2A9DA

Crystal structure of recombinant chicken sulfite oxidase with arg at residue 161
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
369
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
total genus 94
structure length 369
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9dA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9dA01
2A9BA 2CA4A 1OGPA 3R19A 2BLFA 2BPBA 2CA3A 2A9AA 2A9CA 2C9XA 1XDQA 4PW9A 3HBPA 3HBQA 2A9DA 2XTSA 3HC2A 1XDYA 2A99A 1SOXA 3HBGA 4PW3A 3R18A 2BIHA 2BIIA
chains in the Genus database with same CATH superfamily
1T1YA 3TIEB 5I18H 2XWJB 5BRPA 3IGAB 1I3VA 3S98A 2FWOB 5TDPA 5FGSA 3FB5B 3FQUB 4PJ9A 3KYKH 5GGRB 4JFDB 3ESOA 4UNUA 1ZV9A 1PIFA 3T2NH 3RWCB 5HGAB 2FVNA 5JW5B 3QFDA 4XZ4A 1U91B 3HUJA 3NP3A 3ZKNC 4Z7NF 3AW5A 3ZHLA 1X5ZA 4MA8L 5SX4I 3ZMNA 4F15C 4GG6A 2VR4A 3L4UA 4P8QA 4C56D 4P57A 5FX3A 1OAZL 1D7BA 3HG4A 1HZKA 2B8OT 4JFOA 4NP4H 3KYNA 3QWOB 1FAIL 4YSOA 5B22A 2BSRB 2DI8A 2I69A 3VXME 4K9EH 1YEGL 3IBEA 2BS71 2JELL 2N3JA 1PG7H 2WLLB 3I84A 4HJIA 3V4UL 5AVWB 4HGKC 3PWPA 4YSUA 1WE5A 1T5XB 1X9UA 4NRXB 4F7CB 3SJVB 2Z0BA 4BH7A 1ONQA 3KYMA 4D0BA 2BZDA 2JLLA 2OJ1A 2WINB 1L9TA 3MC0A 5ANMA 5I6PA 1SDDB 1YNTF 2EDNA 5EBLB 3NJXA 4PB9H 2KQMA 3VYNA 2F7IA 1T7VA 3ZIMA 2FYYA 3UTTE 3NYKA 4ZUTA 3QXAB 2IXQB 3WNIA 2VAAA 1G7IA 4GMSH 1RJYB 1QZNA 4OUUA 2VIRA 7FABL 1Z9OA 4E9RA 3C6LD 3CSFA 4M1DH 3RGBA 4CN4A 2OR9L 3IJYB 3QJHB 4YSTA 2VISB 1BQHG 1BVOA 4GRLB 5IR1A 4BJLA 1O9WA 4MJ5B 1Q0EA 1DBJH 3K6OA 4HJ0C 1GJUA 2PR9A 1WTGT 4PJAB 1LLAA 3K6DA 5JMRA 3MKGA 1SN0A 4OLZL 4AENA 1EO8H 3G08B 2EUXA 4CN1A 4N9GB 1JDDA 3FQTA 3MLZL 1MLBA 4Q52A 2EICA 1INQA 3VRLF 3DX9B 1BZQK 3K4ZA 4F7MA 3LPPA 4JN2A 3TEUA 3PV7A 4AV0A 3BD5A 2DYPD 2IALA 3BKYL 3HUJB 2DLFL 3PP3H 2R1XA 2WXQA 4UM9D 4F33B 4FA7B 2CLVB 1AR1C 4Y19A 4LAQH 1U21A 3UTSA 1ORQA 4P57B 2CMRL 4ZOCA 5AYUL 3W0WB 5CCGE 1JNNH 3K6IA 2BNQB 1HEHC 1OPGL 1RUKH 2VW6A 2MPAH 2L7UA 5I16B 1BJ8A 2OMTA 4ZTOH 4XBGB 2VJXA 4EIGB 4N68A 1W72B 2FQDA 3T08A 1NBQA 5DMKA 4KZDH 4DZ8A 4JY4B 2YN3A 1QTYT 3KYOA 2BSSA 2G2PA 3QQ9D 3VG9C 1LO5B 3TF4A 3CFCH 4KRLB 2QZQA 4J7RA 4JRYA 3VXRD 2FCBA 5D7KE 2Z31C 5EUOF 2QEJA 4D0BB 2G5BB 3VSVA 1JHLL 5FYKD 4F8PA 1UCBH 4N6RB 3TN0A 3CFEB 5CSBA 1YQVL 1ZLUH 5FHAH 2H3NB 1EEYA 2UZXB 2XUWA 3G7TA 4JGMA 2Y6SC 1F90H 4HK0A 2F19L 4R7NA 5DI8B 1E4HA 1NCTA 2OYPA 5T1KA 5I0XA 2AV7A 1JPSL 5SX4H 4AM0A 2XKNA 2QSCL 2A6KA 5FYKL 5DJ8A 2RJMA 4Z3HA 3T6QC 1MOEA 2FQEA 3JWDH 1H5BB 2N7AA 3THML 3MV7A 4EZMA 4B0MM 2CBMA 3IKCB 5GZND 3FU3A 1KLGA 1T04A 1YEIH 5IM7A 5BMFL 3HC4L 5J11B 4X98B 1Y1UA 2BVQA 2OMWB 3CVDA 4HKBA 4RRPM 2A77H 2VLJE 4NZRL 5HI4D 5HHOA 1CDGA 4QHMA 4OTXH 5B38B 3Q8FA 5LHDA 4B97A 2NMSA 4IOFC 2JSFA 1T66D 2X4TB 1TTGA 3TURA 2H9GA 4F7MB 4DGIL 1MI5D 3GSXB 3ZSTA 4HWZA 4XOBA 4JRFA 4JCLA 4A6YA 1N0XL 1F02I 4B7IA 4DUWA 5HGBA 5EZLA 5GRVL 2IALB 1NMBL 4BWUA 3B2UD 4XNUH 2J73A 2UXGA 2E5EA 2VLLA 4F2ME 4JPIA 4Z9KB 1SJEA 3VXSA 5BCAA 3F58L 2W07A 1I1FA 5D4JA 1KN2H 4XH2B 3PYCA 4JM4L 3ARQA 1NGZA 3IJSA 5ACZA 1IKNA 5EFIB 1FG9C 4I89A 2DJMA 1GC1C 2BHUA 3TFKD 4B9IA 2HWZL 4G7SB 2XTJD 3LIZH 3P77A 5FYLD 4ZMTA 3OHXC 4IBLT 4XO4A 3V6ZB 3WO4B 5KSAD 2IH8A 5DS8B 5IHWA 4Z7UF 4L2LA 4KO7A 1J0KA 1E9PA 7PAZA 1CYXA 4QRTB 4UM8B 4FTVE 1KEGH 1TZAA 2EDWA 2HVJB 4JPKH 4XPFH 4PJCA 5C0CE 5FYLL 4ZFOB 3ULSB 3T09A 3H3PL 1LL1A 4NC0B 4R7NB 3N85L 2H2PC 3CG8A 4Z7VB 5BS0A 1FVCA 1HH9A 1F11A 1V5JA 2OTPA 1NDMB 4Z7QB 4UQCA 2ADGB 4IRSD 3SGDI 5HJBA 3KWUA 4JHBA 3EBHA 2VDNL 3IDIA 1IVTA 2XQYG 4IJ3B 1U8PB 1J5CA 3RHWK 1XGTA 3WIHH 1SYVB 2P5PA 5D1XA 3QI9B 5DJ6B 5IK3A 3IXTA 3LZRA 1LD9B 1RI8A 3MOBL 4OCYL 5E8DH 5LB1A 4X5QA 2EXSA 5F9AC 1UWYA 8FABB 4CMHB 5H2BA 2ZF9A 1EXHA 2H9GB 3TEXA 1KGJA 2WLIB 2CRMA 3WD5H 3EDEA 4TLKA 2Q7YA 3DPBA 2WSDA 1MNUH 3VQLA 1Z5LB 1TZIA 4DTGH 4XOEA 2JQAA 4XXCA 1XH1A 4KQ3L 5HVWA 5I8OH 2PPEA 1AQKL 1GY2A 1GW6A 2K3TA 4L8SB 3HS0A 1OAYH 4FFZL 5CNHA 4OIBA 2XV0A 1I82A 2WIIB 4DP7X 4PJ8C 1I1FB 1JD7A 2W0KA 2BHFA 3DETD 2G0KA 2V7HA 3EH1A 3IJSB 1OHZA 2AJYL 1HESA 1KZQA 4PJ5B 3C12A 3CSYB 4OBRA 2FQFA 4X2UA 4X9YA 1Z2KA 3B7YA 1N8ZB 2J72A 1DBBL 4WGKA 3P77B 4GOSA 1KYDA 5EPMB 4H25A 4N1EA 4K3GA 1VB9A 3O6FD 1TJHH 2CA4A 3VFRA 3KPQB 2R0KL 4FULA 4R97B 4B6ZA 1OXYA 3WAJA 4MCYB 5DJDB 1YMHB 5AW0B 4JB9L 3FSWA 1NOAA 5AZEH 1E4XL 2YAMA 2ZUQB 3OKKA 3OLDA 1U92A 4H2AA 2F15A 2FSDA 4L3EB 4AJ0A 5KVDL 1Y18A 1AGFB 1D6VL 2Y7NA 3CPUA 4YHZH 3IDIB 1MW3A 5DTFA 1CF1A 3WSQL 1OF2B 3DK2A 1A1NA 1MFDH 1IGIH 3ARFC 2OYKA 1R5IA 1SEBB 4OD3H 2QSQA 2WZAA 3MRRA 2AVGA 5CLWA 4AG4H 4APQB 5CJQL 4QF1B 4FFYH 5FYJD 4HJJL 4KJYB 4JFTA 3QXTA 5D9SA 1GSMA 3KL5A 5BZWB 3EH4B 3EH5B 4XWOD 1DBMH 5TDOB 3TTYA 2B2XH 4LL4A 5I23A 3D0VB 5KBKA 1E9OB 5FYJL 3NBNA 1WA2X 4HIHA 4UZUA 4F20A 4MZRA 3DRQB 2CBTA 2VR9A 3NEEA 4I87A 3TA3C 4UT6L 3Q2NA 4QRBA 3RNKB 2DIJA 5AQ0A 4ETQB 1E30A 5D7IB 1SF3A 4IBSA 2L7JA 3NCJL 2BHYA 4V11A 4HOMA 1G84A 2YFOA 1MW1A 1ZHNB 4GXVL 4D9LH 4UDUA 5EIVA 3C60C 4JO1H 3RWFA 3NRQA 4A7GF 2E8YA 4WDIA 4JFYA 4PFEA 3MNDA 5DK2B 5A2BA 3TGXA 2X4SB 3DIVA 5F70A 3BKCL 3WJMA 5J13C 4M5YL 5BW7A 4E42A 4ANUA 4EUPB 5EULV 