMYA 2ZWNA 5DJXB 2X05A 2DKMA 1JZDC 4HJEA 3EFDH 3GZPA 4FMKA 3UTQA 3TBSB 3ML8A 1EFXD 2BIHA 3QQ4A 3U2JA 5DUBB 4I88A 5DWUL 3VI4A 2WZAA 3SYPA 3Q05A 1FJ1B 1LO2L 4PRNA 4YK4B 5DR5L 1WF5A 2V7HA 2HJLA 1UM4L 3F84A 3HKZA 1JYWA 3T6VA 2XPZA 2WVVA 4YZWA 1EZVY 2CLRB 1M57B 4LE8A 1VSCA 4P2QD 4PRHA 3RWDB 5G55A 1SUJA 4KKBD 2ITCB 2MH4A 1HZLA 1GZPA 4WU5B 4YSSA 3RU8L 4X7DC 5AD0B 3A0OA 3L48A 5FW6A 1TF4A 3CZEA 1CFVL 3DJRA 3UTQB 3TBSA 2KI6A 3QQ4B 3B9KA 2NY7H 5DUBA 3VI4B 2KLSA 1MRFH 2P1YA 1L3WA 1YEHL 4WI9A 3KLHD 4H25B 4ODWB 1QNZH 3LQAL 4R2GD 2VUKA 4JFVA 4MMZC 3ZPDA 1ZKAA 3D0VB 3ETTA 3PWPE 4GO8A 4HQQH 2WBWB 3K6SB 3O3AB 5BVPL 2BNQD 3H7LA 3K2UH 4XXDA 5DK3A 3ISWA 3VQ1C 3TPKA 5HHOE 3RA7L 3U9WA 4F27A 5IV2B 3OC8A 3C9NA 3QIBC 2EDBA 5BZDA 3LZPA 5GZOA 5I1KL 2EXWD 1S7UA 2E3VA 2KDYA 3ASWA 2WTRA 4PRPE 2YQGA 2B4CH 4Z0BL 3CFBB 3S2CA 3ZGIA 1QFUL 4H88L 4ODWA 4HS8L 2OL3L 1WBXB 4PBDA 4HIHA 4OT1L 2A73B 4HS6B 3BUPA 5JA9A 3QFGA 2OW7A 4HKZA 4K8RD 4QRUA 3D2TA 1S8DB 3KPNB 4NRZB 4YSOA 3F6IA 5DQ9A 1KIRA 2ZSVB 4JANB 1HFUA 4ZMZA 3BISA 4ZMWA 5IV2A 4GXFA 4OM1H 3MLPA 4ZUUB 1MQ8A 2OYKA 1S7UB 1XD1A 2WJ5A 1QTYT 2PR9A 4W9ZA 5I1JH 3HVDA 2XXGA 1RI8A 4XNMB 5E56A 3QJHB 1M7XA 4TUJA 4CADA 2OTWA 1ZDSA 2MPAH 3M8OL 1G84A 4PRBA 4DW2H 1J48A 4NZFA 4BXVA 3FT3A 3RL1A 2BJMH 1UA6L 1WFUA 1M2VA 2ZWZA 1F4AA 2CNZA 2VDNL 1KGWA 1TQVA 1YA5A 4R84A 2X88A 4LU5L 2XOTA 1BZ9A 5SWSA 4Z7NF 5EZOL 5F7DB 2BNUA 1RSFA 1B90A 1WICA 3LIZH 3WMQA 3SY0B 4OZGA 1ZT1B 4KJYA 3RLSA 4JK0D 3WIHA 3I50H 3SBWA 2O26U 1AI1L 3AROA 3DX6A 4G8GE 3U2SA 3GSQA 1LD9B 2VM3A 2WQSA 4I9WD 3UEQA 3QIWB 1JDCA 4BFOA 5D1QD 1IFHL 3GUTA 2OMTB 5ID1B 3K72B 3L7FA 1F11B 2MHAB 4IBTA 2WGNB 1NAKH 3P11L 4XXWC 4JDVA 5HHXL 2Y25A 3F5WB 1NUNB 2ZCKH 1BWMA 2UYLB 2WBXA 1JPSL 3K6OA 4LLUA 1PD0A 3JV6A 2FATL 1MFAH 4C4KT 3S98A 5CCKH 4M7LH 4ZAKA 5F9JA 1ZT1A 4KJYB 5A3ID 2E7LC 5GGQH 