4MAYC 1FFPB 1EIBA 2NYYC 2QPUA 3CMOH 4LQFL 1J1PL 2G5UA 4K8RD 4J2XA 1USQA 5EUOE 1RJLA 5KTEH 3ULUC 1MJ8H 5BQDA 1QLRB 1SQ2N 2VDPB 1R5WB 1A1MB 3UABA 2HT2C 1U92B 5IVXF 1SFHA 3RFZC 3U82B 3QZLA 4K8RL 1DSWA 2M26A 4I18A 2XN1A 4TRPH 3PREA 4IKJA 1BYOA 4HXAH 5J6SA 4WK2B 3QZNA 4BE6A 4IHOA 3T0EE 4AY0A 5ABDE 4YHNB 3AQDA 4HUXA 3QIUB 3VGDA 2AS5M 1YYCA 3E9UA 1XSIA 2X5PA 4CGUB 3RY6C 4OCLC 2OMBA 3D07A 4PJAF 4RNRB 3JTSB 1YNKL 2HFEA 4KTEH 1M71A 3ILQD 3TCLA 1IQWH 5F1IA 2EO7A 5E08H 5HYQA 4N2AA 3ZYJA 2QGBA 5JA8B 4X8JB 2BVUA 4KY1H 5JW4R 1Z66A 2AQRA 4UCFA 5F7WC 4BQ8A 4FJ6A 3FO1A 3OXRA 2ARJA 4U7KA 4AEIH 3NZSA 2C3XA 4ZT1A 4IMKA 2ZUXA 1A9EB 2AXJA 1RIVL 3RIFF 1V7ML 2P48B 1T3FB 2YPLA 1N4XL 3FU0A 2W60B 2JKXA 3D3VA 2M2DA 3N9GH 3RVTD 1SYSB 5DWUH 5DMJB 5EF2A 2VQUA 3ZXAC 4G9DB 3QRGH 4U7MA 4L8DA 1C5BL 4FG0A 1J0HA 3NACL 4KHXH 1BOGB 2H3XC 3WJMB 1M2OA 2X9XA 3CVIL 5C0AD 1HQRA 4OQ1A 2WXGA 1GRWA 4WCYH 4Y4KB 1X9QA 4JG9A 3ZYIA 4NQCA 3DRTB 1FSKC 4QY8B 1RJLB 3BAYA 3LNIA 3GMLB 1KPUB 2BDNH 2WBJA 4KNQA 4AVHA 2E6QA 3N04A 3D50A 3OSKA 4FLOA 3DURA 4ZNEA 1G7QA 4KO5A 3V4VB 2CDFA 3NZHL 1UOKA 5I1JH 4HS6A 1AY1L 1KB5A 3CDGA 4HDIB 4I18B 4ZO8A 1OOWA 3LPFA 2F61A 4RETB 4D0DA 1ACZA 2H26A 2GG1A 4LSPH 4WHCA 1UXMA 4YBHA 3RTQA 1U8QA 1J9SA 3HR5A 2A6DA 2E27H 2PYEE 4R0LA 5CD3B 2IQ9H 3HCVB 3VGGA 3ARUA 3X3FH 3IMSA 4A7SA 5D7JD 1YECH 3RA7H 5FFOA 2JI1A 2IPTH 4WNQA 2OJEB 3GIVB 3N3EA 1HQ4A 2HFEB 4MJIE 4HUUA 4ZG1A 3TCLB 2LT9A 4MS6A 5K9KA 5C6TH 1NKGA 1I7TB 3PUCA 4AQEB 5L2JA 1N70A 4JLRB 4U1MB 1UVQB 2IBBA 3T3PB 4WV1C 2WZ6A 4JO3L 1GHFL 2NNAB 4X6CA 3N0AA 3JT0A 3MGOA 1OO2A 1IFRA 1OP5H 2NY0C 5MI0B 3PQYB 3UTPE 4ADGA 3SBWA 4GO9A 3VMNA 2Z93B 1IAKB 1P7QB 4MNQD 3UBXA 4Q8BA 1FYTD 5CEZE 1FFRA 2W80C 3TJHD 3MYJB 2KLTA 1JF6A 1KUMA 4MA8H 3GSOA 4XAKD 4L8DB 4BUQA 5ESQB 4QD2E 1MCLA 3WNNA 3F7VB 2V4LA 1OAZH 4RFOL 4BZ2A 5D93B 4XN7A 4GMTH 4NLAA 4Z3EA 3BFOA 4NUJA 2P44B 5D4IA 2AEWA 1FAIH 4P5MA 4AQ8C 2F8VA 1MY7A 3BQUA 4NQTA 5CBAA 1YEGH 2YD0A 2VO5A 2YAPA 3ARDB 2MOGA 3GRWA 5E6ID 3V4UH 1RLWA 3L1OH 2NT0A 3US0A 5EOCH 3MACL 4IBQA 5DJ2A 4AYDC 4ZPTA 4Z7VF 1BA9A 4Q9BA 5ID0B 1AR1D 4KK9C 1H3VA 3B7SA 3O2DA 4Y0GA 4Z7QF 4G8EA 5FPIA 3AMKA 1CDUA 1XH3A 2YBGA 4Q2ZB 1WBXA 2KS0A 1OCRB 3S35X 4P2RE 3IMTA 3FYEB 4JG0L 3U0WL 1PG7W 5GJSL 2R2HA 2VQ4A 3IGKA 3CLFL 5HDBB 3QULA 3RTQB 3U1PA 3VXNB 1U8KB 1GKEA 1WIUA 3DROA 2QGDA 1D7DA 2H1XA 2WB1A 3TVMD 2OR9H 1RZQA 5F3BA 2HKHH 1HQ4B 3VXTB 4HS8L 4OLXH 2JJSA 3H9HA 3NSDA 4FP8L 4P2YA 5JO5A 1TQBB 3ASOB 4HETA 2Y6SD 3MLXH 2X28A 4OLZH 1QLEB 4TOYL 3Q05A 1MCWM 3S2CA 4X6DA 3VX0A 3MLZH 5E9AA 3VXOB 1IM9A 2FJHB 2VC2L 1WBYB 2A7BA 2XETA 3HG1A 1O75A 1QHQA 2OR7A 2PW1A 2K45A 4BSVA 1EHLL 4G1EB 3ZT5A 4J3TA 3NJIA 4FYRA 2VLKE 3BKYH 3B6SB 5GHWH 1UJ3A 4NKIL 2EILB 3VFTA 3DV6B 2B0SL 4GYBA 4PRAB 3FUJA 5IBUG 2CMRH 4HJ1A 5AYUH 5I6MA 1QX1A 4KC3B 1OPGH 3TCXA 1OT1A 1JTTA 4F7KA 4EXKA 4RX4D 3HI5L 2OYMA 3OLEA 4M3JA 5AVSB 3QDMD 4B9CA 2PR4L 1OSYA 3H42H 1TYJA 4TUUA 1LO3H 3NCMA 1P9MC 4K71B 4NKMA 4F7TA 4PVLA 5GGRY 2ATKA 1E2WA 3L95B 2B3IA 3K6SB 4CJ0A 3B9AA 2FHFA 3QRBA 2NX5D 4MKTA 4CJ1A 2JJTC 3CXHK 5LVEA 3EGSA 1HSBB 1QFUL 4WKXA 2X6CA 1RJZB 4NQED 4LSDA 5DMGC 1JHLH 2DF3A 4B9PA 5IOPA 1KY7A 3AVEA 4QRRB 3CFMA 1CDYA 2J71A 5IVXE 4XMPL 4ZOEA 3BVTA 3IFOB 2PP7A 1BQUA 1F4WL 1HHHB 1W0YT 1EEUA 2F19H 4L37B 4DJMA 4EI5A 1EHAA 1SGKA 4QDGA 2UYLB 1AE6L 2R2HB 4AYFA 5J9PA 2QSCH 4K3HA 3QULB 1XSJA 5FYKH 2LOEA 3VUAA 4XB8A 1U36A 1XH0A 4H8PA 1Q0XL 1Z0MA 2WZPA 1TOXA 3MNMA 3IN0A 1MAMH 3LMJH 5HVGB 2UV3A 1FO0A 1IX2A 4X42A 3THMH 1JMXA 3A0OA 4P5TA 4HZLB 4AKQA 4L4VA 3GO1H 3GHEL 2QFPA 2H32A 3C08L 1R47A 2WTRA 5BMFH 1GC1L 3HC4H 2GI7A 3VD0A 4WU7A 2GBVA 2A2QT 4M7KH 1BAFL 3WFZA 2YXMA 2BWQA 2UY7B 4PJAE 2ZOLB 4KVNL 4CKQA 3PAYA 1DSYA 4NAJA 4G43A 4QOKD 1D2OA 2X4QB 4N2NA 5FW8A 4NO0D 1QFPA 3U9PH 2AV1B 2ICES 4WW1A 1IM9B 1ZVSA 2EIEA 3KEDA 5LCVA 3V52L 1IGTA 3DWTA 4AQOA 4G71B 5F1NA 5BRZA 2I9LB 4DGIH 2FATL 2PW1B 1KYOK 4LLAA 1N0XH 4NQXA 3T0EA 1T1XB 5I6OA 5IQOA 5EN2B 4OIIL 4DZBB 3SE6A 4M7ZC 1NMBH 3ISRA 4XMZA 5HDLA 5C0IB 5DK0A 2XPYA 4FZEL 3BJ91 4Q89A 4JPWH 4ONHA 5GGSA 4ZYKA 5KYWB 3X11A 1LDPL 3F58H 1ZTMA 3CZGA 3W9DA 3LAFA 1H5BC 3MBEA 4JM4H 4N2MA 4WFFD 3FT3A 1MY5A 3HNVL 3GMOB 1OTTC 4F3FA 1DDTA 1S7WA 1CQYA 1MAJA 4F7TB 2GJJA 2NR6A 1NQBA 1N5YL 2HWZH 1XZ0B 5J11C 2WTPA 5EC1A 2ITEA 1NUGA 4FNTA 2HRHA 1GL4B 1HU8A 3I02A 3H4HA 3V4LA 4C56E 1A1OB 2BNRD 2WN2A 3BPLB 3MJ8B 4E9XA 1MRCL 4PCTA 4EN3D 1SHMA 1E6OL 4LCWA 4PGBA 5FYLH 3H3PH 3N85H 3MDJA 4EI5B 1RUAL 3TBSB 4PV8A 4AYFB 4ICWA 4PTUA 3WXWL 1CBJA 4JDTL 4MRCA 3GWJA 3BGAA 3FFOA 1F0LA 1BEYL 3QHZL 4FFWC 1R33A 1XR9A 4KJWD 2YEVB 3B3IB 3T2PA 5IREA 4A38A 4QEGA 3JV5A 1VHPA 2DH3A 5F7HA 1H3TA 1WGOA 4QO1A 4TULL 1XGUA 1VGKA 2R29A 4KUCD 4U1SB 3P0VL 4XMKL 4B9ZA 3O9WB 3ILDA 4L4JA 3RVWC 2IAMA 1P7HL 4G43B 5A2IH 4L23A 5I5RA 3INOA 5A2KH 4PGJA 4NS0A 2VWEE 1RXLA 5E1AA 3RIAF 1NEPA 4ABUA 4HKZA 2DLGA 2VAJA 4EAEA 4I7ZC 1I8UA 1QSEB 2IOIA 4N2EA 5DRZB 2FAUA 4KQ3H 3RVXC 1AQKH 1T7ZA 5DK0B 1DBKH 4FFZH 4LLUA 1ZLVK 4OKVB 5C8JB 3KGRA 4FXKA 4FQCH 4TNVF 4LCYA 3I9GL 1EDQA 3MBEB 4JL2A 5EMYA 