4XAKE 4FQHB 3UTTE 32C2B 3TT1H 3JZ7A 5PAZA 1BAFL 1CJYA 1Q1JL 3GZOA 2CAKA 4HJ0D 2PYFB 3MV7D 4LHUD 4RGNC 1IGYB 2H41A 1TCRA 1DDTA 2BNRE 2W0FA 2JSFA 1VIWA 1WK0A 1A7PH 3FZUC 1NCDH 4CNIA 1X5FA 2XIBA 4V1DE 4FA8A 4PJ6A 1D9KD 5H2BB 2I24N 1CGUA 3VRIA 4LARH 3JV6B 3VE0A 4HSQA 1KXQE 1INDL 4G42B 2M26A 3PGFH 4IOIB 2VIRA 3QEUB 3IU3A 2F58L 4AZ8B 3D0AA 3HNVH 3TVMB 2ZOLB 1KOAA 3UPAA 1EO7A 1OLZA 4F9PA 1H3XA 1ZOXA 5IZ7A 2AI0H 4YAQA 3ZKXB 4CNIB 4UQCA 5E2VL 1H9VA 5AB9A 5ICYA 2GCYB 1OD7A 3EOTL 4NKDB 3LRLA 3MX0A 3X11B 3GIVA 4A6YH 5B22A 4LASH 1NCDL 4KVCL 4Z8FL 2BC4B 5F70A 1A6WL 4R2GC 3NCWA 2CGRH 5JLZB 2WHVA 2AZUA 1F2XK 1QFPA 4KOCA 3TVMA 1UACL 3ARPA 3M17B 3S2AA 3QUHA 3WJLA 1GS7A 3NCJL 4NZTL 2EKSB 1ETB1 5KJRH 1KXVC 2ZWLT 2NLJA 1TJHH 1BLIA 2BSEA 5E70A 3V6OA 1CD1B 3DNKA 2WTPA 2EXYC 1NFDE 3M1OA 4WI0B 4PCSA 1U3YA 4OLYL 4PSRA 1VKXA 2BW4A 5EUOB 4KHXL 6CGTA 2EE6A 2VZVA 1KYDA 2BVPA 1KXTB 1OAZH 1ZA6B 2OJ1A 4IRJB 1TZAA 1MJJB 1SN5A 4JGMA 4ODXA 5GSVA 3WY1A 3NIFE 5C0RH 2G60H 2OV0A 5JQ6H 1TQCC 1ZCRA 2DI8A 4LFHD 1F56A 4QIRA 1CU4L 4S1QH 4BH7B 1YMMA 5L2KD 2X41A 3K74B 4DETA 1KLFB 3WJMB 3UJJH 2ZICA 3EYUL 3GRBA 43C9B 3NCJH 1DVTA 3DIDA 3G9AB 1FFNA 3BDXA 4M62H 4PY8J 3SDXB 3LKPA 1GGIL 4RFNB 4UILH 5F0PB 1NFIA 1OF2A 2IANE 3CK0H 3QJXA 4QJ5B 1MW0A 2CCWA 1A6VH 4PN6A 4AW4A 3L4WA 4XMTA 5BUGA 3T0XA 4N6QA 4QRFA 3TO2A 3KM2A 4KK6C 3O4OC 3FOLB 3BX7C 2EIZB 1DQVA 5I30H 2EDJA 2NX5D 5BO1L 4UIKL 2NW2B 5TPWH 4IU2A 4LIQL 2VXTL 2A2QT 4HSAC 5D7JC 5KZCB 3SDXA 1P5UB 1RJYA 4HKBA 1H0DB 2FO1A 1ICTA 2E7DA 3CFTA 4DPBX 1YJDC 2VMFA 3UC0H 2C26A 4BELD 4F7EA 5KWYC 3TLRA 3K71A 3N2JA 4NKMA 1DJGA 3CH1B 3LDBC 5GGUA 3SSGA 4E41D 3PREA 4J4PA 3C8KA 3BN9D 4FQ2H 4U1LA 1JGDA 2Q7NA 2EIZA 1EJOH 3JTSB 3L45A 5HI5D 1HH9B 4XPFH 3KHQA 3P4MB 1UURA 5A7EA 1U92B 3P02A 2MQ3A 4J12A 3V4PB 4UQ3A 5K59E 2AEOA 4G3YL 3LKRB 5AVUB 3UYRL 2VR3A 