1BF8A 2AJYH 4LHUB 4G8GA 4L9DA 4R6UA 4IJ3C 4QXTB 4RGNB 1PS3A 1YY8A 2ZP8A 3GGWA 4FDWA 5C0GB 3S37L 2AITA 1HHGA 1KY6A 4X4XB 1T03L 1DBBH 3VGAB 2Y3AA 1MFAL 3H9SB 3KZ8A 3DJSA 1MDAA 3PWNA 3QI9C 2R0KH 4J39A 4LLWA 1S7QA 3L4VA 2BCMA 5C0NC 5AW7B 4X6FA 5LBSH 5FUCE 1P1ZB 2GSMB 3RWEB 1CLCA 1ND0B 3X17A 1E4XH 4Z7QE 4N0UA 1IGFL 4JQIA 2VLMD 1TTCA 3DX0A 4W9HC 5KVDH 4FOMA 5EIIB 1D6VH 1ES0B 5KSBB 4L8SC 3VXRE 3S3CB 4A2LA 3WDIA 5IFJB 3VXUA 3KPRA 5FYKE 3WSQH 2JH2A 4Y9EA 4AKOA 1DQKA 2HKAA 2ICWI 1VGKB 2DOCA 2HT4C 2WLNA 3B43A 3L4ZA 2VE6B 2VABB 3WIIL 3K46A 5C0EB 1RKRA 1REIA 4MJ6A 2F1AA 5CJQH 2X6MA 3MRFB 5CLTA 4HJJH 1U6AL 3T3PF 4A66A 1R5VB 5FDWA 5E1AB 2HT2D 5CD5D 1WF5A 5K9OA 1W0VB 2W92A 4KDTA 2ZWZA 1MCFA 1A3RL 4R97C 4UIMA 2CPUA 4DIXA 3OR7A 3ZR5A 1L6ZA 2VN6A 3ULUL 5D2NA 5FYJH 3TWYA 3P30L 2QR0B 2FEJA 1JRHL 4ZMOA 5EOQL 3VXQA 4N8PA 4JCMA 3FRUB 4UT6H 4IEFA 3OG4B 4M62L 4TQ8A 5L2KB 2LGNA 4YR6A 1RPQA 4MVBD 4NN5B 1J0IA 5EU4A 3T1FA 2G3NA 4GXVH 4JJHA 4LCYB 4LLQA 1NL0L 1B0WA 4FQPA 1P4LA 1NAKL 4G8GB 3TLRA 1AKJA 1MI5E 3GGWB 3VNYA 2WSPA 1AI1L 2DRUA 5E5LA 3FRPA 2DI7A 3HA0A 2MQ3A 4BZ1A 1QSVA 1DL7H 2EXTA 4M5YH 5IW3A 2PCFB 4IRZA 3DSFL 2EYTB 1SOKA 2DWEA 5KS9A 1WZ1L 4LQFH 1J1PH 3KGTA 5F88A 5AZUA 3SPVA 3TBVA 4XXDB 4ZPVB 4G9FA 4X6FB 5KN5B 3IU3A 3OAZH 2D2OA 1J05A 1DANU 2EDLA 2HB0A 3MRGB 3AWGA 5HHMB 4MS8C 4G42A 4L1SA 3VA6A 4N0UB 5CAYB 1JHTA 3FCSA 1G6RB 3W9EB 2VL5A 2XTJE 2XY2A 2J1XA 4RVBA 5FYLE 2W65A 4K8RH 5HDBF 3S36X 3HS0C 5CCJA 4N2OA 3CH8A 3NAAL 3FQWA 3QJOA 4Y5YB 3L3GA 4OZIB 2X4NA 3VFGL 5C9KA 3A4AA 3RL1B 3VDBA 4GW4A 3AGVA 1XCTA 1FE8L 1EERB 3HZMA 2TRYA 4OZFA 5B21A 4ZK8A 1IILE 4MJ6B 1N64L 3B7RL 3ZKMC 4OQTA 4DP1X 3DUUA 4XPTL 1YNKH 2V9QA 1RK7A 5GRWA 3QFJD 1A7PL 4M3HA 1PBYA 2EVGA 1C5DB 3W56A 5DVLA 1NGQL 4MB4A 3V5DA 1Z9MA 4NQDA 4DQAA 1PCXA 4G7YL 4NZ8A 3U0PA 4RZKA 1LMKA 3ULVF 2OV0A 1SDAB 4K94C 4JFVA 3OB0K 2P47B 5E8OB 5HDOA 2Y7MA 4YHLL 4N2BA 1TZOA 4OW6A 3QIWA 1BFVH 4FQXD 1BXUA 4IKIA 3CQFA 1V7MH 1NGYB 1RZGA 3D25B 4K0OA 4R7XA 5DVKA 4H20H 1N4XH 2R69L 2NY3B 2QQNL 3CDCA 1G7HA 4R9HA 2IGLA 4I0PD 2YWZA 2AQNA 2NY2D 4OJCA 3ASNB 4MMXB 1I8MB 4JGJA 5F93C 4KZEL 1LE5B 1YYML 1C5BH 3NACH 1YC7A 3FRPB 1HI6B 5INCB 5GGUB 3ARED 1SUHA 4GKZA 3P2BA 3SKMA 1EGJH 4DPRA 1DQTA 4K3EL 3QIUC 1ZANL 1IAOB 5CIPA 3CVIH 3NZ8A 1TZHB 4XNDA 2C9AA 5TDNA 4GRMB 3FC8A 4HSQA 5KS9B 2VL4A 4H8UA 3TBVB 1XF5A 2IFFL 2AHIA 3IU3B 4GIPD 4PJEB 2EDHA 1S5HA 2C3WA 3L3IB 1G9EA 1VF5C 4J3OG 2VL5B 2DMGA 1L9MA 2N1TE 4HHAB 4CDGC 1UKQA 4JKWA 1T2QL 3KPNB 3UX9B 4N4YB 1BD2A 1SXCA 3NFPA 2YQ2A 3NZHH 3P3SA 5J6GB 1JGDA 5L8JB 1AY1H 3L5WA 4O2EA 1JPEA 2GBUA 3SPJA 3O3AB 4PW9A 4JKKA 1WC7A 1HHKB 2Y7LA 1TJMA 2LE9A 2FB4L 2X1QA 3D08A 4OLYL 4X8XA 5FUZL 4HS3B 5TE6L 4GW4B 4OB5L 3VRIA 5GRUL 2FH8A 3ALXA 3CTTA 4OZFB 2CKBA 1A4JA 1I3UA 2W88A 4OZ4A 3RUGA 1BZEA 4HLZH 4DP2X 1H3XA 1XB3A 1DQML 4NUMA 4XTRD 4FLSA 5HHNB 3DUUB 3CFKA 2IGFH 2P42B 3GI9H 4M5ZH 2B77A 1U93B 4CUCA 1S9YA 4KK9D 1YVLA 4WFGD 1DVSA 2P3YA 4ODXA 4Y4KC 1PAZA 3WY4A 4PRPB 4NQDB 2WQWA 3QCUL 5L6YH 5CGBA 5E00B 4D0CB 1MCQA 2EQDA 4Q6IA 4JO3H 1GHFH 1G9ML 1VACA 4PRIB 1QLFA 1JZ6A 3MNZA 1DYZA 2YS4A 1M6OB 1NM4A 3CU1A 4UTBL 1NCJA 2X44D 2BY1A 2IJ0C 5F7YC 2GTWB 4AH2A 4MKMA 4P23D 4A2EA 3FN3A 1GS8A 4I18C 4XPGL 4OZGB 4FGMA 4KI1A 3MUUA 4U1HA 1E2ZA 1KXTA 2Y7QB 4OIFA 1JF5A 2UXTA 3K6FA 5E6ZA 1WEJL 3VFSA 3SKMB 4OGAC 4RFOH 2Z92A 4JO2L 3AS2A 2WUBH 4ZUSA 2GSGA 2I5YL 2OMUA 1CFQA 1L0YA 1SMOA 1XWVA 2E9WA 2GCYA 3Q48A 4N1CA 3PJSA 4XHJC 1XF5B 5A40E 3WJLA 3HI1B 1U8NB 2I26N 5AOLA 1S5HB 2BP0B 4ONFL 1G7MB 1AQMA 2XLLA 3KDMB 1IGML 4H4NA 2Q7NA 3ZTDC 1G7LB 3AG1B 1JPGA 2JIXB 4XAWL 3D33A 1HL9A 5EO1A 1JGDB 2C1OA 3LRMA 4IMKC 2ZCHL 5MI0C 1VFOA 1QR1B 5AD0A 3U0WH 1MWAB 4J27A 4JG0H 1SOXA 1UOWA 1D5XB 5GJSH 5KVEL 3CLFH 5CINL 3VO0A 4ONOA 3ABLB 1PD0A 2DV6A 2QQLH 4X5WA 3D4YA 4OD2B 2WZ5A 2CKBB 2KZBA 2D3JA 3TO4D 3SPIA 1ORSB 2RH0A 4Y1AD 5DUBA 1FHNA 1Q9WA 4J8QA 3DYPA 5D93C 3I9PA 4HS8H 3PP3K 5GGQL 1CI3M 4LE8A 1DJSA 3IDJA 4CSTA 3HE6B 4FP8H 3T3PE 4LB8A 4Z6AT 2A74A 1I3GL 4PJ9D 1K2DB 1E4KA 3QQDB 4RWYL 4Z78B 5ID1B 5IHZA 3ARDC 4K5NA 5IW1B 3QZPA 4XP6L 2EKJA 4TOYH 3VH8G 2YR3A 3W3BA 2EECA 2DD8H 2OL3B 2XA8L 4EZKA 2VC2H 1IKOP 5C07B 4XVSL 5E9DB 3VSQA 4KUZL 1F5WA 5JYMA 1EHLH 3TEWA 2AVFA 5DEFB 3RU8L 2B0SH 4WW2B 1KXTB 2ZYSA 3QDGA 1ULVA 4MMZA 5DSCA 1JE6A 3RTQC 4QKXB 2Z4QA 1ZLUK 4DO5A 4I2XA 4YSSA 1I3RA 1KSRA 1MFMA 3AY4A 3SODB 4PMFA 3EF7A 4Q4IA 1C8PA 3HI5H 1OKEA 3PWPD 3TEYA 2XWTB 2SODB 2ZJSH 2PR4H 3HC3L 4UMGA 4OJAA 1KIQB 5H37H 2P7TA 2GCYB 5KYYB 5BOPA 1EFXB 5I1AA 3PUUA 4HWEL 3KWXA 2JI3A 3EW3B 2I27N 3LKQA 1ILSA 2BS9A 2CO4A 2E9GA 3NSYA 1TQBC 3BWAB 4JDVB 4KO6A 3X14B 1FGNL 3BVNB 3VE0A 4ODUA 1MG3C 3MCYA 4PG9B 3LKRB 1KJ3L 2C5DC 2V9UA 5D7LA 5FOJA 4Q9QL 3QG6A 5EHFA 4JUTA 2QL1A 2A4EA 2JKSA 3D87B 5EORL 4JQVA 2HYMA 5C0AE 4CMHC 4XMPH 5E0QA 1NBCA 5HYIA 4Y16A 4KXAA 4N8VG 1F4WH 3VD1A 5AD0B 2VDML 5EU6B 4DH2A 3HNSH 2VW4A 4MCZA 3MUHL 3QRLA 4F57L 3ULVC 5DHXB 1OTTD 1RZPA 1ILUA 1JNJA 5GGVL 2ENJA 3CFDA 1Q0XH 3LB6D 3JVGA 1TXKA 2YGVA 3QNZA 4F8QA 3ZHNA 2BNUB 1UHVA 5K9JL 3GHEH 5F9JB 3NRFA 4KKAD 4RAUB 4PI0A 3C08H 3PNWA 3AC0A 1GC1H 4GUPB 4PJXB 4PP1C 1BAFH 2APSA 2J1KA 3BKJL 4GO8A 2NUPB 5H37G 1AC6A 1U2HA 4KVNH 2RQEA 1U58A 4X7TB 2IOMA 5IHZB 3ZGHA 4G5AA 3C5SA 5JHLA 1NUNB 1S7SB 3V52H 4RMWA 3K2UL 3E6HB 4FFWD 4Y19D 3EYVA 4TLSA 5AW5B 3IDNA 5ENWB 5PAZA 3UTSD 2FATH 4LLDB 4OAWA 4OIIH 4U1JA 1F56A 5AYTA 1KGYE 4LKXB 3GFUA 4TUKL 4MHHI 7CGTA 3QDGB 5DSCB 3GLAA 1YY9D 4FZEH 2D73A 3OGCB 4EN2A 3BH9B 5E4AA 1LDPH 3ALPA 1X5YA 4ZW6A 2AZUA 3VCLB 1A3ZA 3LHPL 3TIDB 3LSOA 3GSNA 2QZ5A 3HKFA 1CMOA 2YD7A 3HNVH 4H0HB 4HH8A 4JRYD 2OTUA 4EI6A 5I1AB 1F3JA 2R1WB 2CCVA 2Z91B 4MNQE 2APFA 2WBKA 4XT1C 5D1ZB 1E5YA 1FYTE 3TN0D 4JZJA 1UZ6F 2ZUYA 4QXUL 4XAKE 1JPFA 4ODUB 5K59F 1OE3A 2HLAA 5BQ7A 1WA0X 5T1KD 1AXSB 1MCNA 2WYIA 1YEKL 4HPYH 3T0XA 3TZVA 1EV2E 1D3CA 1MRCH 5D1QD 5IBLD 4AGQA 4AX3A 3WN5B 1E6OH 2PYFB 3KBPA 4Y16B 4MD4B 4MFHA 2AEPL 5LAXA 3MV7D 1RUAH 4MCZB 1FVDA 2QSTA 3WXWH 1DJYA 4CC4C 4OZIF 1JRHI 4JDTH 2ZX6A 1JNHA 4URTB 1BEYH 2IQAB 5F89A 1NGWA 4KBPA 3L1GA 3S5LG 3ZQXA 1KOAA 4JFEB 1GZQA 4DCQA 3DNKA 2H8PA 5E4OA 3L2LA 5HHOD 3LQAL 4FMFA 4TULH 4M43L 1N2RB 3P0VH 5KJ4A 5C0ND 4XMKH 2UWEF 4KROD 3O8XD 4MJ4A 4X0NA 3RZCA 3V6FA 3VFOA 3ZRFC 3V0DA 1N0LB 2H5UA 2Y22A 3N6YA 5EN3A 3HLKA 1CR9L 4OKDA 2BP8B 2FJFB 4LEEA 3K80A 3K4DA 5GSVB 4E9LA 1MEXL 1XIWB 1NEZG 2XXMB 3S5YA 3PXLA 3BPLC 3VXSD 2ZSVA 5CMAA 4OAWB 3UTQA 2DWDA 3U2JA 4ZSOA 4A6YL 1TVHA 5B4MC 4PRNA 3DMMA 3EZ8A 2DMBA 2AXFA 4EI5C 1AQDA 2YEZB 3HAEA 1UT2A 2YGNA 4UILH 3V0GA 2V9RA 3LY6A 4LNRA 3SYOA 3ZE0E 4Z7OF 3LSOB 2V37A 3F7QA 3I9GH 3QW9A 3QAQA 3NCXA 4H8QA 1OZTG 1IC0A 5J1SC 4K5OA 3SE4A 5D5MF 2D4DA 3GSVA 1F3JB 4X99B 4OF3A 1KJVB 1T03H 4H1LG 3L3OA 2CO6A 2ICWJ 4JZJB 1MFAH 1MHPL 4F7EA 3FB8A 3A3YB 5JXAL 1A4KA 4PJEF 1KV3A 5BQ7B 3HBQA 3CZFB 5BS0D 2J4WL 3UP1A 4PP2B 4U3SA 3DJTA 4YX2H 2E9BA 1YUKB 3TZVB 4AEEA 1FG2A 2Z9TA 3VFPB 5AB1A 3HPJA 1W91A 4U1IB 3KXFA 4X7SL 4ZDHA 1G9NL 4NT6B 3OKNA 1LE9B 1N59A 3OKEA 1XL6A 1W6WA 5I9QB 1U8LB 4W9ZA 1JNHB 1V27A 2NX5E 5I74C 4DW2L 5BUAA 3NQKA 4HIEA 4L8BB 2H41A 4JZOA 3OBAA 4UUJA 2ZAGA 4DCQB 5D1XD 3QIBA 1QHOA 4WAFA 4ZJ9A 1JERA 3SCMA 3VM7A 1OCWL 5T5NF 2CGZA 3MBEC 5IQ7H 5DJCA 5FK9B 2R15A 3OXSB 2ZZUT 1G43A 2WLZA 3WIIH 1TMQA 3VTTA 1JXGA 3S3DB 5H4YA 2BRQA 2FDBP 1UZ8A 1S9VB 4JDZB 3WFDL 3H3KA 2R39A 4MS8D 3VGAC 1U6AH 3K1DA 3VD5A 1E27B 2VN5A 1JP5A 1TU2A 4PY7B 1BVZA 4A2HA 4M61B 5F9DC 2BXZA 2Y06H 3APFA 3DX6A 4JS7A 1A3RH 2UX7A 5ERWB 3RWIA 2ZSVB 3FUIA 3RB7A 5I76B 1CD0A 4JHWL 4CDHA 5DRNA 3ULUH 1TVHB 3P30H 4PRNB 2XDHA 3AY2A 4LF3A 1JRHH 4EIBA 5EOQH 1RZJC 3K0YA 1PFCA 4OZGF 3RGVA 4DK3A 4M62H 2BVEA 3SDAA 4IMLA 1WBZB 2I07A 2EYRB 2NUTB 2GJZA 4QKTA 4QOKE 5I1HL 2WO2B 2Y36L 4RZCA 1J8HD 4B3VA 4RGNE 4BM7A 1NL0H 4HKJB 4PCKA 1NAKH 2OQJB 3GSVB 4ZMAT 5B7EA 1FPTL 1TJGL 1KXVC 2VDQL 5DLLA 4F27A 1CO1A 4R5VA 2LAAA 5FGBA 5T3ZD 2XFGB 4J5VA 4MBRA 3WE1A 2BZ7A 1C16A 3FB8B 3G5ZA 2F7RA 3JV4A 1KBPA 3I9AA 2IAMC 3DSFH 4KH9A 4C4BA 4B50A 1CXEA 3GMNB 4JHZA 4CKVX 3AADB 1WZ1H 4M7JH 1N5AA 5D2LF 1FG2B 1JF1B 3ZR6A 1NIFA 2JE8A 4WFFE 4AZ8B 1A7NH 3KXFB 1T7WA 1C08A 1PQZB 2OTWA 1YEWA 2MJWA 3OKEB 2EDMA 1MPAL 2DQTL 5EV7A 4P9MH 4XO9A 2XJKA 2XQYA 2FL5B 2ADIA 3SDYH 5F7AA 3UIYA 3BD4A 5A7BA 1JNLL 2P80D 2BNRE 1KN4L 1A6TA 2AK4A 2CR6A 3KLLA 4AL8H 2CO7A 4NN5C 5HDQL 1XF3B 4H40A 5HY9A 2O6FA 3FUNA 4TL4A 3VFGH 3I85A 3A67H 1EBPA 4JJ5A 5KZCB 1JZHA 4QXVA 1FE8H 2X1OA 4K5PA 4Z0BH 2NDGA 4PGDA 2KI6A 4X4ME 1NICA 4GUOA 1WVZA 2OJZH 2Q76B 4ALAC 2JF1A 4XPTH 2IBZY 4IQHA 1A7PH 1NGQH 4ATTA 4KKLC 3M7OA 4G8IA 5F0PB 1S5IL 1IBZA 1T0MA 4G7YH 2P8PA 4HVBA 1RZFL 1OGAA 3OMZA 3L3HA 1E3FA 5L2KE 3RGVB 1VFBA 3ZQWA 2QLVB 1MFBL 4IMLB 1XR8B 1WJ3A 4WW2F 1EHXA 4DEUA 4KZ0A 2B16A 2R69H 4XNBA 4AUUA 4JPSA 2QQNH 4WUUA 4L3CB 4TVUA 3MOQA 3W1ZA 3ZE1B 3BSZH 2EEBA 4Y5YC 3PABA 1J8SA 3EDJA 4KZEH 1YYMH 3GT6A 4H0GA 1NJ9B 3DXAA 3T04D 2HX7A 1PDKB 3T8VA 1UWEL 4KWUA 4YSQA 5LGJB 3G5ZB 3DBXA 5DU7A 4KRMB 3HBGA 1U3HB 3U4BL 5B1AB 1UZ6E 1TZGL 2V7NB 3LV3A 1OIOA 1BX2A 1F13A 1QQDA 1JSYA 5BO1L 5K59E 1CFSA 4KDTC 1KGCD 2IFFH 2XPGB 3MSPA 1J5HA 1A9BB 3EH2A 3HLAB 3UIZA 3O6ML 4U2YA 2DMKA 1F6FB 2OTWB 2WANA 4TMPA 1H9DA 3U2SA 2VRKA 2E4TA 2DL9A 1C1EL 1YMMD 2VMDA 5IIEA 1ASQA 2ED7A 3JTTA 4N26A 3T5WA 1BFSA 3BDXA 1T2QH 2WWNA 4XX5A 2N4IA 2AQPA 1ZHKB 4OZIE 4C83B 5F8QC 1A6TB 3FU7A 3MROB 4EIUA 2YZ1A 5K39A 2CO7B 1KJ2A 3IDMB 4PV1C 3UBHA 4YGAB 1YPZA 3FO9A 4F1SA 4W1TA 5HY9B 1RZ8B 2E3VA 2YBRB 2F5AH 2AKRB 3MTRA 4OLYH 2FB4H 5FUZH 1HWHB 1QI5A 5TE6H 4OB5H 2IANA 5FA3A 4MMXC 2H0FA 3PF2A 3RIFK 2EIJB 1OP5K 3QQ3B 5D1ZI 2VLME 1XBRA 4YDIL 1DQMH 3AZUA 2UWEE 1U8HA 1DJXA 3EO0B 1FH2A 4DN4L 2ICEB 1XGQA 4M4RA 1OARL 1PAMA 4JY5L 4NM4L 4LLYB 1BGXL 2AAVA 5I8KL 3EJTA 4B9KC 3U6RB 4MDJA 1JZ8A 5ECGA 4HK3N 4NDMA 2WY3B 3LEXB 3QCUH 4H88L 2ZX5A 1EAPB 2MIZA 2LU3A 4UBDC 2YPLD 4X4KA 4PS4L 3QHTC 1OGAB 1OTSD 3D3VD 2XVLA 3QNXB 1G9MH 1MJJB 2YC1A 3PWJA 2DMCA 3ZL2A 1YNLL 1BHGA 3BUPA 3GZPA 4XN1A 5J12B 3LNGA 5HI3D 4UTBH 3Q1SH 2ZT9C 3BZFB 4POZC 2IF7A 2QVTA 4NRYB 3S35L 3V5KB 2CLZA 4LBAA 5CCKH 4B9FA 3UBFA 2WTOA 4Z7OE 2K7PA 4M8QA 4Y5VA 4NQCD 4YBQC 5D5ME 3WUWG 1KIRB 3DBXB 