3B7RL 1BZ8A 2J4WH 3F7YB 2KLRA 3DDGA 3RVTD 1DQJB 1PDKA 3BP5A 5F3HA 3QZNA 3ULSA 3Q0HA 5C0DA 2I60H 2KBGA 4U1LB 4YLCA 4IJ3B 5D5MA 1LO5B 4MMYA 3N40F 4WNSA 1EERB 4JFFA 4POUB 3UTSA 3KPLB 4E9SA 4OLVH 2AQSA 3P4MA 4TMPA 5C2UB 4ZNCD 3SGDH 3MV7E 2EEFA 3LIZL 1BPLB 1MUJA 3JTBA 4UANA 3SDDD 3FDWA 1JF6A 3LS4H 1FP5A 4XAKD 2HG5A 3QO1B 1R33A 3EXJA 2PF6A 5F7AA 3HB3C 1FBIL 4Y4KB 3TBBA 1PLAA 3CSPA 4ZI8A 1A1OA 2BHUA 4H40A 1MHEB 1G9EA 3PNWB 5KSAA 1WT5C 2CO7A 4LSQH 4TQPA 4UMSA 4FNSA 3GI8L 2J1ZA 3H6JA 2IAMB 1FZKB 4OZIF 3KLAB 4J3OH 4YSRA 1MFAL 3X1GA 4DW2L 2DH3A 3F7VA 1FL5A 1D5ZA 4F7CB 1DBML 1WD9A 4G6JL 4YDJA 3SDAA 5C3IA 3VWJC 4FXKA 2VDNH 1A6AB 1KUMA 3MBEC 5ABDE 2MSPA 1V3MA 3MN8A 3OHMB 2KZWA 1SXBA 4XP1L 3ME0A 3N43F 4P9ML 3NH7L 3QEGL 2DQGH 3QI9B 2LT9A 1XF2B 2QSCL 2CGYA 2SEBA 4RAUB 4WNJA 1SLUA 2EEAA 3W57A 4GXUM 1SJEB 4N8CL 5EB9A 5F3BB 5DJAA 3CFEB 3KLAA 2X28A 4HETA 4PG9B 1BQ5A 4LLWA 4PRIE 4P5RA 2O5YH 3PYCA 4YGAB 4HDIA 3DV4B 4PI2A 4QXGH 2Z8SA 4B5EA 1NCAH 1JG9A 1GYVA 3WE6A 1E50A 3NPZB 1U8LA 1LO3L 4K5MA 1TMQA 4I9XA 2VW4A 3CQFA 2X89A 1EXUA 2HTKC 5CN1A 3G7TA 5DLLA 3T3MB 2KLTA 2YARA 3HI6H 3RX8A 5I5MA 4EIZC 4B9KC 2L8AA 4FQLH 3I02B 2C7UA 4N28A 1NMCB 5E94B 2DQGL 1MPAH 4JR9H 2XNAA 1IKFL 1U8IB 2DMGA 4PJHB 4XX1E 5F9AC 3ZE1F 4AI7A 4UB0H 4ONHA 1XGQA 5CP7B 4UV4H 4EDWH 3U0PA 4R3SA 4PGJA 5F7HA 4U7MA 1EEZB 2A9CA 4YMPA 4MSWB 1FG2B 3NIDB 3CE1A 3QNZB 2LHAA 1UJTA 3OXRB 4FDWA 2AQPA 5A2IH 1UD4A 3UZQA 1NAML 4HS8H 3V6ZA 1T22B 4LNRB 2F9BT 5IFAH 4NN7B 1RZGB 2Z91B 5CZXC 1RJZA 4U4BA 5JNYA 3VD4A 4WW1B 4KOBA 3VFNA 3KL3A 5DO8A 3WTTA 4GW4A 5IGXL 3CFJB 1YMME 4MSWA 5AKVA 5TDPA 4UTAA 3TIDA 2J21A 1HINL 1WUZA 3QNZA 4B9IA 5HGHA 3BN9C 3CXDL 3FBKA 5F6IC 4BRVA 4NO2A 2BOCA 4PSPA 3DBXB 4CKQA 3H7BA 1KYOJ 4BZ2H 3HFFA 1JYXA 1MWAB 3QDGE 5AKSA 1ACZA 4WTZG 2R0ZL 5DZJA 3W0WA 5BVJB 4YFLF 4YBQC 3GRWA 4ZOAA 5KSBE 