4R4BA 4JO2H 4GG6F 1TKWA 2CJSA 3L2NA 4ZW8A 3FB6B 3BH8A 2B1AL 2I5YH 2R9HC 4KRPD 3SDXB 5C2BH 3CHRA 4UIKL 2WBJD 3WU1A 1BX2B 5FV1L 1TQCC 1VKXA 1P4BL 2GC7C 3HZKA 5G4MA 4PJEE 3QC6X 2ED9A 2ESVA 2Y7OA 4U1NB 3UXFA 3VJ6A 1VRSA 1UOLA 3FTXA 4MMYA 4ONFH 3GBMH 2EDJA 3CU7A 4J1UA 1IGMH 1P5UB 2MH4A 1BBDL 4G8AC 1KNOA 3ILPA 3QDHA 4XAWH 3I2CL 4ETYA 1H8NA 5ETUA 4JFWA 1JGVL 4LPXA 2GI0A 3QARA 1XL4A 1NGXB 4JGUA 1I8LA 2ZCHH 4R4NC 5K39B 2YLKA 1KB5L 1BQSA 3VA2C 4YXKH 5IV2A 3P4NB 1ADQA 4BHUI 2XWRA 2HJLA 4EXPX 3LNEA 1IAMA 5CHNB 4HIQA 5KVEH 5E8PA 5CINH 4K23L 4WI0B 2HXAA 2IANB 3PJLA 2JJVA 3H54A 1M4KA 2HX9A 5AUMB 2R23B 2GY5A 1OWWA 3IETA 5TH2A 3IDGA 3RURA 3STLA 2R7EA 3FOMA 1DE4A 1A3LL 1G7JA 2FH6A 3N0PB 1Z9SA 1JAEA 1JI1A 2FTAA 2ZX8A 4M4RB 4PREB 4N3TA 2P45B 2DJ4A 4J3BA 1SMDA 3P4MA 2G60L 2WKGA 2OI9B 2WXNA 3P73A 4JBSA 1I3GH 4RWYH 2QMKA 5I19L 1X3DA 4MJHA 4XP6H 5EEYA 4PRIE 4CNIB 2PWGA 3BEVA 4FXGA 4A63A 3EJYC 1IC1A 2YC1B 1OHQA 4GG8B 2NY4D 2GUYA 2XA8H 1T89A 5CZXD 1HS6A 3D0LB 4XVSH 3K8LA 1CDHA 3QFJE 4KUZH 5J4MA 2JWYA 3FFCA 2A73B 4KJQC 4M1CD 4U2ZA 3R4RA 2MSPA 4WI4A 3RU8H 1MG2C 1IM3B 3BQUD 4M8QB 4LEBA 3PL6B 5IVZA 4BXSV 2IH1A 4F7PA 1E42A 3OF6A 2WWKT 3O3UN 1MIML 1LP9A 2PPDA 3BH8B 3ARBB 2GW5A 4BZ2L 5MHSD 5JZ7C 5TQ2H 2Z64C 5E2JA 4NSKA 1VKXB 3R8QA 4FJZA 5FLUA 2ZXCA 4HWEH 2P5WA 2F54B 2FT6A 4ZQKB 2IDTA 5GISL 2DIEA 5DYFA 5DA4A 3HE7A 1FZMB 1HWWA 2J88L 3HE6C 3GRWL 5D2LE 4OH2A 2KHAA 1FGNH 3SE3A 1KNOB 1KJ3H 4Q9QH 2OZNA 4AE1A 4HUKB 1JYWA 2XTSA 5F44A 5ETUB 3ZYZA 1ZV2A 1XTMA 1CXFA 3P54A 3O2DL 4WFHE 1FORL 1PX8A 1SJHB 1LK2A 2J1ZA 4LLMB 3EOBA 4O02B 5T3XE 3UG5A 2VDMH 4RMQA 4XB3A 2A1WL 2NXYB 4F57H 3QUMA 5GGVH 1FZOB 1RP9A 1WFMA 2DYSB 3WE6B 4HG4K 3FT4B 4WW2C 1D7CA 3KCWA 1SLUA 2MCPL 2H7WA 4NI3A 3BLBA 3MV01 2R7EB 5K9JH 1DE4B 2APVA 4AT6B 2AK1L 5KVFL 4PJFF 3ZY7A 3BKJH 5HGDA 1ZXKA 1CFTA 3FUMA 5EOTB 2C34A 3HG1D 4O2CA 2DYRB 1S78D 3WKNA 3DA0A 3CX5K 2RAMA 5JORA 1NC2A 3Q2VA 4Z7WE 3MREA 4ZAKA 4M8VA 3SIKA 5I1KH 2CIIB 2XXGA 3G3LA 2NNRA 3GBLA 5J3HC 5E9DE 5GS1A 2CHNA 2GIYA 4XBPB 3PWUA 2X41A 3EFFA 5KBMA 3FFCB 4WFGE 4IYKA 1HYSC 3ECVA 1PW3A 1WWAX 4TUKH 4GAGH 4NI6A 5I1EL 3BPNB 3OZ9L 4NZFA 3U0TA 3LOWA 2VW7A 1LEIA 1NPJA 3T77B 4AUJA 3CCHB 3VTAA 3LHPH 3V4PA 1KV7A 4R3SB 1A8JH 3HG2A 3Q6FA 1K8IA 3C6SA 4TXVB 4XVJH 4RA3A 3OMAB 2EIMB 2LVCA 1Q0YL 3NN8B 3CVHA 1M7IB 2HZHA 2VDLB 3C5ZA 3RKPA 3HE7B 3S8FB 2L8AA 4QXUH 1KCRH 3HB3B 3UGXA 3UO8B 1J86A 1JVLA 1NTDA 1X4ZA 2W9EL 3F7YB 5IB3A 4LSTL 5ICUA 1QRKA 1AVAA 4AMKL 3SY6A 5IBTL 2XWBA 3OX8A 4XCEB 4UQEA 2WSKA 5L4IA 4BFJA 1PU0A 3BLPX 2FT8A 4ZX3A 1B4RA 4IIZA 2XWEA 2YRBA 2AEPH 4UF7C 1F42A 4P5TD 3MRMA 5FO8B 3X13A 4L4VD 3BRGC 3GUTB 5EG6C 4TUJA 3WEXA 1G5AA 3RWHB 2VSCA 3FTYA 2HN7B 1IU1A 3BXNB 5IHBA 1ETJA 4R8WL 2UVEA 4NQVB 1BQRA 4X5RA 5KVEE 1FO0L 4LRIC 2LTQB 1KENL 4MGXA 5EZJA 3LQAH 5G2NA 4M43H 3VVVA 4X7FC 1S8DA 2Z34A 1L3NA 1CVSC 3NEXA 4M8UA 3FT0A 4S1RL 5EF0A 4BFIB 1SLXA 2A6IB 2NTFA 3MRLA 3GMQB 1ACYL 5FAAA 1BZ7A 4U6XB 1QACA 5D1ZC 5F7BA 5BRZD 5IJKA 1NFDB 1EVTC 3WEOA 3SDCB 5LWYH 1YUHA 1G6VK 1CR9H 5IHLB 5J5EA 1KTLB 1CZ8L 3EKCA 1MEXH 2IWKA 1I8AA 3MNWA 3POHA 5IUSA 1HXYB 3JWOC 4Y1AE 5A3IC 5LCVL 3FQYA 4LSRH 2OFQA 1JHKL 4JQVC 4XXWC 3SY0A 4P4RA 4HIIB 4A6YH 5DD0H 3WN5C 4DKAA 3WDHA 4Y16C 1IKFL 2B39A 1A6VH 1DLHA 5EO9A 5HHXL 4LPYA 2XKSA 2ZCKL 5EUKA 4D3CL 3JWNH 4EEEA 2Z7YA 3H4FA 4B96A 2GY7B 2GK0A 2MPVA 2NR6D 1DN0B 5C09B 4HU2A 3ZE2B 5IWLA 3JVGC 2DQIH 3V4PB 4AQ1A 1KT2A 1XFPA 2FIKB 4GG6E 5C97A 3WMSA 3OKDB 3L8QA 3EDKA 4N5EC 1JXJA 4U3CA 2ZKYA 4X9HA 4D8OA 1KLFB 5JXEA 4KY2A 1AS6A 5JXAH 4LCWD 4BFNA 3NFSL 1PEWA 4O2FB 4OF8A 1RFDL 2J4WH 5JOFA 3FMGL 2XWBB 3FFDA 4Y9GA 5JHDA 4PYHA 1XEDA 3DDGA 2VXVL 2XN9B 4LP8A 5MP6L 1XIWC 4NGHL 1UM4L 4P2QA 3U36A 2N7BA 4X7SH 4JRLA 4A68A 4KKBD 1WSST 1G9NH 3L4TA 2F8XC 2HA1A 3MRMB 1SBBA 3UTOA 3X13B 1RZJL 4TUJB 3T8XB 1UM6L 4L9LB 3RIAK 1ADWA 5ANME 3MFGB 4ELKA 2UXVA 3G5YA 3KLHD 1S4IA 1B9ZA 1U8OB 2N01B 1KTCA 3IE4A 1LM8V 1JWSB 2IAMD 2X4UA 2HFGH 1WFUA 3BMVA 4YQXL 4PJDA 5CGYD 3AAZB 3CWGA 1K8DA 1S8DB 3CN2A 1D5BA 1PNDA 1JCVA 2R29L 3Q3GA 4HIPA 4YE4L 3B5HA 5DS2A 2ZE0A 4QJ5B 1AO7B 1UQSA 2V17L 3WFDH 4TNVK 5C08B 4W81A 5DEGA 4CW1B 1V55B 4JZJC 3O3DB 3UBGA 3APDA 4ENED 1I8KB 4W9DC 1I7ZA 3BT2L 5GS0C 4QAWA 3WS3B 5DJYB 3Q8EA 5HYJA 5FFLA 5FYKU 3TZVC 1AHMA 2X70A 3PGCA 5TF0A 4JHWH 4P5KA 3I50L 3CX2A 4WEUD 4ELMF 3PNRB 5T1DL 1CICB 4LEXL 4R83A 2PABA 5KVGH 1BREA 1J9CT 3ATFA 4WO4A 3S36L 5AVTB 3EDDA 4N2KA 1Y7VA 2Y36H 3OAZK 1TSRA 1F3DH 1AD0B 1P4UA 4OT1H 4P4KB 4BUHA 1VADA 1BFOB 2OMVA 1FPTH 1TJGH 2UUDH 1EH9A 2VDQH 2BMKB 3ROOB 1USZA 1WK0A 4KKLD 1X7SA 3O45A 2GPZA 3V0JA 4Q9CA 3MLWL 1A7RL 3V6OC 2EDQA 3JV0A 5C70A 1Z3RA 3F5WB 4WWKD 4ALAL 1KBWA 3M7FB 2VJ0A 5FECA 5JPMB 3VTMA 3E1ZA 2ODIA 2VERA 5T3ZH 4JM2B 4R26L 2OS7A 3VX1A 5CJXC 2EDYA 1HFUA 1QFWM 4UQIM 3HZVA 4NO2A 1PLGL 2ZOUA 3K72B 3RQ3A 3KPRD 2AQ2A 1MPAH 1GGTA 2DQTH 3VXUD 4JQIL 1XDQA 5AL0A 1G6RL 1GAFL 2P49B 1XGYL 4S1QL 1C12A 4IU3A 2ISDA 5I0DA 1Y0LB 5F3HA 2FBJL 3ATAA 3VQ2C 1KN4H 5FF6B 5HDQH 2HTLD 2NLJB 4PJDB 1NCHA 4J28A 5D1QE 2WD0A 3KH3A 1NUFA 3RX5A 4AGMA 1DUYB 2WQXA 2VZ1A 4N0CD 1OGPA 3BP4A 3KGSA 3MV7E 2BY2A 4PJFE 1YN6A 2D7TL 3BAKA 2E46A 3RBSA 4BGDA 3GBDA 4LCUB 3TCTA 4K7PL 1J48A 3VWKB 3C5JA 4KMQA 1B0IA 2FUTA 3O41A 4NCC1 2ZYRA 4I1PA 3FCGA 5HYJB 3CN4A 3I3EA 2ZYIA 2X4RA 1N68A 5HHOE 1S5IH 4P5KB 4U3HA 2XX0A 4XP4L 3MRPA 3MX0A 4UQDA 5T8IA 5BZDA 2LVEA 1RZFH 1F6AA 1WCBB 3X1BA 3QDJB 1AKJD 1MFBH 2PP8A 4JREB 4AC4A 3NP4A 2J8OA 4I3RL 4R2GB 1OP3H 4FI8A 3ZW3A 4OJDH 1AYRA 3TNNB 4GI6A 4XNMA 3HNTH 1AHWA 3EGDA 3BZEA 3BVDB 3QIBC 4HIJB 3JWNE 6PCYA 1CDBA 3VXSE 2EXWD 1T1ZA 2PXYA 5C3IA 1JDAA 4I4WA 4JN1L 4ZQTA 3FF7A 1UWEH 2YJQA 3QYMA 2EDRA 2ILLA 1IC4H 4G9FD 3QJTB 4BZ1L 3QORB 4IKNA 2EO9A 3HR6A 1AHKA 3DX7B 3U4BH 3C8KB 4QGTA 1JZJA 4IRZL 1TZGH 2IBGA 2V3DA 1KYAA 2HLFD 3MRBA 4F8NA 4JKNA 3HPLA 1UXWA 5BO1H 5DYOA 4GBXB 1I1RA 3WJJC 3TFBA 1CT8A 2CDGA 2P8MA 1L6XA 1OAQL 1RQ5A 4U1GB 5K5YA 1KGUA 4ZX4A 1C1EH 1CFVL 3B9EA 4YC2B 2JXMB 4PJCE 3RDTA 4JL1A 2D3NA 3RGVC 3WFCL 2I60L 5BS0E 3UPRB 1TVBA 3BQVA 1HH6A 4YDVB 1YC8A 3QPQD 4RIRB 2R9HD 4M6AA 4RLDA 4XCFL 2BIIA 5I75B 1RHHB 2IV8A 5I8CA 3WFHA 1ET5A 1RZKC 2B59B 5H8DA 3V9EA 4UINL 1GVIA 3BZ5A 4JRXB 3EYOA 4GT0A 4DO4A 3BP7A 2GT9B 4YDIH 2X6BA 4PJ7B 1HHJA 2D0GA 3BO8B 2ALAA 4Y9BA 4OQTL 1EHKB 5I2IA 1OARH 3B9KA 4JY5H 4GW5B 5IZ7A 3MUGA 1U3HC 4PJBA 2EIBA 5D1XE 1MCPL 3PWVB 4N2DA 4DK5A 3QIWD 1JK8B 1P7KA 2E75C 3HW7A 1T4WA 3VGBA 4H88H 3MX0B 1DQQA 4ZUUB 5JIIA 3DTXA 2AW2A 4NZTL 2EVFA 1D2PA 2F1BA 5AOJA 4DO6A 4IM8A 3MRJB 1FUNA 1YNLH 2QKSA 4UQ9A 2DQFA 1ZT7A 3MV8A 5ITBL 1T21B 3HG5A 4XNMB 3S35H 3EIFA 5KVGE 2LU7A 1TCRB 3DO7A 1CE6A 2HRPL 5FB8A 4ODTH 1T6VN 5EEXA 4I4WB 1A0QL 1CWVA 3CMGA 1QRNB 1V54B 1P6WA 3LKOB 3DGGA 5D96C 3NG5A 2B1AH 1PKQB 2DKMA 1TZ8A 2V5YA 3TJPA 4UIKH 12E8L 1EK3A 5E6RB 3FTSA 4AITA 1P4BH 1VESA 1J8HE 1T4KA 2XSKA 2D9CA 4A7UA 3MHZA 5CU9A 1YQ2A 1BD2D 1MELA 3TBTB 3Q5TA 2CDGB 4OCXL 2XFXA 2PO6D 5T3ZE 1BBDH 4G72B 1I9RL 1JZFA 1R3LB 3MRCB 4IGBB 4FABL 3AUVA 3I2CH 3WTWA 1JV2B 4DP5X 3FQXB 1JGVH 3GTVA 4H5SB 1ZAGA 1R46A 4V33A 5J12C 1OZUA 3AQYA 5DHVB 2C9UA 1KB5H 1AXTL 2AJZA 3L9YA 4PR5B 4HCIA 4YE0A 5JIKA 3KPSA 4DKEL 4TYUA 2IIJA 4YSPA 2ATPA 4JE4B 5SWZB 2Z1KA 5I8CB 1QO3A 4K23H 3WFHB 1T20A 1F1AA 4UZGA 1WAAA 4LVOC 3OMNB 2ZP0T 2CKBL 4WJ5B 3O4OB 1SDYA 1A3LH 3VFMB 2X2HA 4PRHA 5TFSL 1PYWA 1BVNP 2WGXA 2DM7A 4PJIA 2PF6A 3AG4B 3QZWA 4W9CC 4JANA 2G60H 3GZOA 2C7UA 4N0YL 2VXQA 3WV0A 4MCNA 3GJEB 4L0YA 2EDBA 4E5XB 4Q6KA 3SE8H 5I1LA 5C0BB 1YDPB 1AP2A 4U1KA 4M48H 1S9XB 2KBGA 3V10A 4HFWB 1DN2A 3MA7A 2LLLA 3U83A 1HOEA 4ELME 3NTCL 4GXUN 4JDEA 1JZIA 2XG5B 1FNGA 1J87A 1G1OA 2RFXB 5DD1L 3ATDA 4GP4B 2AF2A 2WPGA 1DANT 2A0LC 2F53D 2CHDA 2J21A 5CS7A 3ZE2F 3VB9A 2DTML 2P5EB 2XG4B 4P59L 5ICZA 5FB8B 1SY6A 4POUB 1E3ZA 3DX3A 3BVXA 3TONA 2WLKA 5CLXA 1Z1WA 3MRNA 2APTA 2V8LA 1IEBA 4CILA 4QNPF 1MIMH 1MZYA 2VR3A 5EBMA 2X0UA 3UZVA 2FNBA 4XE5B 4RMBA 4BGLA 2DEYX 5EBWB 4BKLA 5FGRA 4JFZH 4BRVA 1JYNA 2J8UB 2CJUL 2IGTA 5GISH 2PCXA 5B1KA 2W0PA 1N6QL 1KCSH 2BH0A 2J88H 3GRWH 2BSEA 2OI9C 3L3JA 5DQ9B 2XFXB 3ZDZE 3BC9A 5CCHE 1NFIA 2C1PA 2IPUK 3IGUA 3MU3A 2C9SA 2UX6A 4M03A 3UZEA 3WFEL 3O2DH 1FORH 2CUMA 3BWUF 3GS7A 3SYAA 2A1WH 1KGCE 1NC4B 1OAUL 3UBXG 1T20B 1LJMA 1XF4B 1I8IA 2ZKMX 3H0TB 4RAVA 1SJMA 2XA3A 3T6VA 2BVPA 2J2ZA 1RIUL 2MCPH 1KB9K 1YMME 1IBFA 4X9IA 2YD1A 1HVXA 1QSFB 3PL6C 3SQBA 1YAZA 2J6WA 1QA9A 1PYWB 2AK1H 2EIDA 5KVFH 4PJIB 3AG2B 1UWGL 2PMZA 3ARBC 1MCHA 4I48B 4OD1L 1JWMB 3QCVL 2YRPA 4JANB 5BUGA 4PUBL 4JVUA 4MQ7B 3FTGA 3T3MF 1U3JA 3VXMA 3EAKA 4L4TB 1U8JA 3LN5B 1MH5A 3NJLA 2F68X 3ARGB 1NCAL 3HZYB 4HJSA 5HDRA 3FS9A 4ZW5A 1E7VA 3SDDA 3ESNA 3PDOB 1IARB 3QO0A 1AANA 2AQSA 3HKZA 2OA9A 3IJHB 1M1XB 3N40P 4MX7A 4HK3J 5EU7E 3T0AA 3WO3B 4YHIA 5CWSA 3OPUA 1I8LC 1WG3A 4MYPA 3VI3B 5I1EH 4QRUB 3LTVA 1L7TL 3OZ9H 3CHQA 3R06A 5DGRA 5ISZA 3R7QA 3UTTA 1YA5A 3IMUA 1IEBB 3KLQA 3HG3A 1ZHLA 4M3KB 1IV8A 1BFTA 1ZD6A 3QUXD 1BBJA 4TUOA 3AABA 4CU6A 2J5WA 2KDGA 4HGWA 3TF7C 3FCUB 3NEOA 3O6KH 5AVXB 2F54E 3NJMA 6PAZA 2H2SD 4EDXA 5D7LD 1C5CH 1Q0YH 1F3DJ 3B2MA 1K4CA 3GLZA 4TNWK 4JM2F 4XVUC 3A5VA 3L3JB 2H45A 2DLHA 4X4ZA 1VAHA 4BSWA 2W9EH 3MV9A 4M7LT 1Q94B 4LSTH 3SHSA 3VI4A 4AMKH 2V2TA 1ZPUA 2ADJA 2OMYB 3I6SA 2NY1D 5IBTH 2AXGB 3EUUA 1AGDA 5DJZA 1T0PB 3CDFA 2YZ8A 3MR9A 5MEPB 4AMWA 2VM4A 1T89C 4ANVA 2B1HL 1ZRUA 3EO9L 3I6LD 4XNQB 4K7FA 4ZNEE 2YD9A 4M6NL 3ARYA 2X4OA 2YKLL 3RGHA 4Z77A 5CFAA 1H0DB 2FR4A 3BPNC 1GCFA 4GH7B 2IADB 4R8WH 4YSRA 2C4FU 5I30H 3IFLL 2H0JA 4OLUH 3IJEA 1FO0H 1OQXA 3UH8A 1KENH 1BZ9A 1QA9B 3MJ7A 5D6CA 2H32H 4BFOA 1PIGA 4S1RH 1IZJA 1R3KA 1HJCA 2J7LA 3VH8A 1ACYH 3IMVA 4AJYV 1TITA 4OFYA 4N2CA 1MH5B 3LX9A 5EZPA 2HSIA 3POCA 3L45A 5CZVL 3HE7C 4WO0A 1VERA 4XRCA 4IDJH 1AD9A 3HB3C 3SDDB 1CZ8H 2ZKHL 4E36A 2WYZA 3EG9B 4I1NB 1Q9LA 1S9WA 5JHLL 5LCVH 4UV4H 1E8YA 1JHKH 3KPLA 5MEOA 5I8EB 2NY6B 5A1AA 4M9OA 1LK3L 4KK8C 1OQOA 5AKTA 5E8NA 3QNYB 4MXVF 4XMTA 3PPSA 1IKFH 1NAMA 3OJMB 4UWQB 2R4SL 5HHXH 4S2SA 5DJAA 5T5FA 1AOZA 2ZCKH 4D3CH 3ETSA 3MFFA 3B34A 2BVOB 4KDVA 2IDQA 1T1WA 3ZK0A 4KOBA 2WLMA 3SD5A 1LILA 3VVWA 3GSNL 4QWWD 1F58L 2NSQA 4PJGB 2KZKA 4XCYB 1OW0C 4H0LC 