5KYWB 2E7CA 1IC1A 1M05A 4LSSH 3B5GA 1RY7B 1KIQB 5JMOC 4ZFGL 2R69A 2IPUK 4NIKB 3PFUA 4G7YH 4WCYH 1SQMA 5JXEA 3W1ZA 2MOVA 5BXFB 3OL2A 1Q9WB 4J3XA 2O4EA 5JMRA 1S5IH 2NY5C 5CEYA 1ASPA 4W9GC 2WWMD 1J0JA 3CFIC 5KBDA 2D03L 3DBXA 4J7RA 5IUCA 1S7RA 4GB9A 4UTBH 3SJVD 3K81A 4I89A 5C0CB 3QULA 1OXYA 2NY4D 1T0NA 3HA0A 1OP3K 2JNZA 3DVGA 4I13B 3RGVD 1OAUH 5C6TH 1E8YA 4KUZL 5D7IA 3EJCA 3DYMA 3IFLL 3X14A 3QQ3B 1EHLH 3ZKNC 1TSHA 4H8WL 1OSPH 1NKGA 3HG0A 2Y06L 6PCYA 2DTMH 2VDPB 4S0SD 1MG2C 2BZCA 4Z0XA 5MI0C 2X4UB 5JW3L 4LVHB 3QI9C 2B2XL 2JKRM 1GZHC 4NP4H 4JEGB 1GAFL 4MAYC 3R4DA 3QJRB 1SNRA 1G5AA 1KCLA 2XQYG 1XGRA 1I9IH 4JB9H 4D0CA 3QULB 1I8LC 3TZVD 2W94A 1LNUA 4N20A 3BJ91 5IVOA 4ZFZB 1F2QA 2YA0A 4ZMNA 3MRDB 4OGYL 1RUKL 3BIBX 4G1MB 4IMKC 4AVKA 3DRQB 3V0DA 2XVKA 4IHOB 1AR2A 1NPUA 3FB6B 1JSYA 3V0FA 1DFXA 4PLKC 5EU6D 1LO4H 3QORC 2FZ3A 5I1GH 2B3RA 2YGVA 3IJ9A 4HV8B 4NNXA 1S7XB 2WWNA 3GD1C 3LCYA 5HHPA 4XVJL 1M9WA 4IGBB 2HVKA 4N3UA 3QR2A 1ZTMA 3BD4A 3CSGA 4D9QE 3D51A 4X6FB 5CILH 5GGSY 3GXMA 4FTVE 4N87A 5GIRB 1CYGA 4MB3A 4RGOH 2CBOA 4YOKA 3MRDA 4PLJD 1UENA 3JVGC 2FBJL 1G9NH 3MHZA 3HR5A 4NQSB 5FFOA 2DLIA 4MRBA 3LS4L 4ACPA 4OQTL 3DTXA 4M1GH 4NCC1 3V6BR 5TD4A 4O58H 4KRNA 3EFOB 3LPOA 3U4KA 3VFOA 3R1GH 4NERA 1FZOB 1I1AD 1BOGA 4ZRGA 1J1PH 1E28B 1LJMA 5CGYD 1SJHA 1JD9A 3K5RA 1JPTL 2FLBT 4OZGE 3ZQXA 1ZSDA 2Q9OA 3FTGB 4Y19E 3HG2A 4ODVH 1EPFA 4DNLA 4JRYE 2WZPA 4DZBB 4AL8L 5DTFB 4DUWA 1MCFA 1X7TA 3TCTA 4NQSA 1FNHA 2X4SB 4D9LH 4XI5D 1FNEA 2DEYX 5BOPA 5HYJB 2BVEA 1NDGA 1M7IB 1W91A 3LV3A 3TOPA 3CFQA 5IMLA 4ZX3A 1LDSA 2CHXA 5EF1A 1NC2B 3V52H 2P7TA 5F6IB 3UAJD 1AP2B 1N5AB 1R6VA 1KJ3L 3FCGA 4AL8C 2B1OA 4N8CH 5AW1B 1ACCA 1N5YL 1E6JL 3TNMB 4DZBA 5FA4A 3K7UA 3DX0A 1VJSA 5K93A 2G60L 3MNWB 3VW3H 3US1A 4QRPE 5CINL 5FO2A 3CZGA 1IZKA 1E0OB 3DUSA 2NXZB 5L2KE 5SWZA 3LV3B 1FVEB 5C08E