4LCIL 3A23A 2DM4A 4LVEA 3FBKA 3W39B 4TNEA 1HNYA 2WKLA 5C86A 1LMIA 4KKCD 2VLJA 2Z31A 4LOEA 3RJDA 1UT1A 4N2IA 3GC3A 1RFDH 3KLAA 3SDCC 5GS0L 5I0VA 3FMGH 4XGZB 5FKPA 4S10A 2VXVH 3MGTA 5MP6H 3L5IA 4LU5H 3ESVF 5DZPA 3QUXB 1CC3A 4DN3L 2VM3A 3K5SA 1I1YB 2ZX7A 2YJLA 1MCRA 4G11A 1IJ9A 4E41A 3KLSA 4K7FB 3TO2B 3DOSA 3FSVA 4EI0A 1UM6H 3WL9B 3IXAA 2X4OB 4Z77B 1D9KD 2XXFA 1KCUL 1A6ZA 1BIHA 4NQQA 3QJFB 3RZCD 4XOCA 3MLTA 1U8CB 3KJ4B 4YQXH 2KZWA 1XMEB 3D39A 5JHAA 5DR5L 2R29H 1R3KB 3Q5OA 4MA7H 4UNVA 1E8WA 4IBTA 4LHUG 5I1DA 2V17H 2VDKL 3L7FA 3UAFA 1HSAB 2ITDB 4XRCB 1KG0A 3S97C 2KUTA 1S7UA 2IPKA 3CZJA 4OBSA 5FR3A 4GRWH 4WI7A 3BT2H 4Y4FB 1RPUA 3L3DB 3DMMD 4LSVL 4RESB 3HN5A 4CMMB 2Y24A 5DRXB 5LAPA 2MRYA 4GAYA 3LRHA 3LZOA 3I50H 4GJTB 1Q1JL 4TSCL 4ZFZB 1ICTA 3WKML 3ZHDA 1R1CA 2UZYA 2Z8WC 5T1DH 4LEXH 2JKJA 2J8HA 2VSMB 2YIHA 4FQHB 4X6DE 1FCGA 3ZO9A 3NIFE 4X6BA 1C8QA 3BAEL 4LPUA 4ZW7A 1N8OE 4S2SB 2W9LA 3HG1E 3S36H 3DVIA 3MLUL 4L9LC 2NW2B 3ZE2E 2GJPA 2PUQT 3FHAA 3TT3L 3QUZA 5T1MB 2EDKA 2E7MA 1DVFB 1T1WB 5IMMB 1J5OL 3GPEA 2GJ6D 2M8XA 2VKXA 3IAQA 1ZSDB 3KPOA 3ZVVA 5EIIG 1CB4A 3H9YA 2ITCA 2AQ1A 3MRQB 4QNPE 1ODAA 2ARWA 4KHTL 1AGEA 2EE0A 1VPOL 1FL6A 3ZSSA 3BMWA 3JYCA 1HCZA 2J20A 3BPCA 3MLWH 1A7RH 4ZZKA 5BNXD 1U42A 4ODWB 3OMIB 1KWKA 1WWBX 4ALAH 1BVKB 4GXFA 4XC3H 1PLCA 2FZ3A 4P46B 2XN9E 1FN4A 3IWVA 3MGTB 4R26H 1T5WB 1PLGH 3TYGH 5FM8A 4WHYG 1P1VA 4MXQC 3F7PC 5FW6A 1D6EB 3DOSB 3QIBD 4MQXD 2CD0A 3IXAB 4JQIH 2M1KA 4WVRA 4O51A 1CICC 3S5LA 3CSTA 1XCQB 3SCMD 3FQRA 4XO3A 1XGYH 2MMXA 4S1QH 4MCMA 1FL3B 5I5JA 2ZWNA 3GBEA 3M17A 4F2MB 1CDJA 1EJ8A 2FBJH 3ROLB 3VMPA 5HHQA 1BAWA 3EJRA 4ANXA 1T2XA 3CZEA 3GMPB 3NDYE 1J9RA 4AGLA 1EUTA 5IWLC 3D34A 1MQKL 1L5GA 4JQXC 5H94A 3TWCH 1ZWIA 3DIFB 4GFTB 1MVUA 4HUNB 4P4KC 3MZTA 4L8CB 4YL9A 2ATAA 3K3QA 3ZRCC 2D7TH 1BQHB 5AVYB 2H6PA 1NEZA 2IMMA 3T3ME 1U8MA 1S7UB 4K7PH 1XGPA 2YAFA 1BF5A 1FIGL 4O4YL 2PW2A 5KG9A 3GXIA 5JQ6L 1JK9A 2HX8A 1HWGB 3SDAD 4FTVB 2EXYC 2N0MA 3P0YL 4FEMA 4XP4H 3ZT6A 5J6HB 5C0CB 1RSYA 2I7OA 4Z3FA 35C8L 4X6BB 2IV9A 2HCZX 3W37A 1U4EA 4HBQA 1FV1B 5BRZE 1YNTA 2YUZA 2BC4A 4FE9A 5F8RC 4I3RH 2W59A 3QUZB 4IIQA 2XYCA 4OCMC 3WHXA 3GQFA 4W6YB 3SKUD 2XVGA 1IIKA 4RA0C 1Q4NX 4H1LA 2C3VA 5EIQA 4GQRA 3RX9A 3PAUA 3VFNA 1RZKL 1RIHL 4FFVD 5E2TL 1FL6B 3QEHB 4JN1H 1ZA3A 3BPCB 4MHHG 4AE0A 5HYSB 1OE2A 4G7RB 4BK8A 4L1BA 2HT3C 5F9OL 4ZXBB 3REWA 4BZ1H 5GZOC 5INDB 4J4PC 2R4RL 4IRZH 2C8NA 3PGFL 4QJ3B 4HZ1A 2ZXDA 3GMRB 4NX0A 3RVVC 1JGEB 5L8LB 1TNMA 5B3NA 4XCNB 2Z8VC 4E2OA 1P53A 3ILEA 1IGJA 3FHQA 3MNVA 1CXIA 1XCWA 3OKYA 2AK4D 4QHNB 1OAQH 4FTDA 1CFVH 5F1OB 1IGCL 1H15A 1P5VA 1IAIL 2BSTB 5ECJE 4LCWE 3D4GA 3NZUA 3LCYA 3WFCH 2I60H 4JREC 3LRSB 5LN4A 1MJUL 3NVQA 2D3LA 3Q01A 3LN4B 2VH5L 4PLJC 1TENA 3ARFA 3GEFA 4XWGL 5H94B 4RSYA 3EJJX 1ZWIB 5KJ7E 3G6JA 3U4KA 4UINH 5IGXL 2I25N 3DLQR 4QT5B 3EBIA 4GKNA 5FO9A 3UO1L 3RUGF 3FRPG 4XN2A 4OQTH 5DURB 3V0AC 2Q8BL 3QHFL 1FGVL 4V2CB 4RDQF 1DVQA 1JK9B 4HMDA 3PV6B 5CN3A 1TYEB 1ETA1 4GRWE 5BZZA 5EUOA 4NZTH 1R3JA 4WUUD 1NPNA 3VRJA 3DHPA 9PCYA 4U1GC 1A02N 32C2A 3VI3F 1G87A 5JIQA 2EVIA 1DQLL 2I7SA 3DXAD 5M95B 5ITBH 2X0WA 3C60A 5KSVB 4JFSA 2GKIA 4XPBL 2HRPH 1UACL 2FE0A 1QTPA 1KJMA 5SWSA 5I75C 1A0QH 3U7AA 4KXCA 1VFAA 1I9IL 2P9RA 2JKIS 4MAYA 4EZLA 5KYNA 4FKHA 2WWKO 4I9WD 4OZFG 5CIPH 4ZODA 3WTTA 5CR1A 12E8H 1HTYA 2OX5B 4PJ6A 2XZZA 3E8UL 4IRJD 2ZPKL 4MNHA 4WIQA 4JY6A 4YGVB 4Y2LA 4FXLA 3I6GA 3FT2B 4OCXH 3T6XA 2G75B 3RFZA 3PG2A 1I9RH 3QQ4A 1WS7A 4FABH 3AG3B 4J8RA 2ZKXA 3JV6A 5D4HA 3K8KA 5HJ3A 1ZGLP 4Q6YA 4E0RB 1M6UA 2V2XB 2ZCLL 3GS0A 5DS1A 1DDHB 1AXTH 3G9AB 3EJZC 3I75A 4DKEH 1KJ2L 2EDOA 3B1TA 1F4AA 5DFVC 5IMOB 4NO5A 4BKSC 1KMGA 1HAUA 1OAXL 1JOIA 2CUHA 5MENA 4CAGA 3G6DL 2CLRA 2ENPA 3VXUE 1UWXH 4GW1B 3RY6A 1NOLA 3LXUX 2CRYA 4AV5A 4I13B 3FB7B 2XQBL 3RKDD 1M9WA 4JFQA 5TFSH 4QHKI 4OLWL 2V2WB 4WLCA 4LDEB 2JK5B 1YEHL 4A67A 5DHEA 4N0YH 1NIDA 3U48A 4YPGA 1LQSR 3DI2B 4ZTPH 3CC1A 4J23A 3I6KB 2TSAA 3ISYA 5EUOB 5IFAL 4Z7UA 1B0RA 3BW9A 5DMIL 4OJYA 2QSVA 4RRPA 3GXPA 3NTCH 3O4LB 3B9DA 4M4PA 4HV8A 2D7OA 3RWGA 4IGBC 3ZMRA 5D2NE 5DD1H 5DZOA 3QXVA 2R2EB 3BAIA 2NRDA 4R84A 2FUQA 3S2AA 3DSNA 3UJTL 3SBQA 2DTMH 4KK6D 4P59H 1KPVB 5FOBB 4FX5A 3APCA 3GBNL 2VITA 5ESAA 3S37X 4PJGF 4DGVL 3T0EB 4I85A 3MMEA 4KI5D 4O58L 3DTUB 5D72L 4YO0A 1PKQE 2ESVD 5HD8D 4B5ZA 2G3MA 1G4RA 3VM5A 4AKPA 4OM0L 4IJTA 3EH3B 3GKWL 1W80A 2C9RA 1NANH 4GEJA 4NC1C 3EHBD 4LDOB 3VACA 4ILDA 3U46A 2F2HA 4MD5B 3NA9L 4MJIA 4MNHB 4N25A 3B9KC 3H7BA 3RFRA 3MLVL 1FAKT 2CJUH 1E4JA 3RP1A 1E9QB 1N6QH 1DVTA 4I1RA 4PQXA 3P9MB 2VR7A 4TVPD 4TSBL 3UAAA 3VFVA 4P2OA 2BIHA 4TTGA 4L48A 2J6EA 4ERSL 3SGJC 4G9FE 1UM5H 5T1LB 3M88A 2MTAA 3F6LA 4YNYB 1A3QA 4TVPL 5CJOL 1ACCA 3KDPB 4DSYA 1ADQL 4NO5B 2W8CA 3UZQA 3NJGA 3ECBA 3GJFA 3N50A 2G0LA 1RIUH 4Z5RB 5J1AB 3D85B 4C47A 4PS7A 2HVKA 3WNLA 5IMLA 1NBVL 5E23A 1O6VA 4GUCA 2JTDA 3DARA 2EABA 5EDSA 1UWGH 1N12A 3QCVH 3TESA 1EXUA 3LDBB 3ESUF 4LOVA 4WV1A 3U6XA 4A39A 3BFQG 4GP8B 1NCAH 1S7RA 1B0RB 3T65A 4PH8A 3SQOH 3ZKXB 4BH8B 2DBLH 3H53A 1CIDA 3S3PA 3BW9B 2WCSA 4XI5D 4L0ZA 3T2OA 2EIKB 5EC2B 1RK1A 2R8SL 3UG4A 4GKOA 2EE3A 4YH6A 4HEPG 2NW3A 1FZJA 2MOVA 3DOIA 1PPIA 1TTRA 1ED3B 4V1DA 1LO4L 4HAKA 5BO0D 2OSLB 4U49A 3WUWA 1O7DE 1E28B 1WISA 2PCPA 4IS6A 3CH1A 3MA9L 4P2RA 1L7TH 1SNRA 2FLBT 3OJ2C 3MMEB 2P5WD 5CBEB 4UU9B 2WW8A 1MLCB 2PYEB 3OG6B 4GSDL 4AQ8A 2FSEB 2Y1ZA 2HMID 1DJZA 1YEDB 2A6JB 1GMEA 1IC7L 4HEME 3H7BB 4PCSA 1N18A 3JXAA 4JFFA 1L0XA 3WLBB 4AXWB 1GGCH 2X05A 1ZT4B 2HFFA 1H9VA 2ODHA 3FXIC 5KW9L 2Z1PA 4HALA 4P2OB 2XWJA 3V7AG 2BP5M 3IGAA 2VUOA 3ZT7A 3ARGC 2XXCB 3QUHA 4PMEA 2FWOA 2R1YB 4EE2A 3FB5A 3FQUA 5HVHB 5IJVB 3FT1A 2CM5A 4N6QA 1PZ5B 4ZUWB 5GGRA 4JFDA 4PM1A 5CO1A 1SHXA 3IFPB 4HFUL 3UFIA 2X2JA 2BFVH 3ARZA 3RWCA 2P8LB 2B1HH 5HGAA 2WNGA 5JW5A 2A9DA 4K2UL 1U91A 3QUYB 3MLSL 1EXGA 4PHXA 4JZNA 4M6NH 4KFZC 1BD2E 4MB1A 2YKLH 3QUML 1ZE3H 2NZIA 3QEQB 4HH9B 1MJ7H 4Y2DA 1A7OL 3IFLH 4IOSA 4Z23A 4WSGA 4PV9B 3S34L 2FEEL 3HC0A 15C8L 5DRWA 2XZQL 4A7GA 5IMLB 2BSRA 3GLEA 4HWBH 3RUGE 4Q4EA 5AYQA 4Q9RL 1NC2D 5E99L 4ZAKD 3RG1C 1ANUA 4G8FB 2WLLA 1Q9KB 4M93B 4JFPB 1ID2A 1QW8A 1B3IA 1YJDL 4H8HA 3U1QA 5BOJA 5K9QI 5C0FB 2X88A 1T5XA 4NRXA 4F7CA 4AEHL 2ZKHH 2R51A 1ZVHA 1BXVA 5LGKA 5LXGL 3AXLB 4JG1L 2WINA 2NW3B 3GK8L 1I9EA 5JHLH 1SDDA 2K6ZA 1CGXA 3GI8H 3GXDA 5FXCH 4AJWA 1LK3H 3VI3E 4NN7B 2QADB 2WBWB 2JQMA 3Q0HA 3BI9X 4MWFB 3NCFB 2B1OA 4WWOA 4IS6B 2R4SH 2VLRB 3KJ6L 3QXAA 3W81A 2IXQA 3P3UA 4QTHA 5DFTA 2OP4L 4LVNB 1RJYA 3KR3L 3C5ZD 2ZWYA 1E50A 4F92B 1ASPA 1MNNA 3FYIB 2WOYA 3IJYA 3QJHA 1P9MA 4S1DC 3V4PL 4C54A 2VISA 1U3YA 3GSNH 3QG7L 1F58H 2X10A 4GRLA 5A6MA 4LLVA 2HKFL 4XN8A 4EDWL 2F53E 2MTPA 4LCIH 2JJTA 3ARVA 5B3JF 3CVHL 3MRKB 2DM2A 4PJAA 1E5CA 2QQKL 2O6DA 4PLKD 1HX0A 3G08A 5IROA 4N9GA 3ZTEA 3X12B 2W1NA 3SDDC 5C9JB 2E7HA 2BXYA 3DX9A 2O5XL 1HILB 4LZKA 5E70A 4DN3H 5J89A 4WFED 1BG9A 3C6EA 1I1AB 2NY6C 4JZNB 4LL1A 3LD8B 4G6FD 2VLKB 1B2WL 2CLVA 3HZ3A 4F33A 5JR1L 1IE5A 1SN5A 4XCCH 4Y2DB 3W0WA 3OAYK 2P28B 5ELIA 1DJIA 2BNQA 3NT0A 1FFNB 3K71B 5LJYH 3HC0B 5DRWB 3AT0A 5I5IA 5I16A 1H3UA 4XBGA 1W72A 1X5MA 4NO3B 1V10A 2QVIA 1FNLA 2XNAB 2YRLA 5DR5H 4JY4A 5E2UL 1CQKA 2BOCB 2X3BA 4GKLA 1LO5A 1B90A 4LCVA 1JD9A 2VDKH 1LQBC 5DC4B 4G6AD 4G59C 3IVKB 1AMXA 3ME0A 4AWJC 2QV2A 4LSVH 2G5BA 4P9HC 3WNOA 1FHGA 2UUDK 4N6RA 3BAWA 3CFEA 2QPEB 2H3NA 3J7HA 4N5UA 2UZXA 5ESVA 2WIMA 4TSCH 1Q1JH 3WKMH 3NJHA 2DN7A 3LH8A 5DI8A 5IVXB 2YHGA 1NCNA 2YAOA 3QUKB 3AU0A 4YZWA 3AXIA 3BAEH 2WNKA 4QTHB 3MLUH 5A6IA 1HCVA 3LVTA 3TT3H 3HAEH 3Q06A 1Q90A 3TBCA 3G04A 5DHMC 1H5BA 3EYQC 4YHPB 1CFBA 1J5OH 1BV8A 3WYRA 2C7FA 3IKCA 4ZMLA 3DVFA 4NNYB 4PJGE 4WSJA 4KK5D 5JXED 3VWJB 1ZLEA 3OAUL 2CO1A 2VMFA 2WXIA 4LLVB 4X98A 4KHTH 2OMWA 3KJ4C 1VPOH 1N7ML 4I2XE 3WCYA 5JHDD 2IAAC 4TQPA 4H26A 2EXYD 3TPUA 3F01A 3GSWA 4P2QD 5BOZG 3WEMA 5B38A 2FX8L 1B4TA 2X4PB 4GP5B 4NUGL 1CGVA 5FFGA 3D2UB 4Y4HB 3FJTA 3ZHKA 4CBPA 3STZB 1BLNB 2JI2A 2X4TA 1RH8A 1D5ZA 4Y4FC 2K78A 3TNMB 3GSXA 3CLEL 1KEMH 3C6LA 3FUFA 1WFJA 5D7LE 4AQAB 2VQTA 4HD5A 1CG9B 3EXJA 2V3FA 1NCDH 2Z35B 1GYAA 2FWLB 4TQEL 4XH2A 5JIPA 3HAEG 5JDJA 3CHSA 1B4LA 1DVFC 1MQKH 2EAEA 3B2VL 3C09B 3E6FB 4OFDA 4UQ3B 4XHQA 5EFIA 5JW3L 3CD4A 4Q58C 2Z7WA 4NEHB 3UJIL 1V05A 3RVVD 1TQWA 5IESH 3I6LE 4NOBA 1AZRA 4OGXL 1OP3K 4TQIA 3WLWC 4FKEA 4BDVB 3V6ZA 2YUXA 1S7VA 3FO0L 3LXBA 3ME0B 3PWLB 1FIGH 5DS8A 4O4YH 2RR3A 4C56B 5HYEA 3OAWA 4QRTA 4UM8A 3ZDYF 4P46C 1MXGA 1LO2L 2HVJA 5JQ6H 1JXFA 4WO4D 5ESVB 1UB5B 4PGEB 4ZFOA 1NCGA 2YOAA 3ULSA 2R2BB 1LYQA 3P0YH 3CFJB 1U9KA 1Z32X 4Z7VA 5JW4M 2Q2EB 3QR2A 4HPOH 4JFHD 35C8H 4GI9A 2FJSA 1NDMA 5JIHA 2ADGA 5C0JB 5CFHA 3CFUA 1LXMA 3BVUA 3G04B 3Q8AA 4IK7A 3UERA 4OVUA 1WITA 2DQMA 3QJUB 4OV6F 3STBA 1U8PA 2NZ9D 4BFGA 1RZKH 5E2TH 1SYVA 1E4WL 1WIPA 1PLBA 1QSZA 3ZTNL 3QI9A 4H26B 1Q72L 2CK0H 5DJ6A 3RNQB 2GQHA 5FO2A 4ZMWA 5F9OH 1LD9A 3TPUB 2IO5A 3GSWB 3U25A 1VA9A 5JDSB 3PGFH 1HEZB 3DI3B 8FABA 2DQGL 4LT7A 1ZCRA 2YAHA 1D5ZB 2WLIA 2DQEL 4K9EC 4LVHB 2FK9A 3C6LB 3DHUA 4Y89A 1Z5LA 2Q9OA 3QDAA 4WEBL 2LV4A 5MERB 4HPHA 2Y5TB 4NJ9L 1IC5H 2VN7A 1KACB 1IGCH 4BK4A 2X6UA 1KF9B 4L8SA 4N24A 2SEBB 1IAIH 1L0PA 3B3BA 3U4EA 3DKHA 4NAQA 2WIIA 3LEYL 1FNEB 1MJUH 2X89A 3QUZC 5FS5A 4L05A 1A6AB 2BZCA 2VH5H 2DLTA 4XWGH 2GJRA 2QQQA 3V0VB 4PJ5A 1HZHL 3CSYA 2ZAHA 3A47A 4RQQB 5IGXH 1N8ZA 3V6BR 2OCJA 5LGHL 3DPDA 5EPMA 4J3VA 1KDIA 2CIKA 2DYPB 4ZMQA 4UM9B 1S7VB 1BMZA 3KPQA 3E0GA 1Q1PA 1XZWA 4K3DL 2Q8BH 3QHFH 1FGVH 3E8VA 4BSJA 3K74B 4IW4C 1H8LA 5DVPA 4MCYA 4WF7A 1MVFA 1YMHA 4XPAL 5DJDA 3KCPB 4AVKA 4BELD 3NIGF 4XVTH 1WYJA 5A16A 4NFBA 3WY2A 5SX5K 5F7NC 4N20A 4R4FL 4ZD3L 1QI3A 1AZCA 4L3EA 1IFGA 3NMEA 3UGEA 1AGFA 3KVQA 4Y1SA 2PXYD 1DQLH 4AVJA 4ZSOE 3AQZA 5D70L 2KDYA 3FPYA 3VXRB 4P48A 3HJ0A 1OF2A 4FQQB 5HP5A 4XPBH 1UACH 2A9BA 4Y2OA 1SEBA 3C2SA 4N90D 1N26A 4RSVA 2J43A 2DKUA 3QRFM 1DQDH 1I9IH 3TBWB 4U0RC 4APQA 1YYLL 1FH5L 4QF1A 1SLVA 2UY6B 1IEAB 4KJYA 5B3JE 1R3HA 4F58L 3E8UH 1EFQA 4IRSA 3DJ9A 5BZWA 2GJ6E 2ZPKH 5TDOA 3INUL 1I7RB 4QHKJ 4ENZA 3RDTD 1XMWA 3D0VA 1XO8A 1YRKA 1E9OA 1O6SA 3BP6B 1NPUA 1QPXA 3BX7C 3DRQA 1U41A 4TTDC 2XZCL 3RNKA 3U4EB 2YQ3A 4ETQA 5D7IA