2A9DA

Crystal structure of recombinant chicken sulfite oxidase with arg at residue 161
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
369
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
total genus 94
structure length 369
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9dA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9dA01
3R18A 1OGPA 3HBGA 2CA4A 1XDYA 1XDQA 2A9CA 3R19A 1SOXA 2BPBA 2A9AA 4PW9A 2A99A 2BLFA 2C9XA 4PW3A 3HBQA 2A9DA 2XTSA 3HBPA 2BIHA 3HC2A 2A9BA 2CA3A 2BIIA
chains in the Genus database with same CATH superfamily
1NEPA 3VWKB 2YGPA 3UJIL 5E00B 1UQSB 3F7QA 4O00A 1CTNA 3QXUA 2X70B 4XNUH 4XNYH 4YDVB 3E80A 2R2EA 3GMOB 3V5KA 4LCVA 2GUYA 2NTFA 1ZT4B 4HKXB 2JCCE 1YA5A 4EZLA 4HFUL 4PGEA 1BGXL 2OSLA 3DUUA 3VFWB 3DO7B 1CYXA 2KL6A 3GINA 1FNSL 4PBVC 5DT1H 1GJUA 4KOCA 3U2JA 2FZ3A 3UZQA 3FSZA 3H1ZA 4KV5F 1AGDB 2BNQB 2NDGA 4ZUVA 1UD5A 2QKSA 1MW1A 1QHQA 2Y7MA 4EE2A 1RUMH 1KLUB 4N8VB 1FZKB 1DDHA 1DP0A 3GO1L 4XCNA 2D2OA 1EDYA 2YSSA 3HJEA 3LEVL 4HAFA 2FE0A 4YHZH 2EC8A 3R1GH 3RGVC 3KLAA 2LABA 4U1JB 3VQLA 1MCPH 2YAMA 1P0SE 4JLRA 2JK5B 3C8DA 1QFWM 2DTML 4P3CL 2WLNA 3EDKA 1WAAE 3PWUB 3AAZB 4BKLA 2DY2A 2QT6A 1PLBA 2OAAA 4GRWB 4N8CL 2C34A 4XB7A 1JHKL 2G5BA 4Y19A 3VD7A 1P1ZB 3KDMA 1IUZA 5FM8A 2HG0A 1PEWA 2N0MA 4YE0A 4KDWA 3ESOA 2GSMB 2B4CL 3S8FB 1U8IA 3TBWA 3MV8E 2XUWA 3IMRA 2ZP8A 1NKRA 3MRIB 4Y2DD 3ZVVA 3BMWA 4JJ5B 3SODB 3FTZA 1OGAA 2BS8A 3CSYB 1H8NA 2Y07L 3QGVA 5E5UB 3RL2A 4I48A 2IDUA 2Y2WA 4U2YA 1PZSA 3S35L 1Y1DA 4PCKA 3BSZL 2AQSA 2VSKB 1HJCA 1MN4A 2NQCA 1OSZA 1N64L 2WKOF 3F7PC 3MROA 3M07A 2FO4B 4HJUA 3FU5A 3U46A 4QRAA 1P7KB 1B9KA 4JRWA 1U8KB 4P05A 5EU6E 4BQ6A 1LVEA 4ABVA 4A6YH 4RFEA 2EDMA 2XFXA 1ET8A 3KLDA 1I8MB 3E6HA 1J8HE 2EH8L 1NBYB 4L3CB 4AENB 1MY5A 5F44A 4HCRA 4Y5YA 2IV8A 4LEOA 3BSGA 3BP7A 3QWRD 2K3TA 1CE1L 1MIEH 1LNUB 4ODWA 3L4VA 5CP3A 4GXFA 4MDRA 2O5XL 1PLGH 4RZKA 4G6MH 2DQMA 4N9GB 3QJOA 3MRNB 1MCHA 2A5UA 4AJVA 1TPXC 4YDLC 2R1WB 2AQTA 2C9VA 4QLWA 5I74B 1NGXB 2DJ4A 4L4TD 1SZNA 1NFDF 2UY6A 3BDYH 3LKNA 3PV6A 4X6CB 1N5AA 2EP6A 3EIFA 5T1LB 4QRSB 5AKTA 3GQFA 4UOQA 3N9GL 3EGSA 3HI1B 2QSTA 2DQFA 1XF3B 1A6ZB 1T7YA 3BH8A 4U6HB 4FN0A 5G5DA 2V9TA 1QHOA 3X3FL 1J0ZA 2YAPA 4M5YH 3SYPA 4TLTA 1BG1A 1DUZB 1NCBL 2VZ3A 3JTBA 3AS3A 4M43L 4TOYH 4K4KA 4LL1A 2CNYA 2EE3A 3D30A 2YK1H 1IC0A 2EDQA 1MKFA 4ZX4A 3DV6B 4NBXB 4W9JC 1G7PA 3TA3A 4F1SA 2PW2B 3FOLA 3O3DA 2P26A 4M1DL 1OM3L 2X40A 4OVUA 5CJQH 2HFFA 5EU3A 4O4YH 1IAII 5B22A 1PZ5B 1FL6A 4YDJA 3MLRL 4HBCH 4BRJA 2YD9A 5CCHE 2MCAA 1JI2A 3ZKQD 1DO5A 2DQEH 2CD0A 4BGLA 1U3ZA 1MG3C 4OLUL 5I1AA 1U41A 4V1DE 2P5ED 4X2UA 3J8F7 5I5MA 2W60A 4KAQH 4ODTL 5IQOA 2X4QA 2Y6TE 4IOIA 4LB8A 1DVZA 3CZLA 2Q6WA 3M1BA 4A7SA 1V7NH 1LILA 5IQ9B 4H88L 3QI9C 4JG5A 5CEXB 5K93A 3MRQB 4NPKA 3TCLB 2EKSA 4AE1A 3K8LA 3I9PA 3F2LA 4LHUD 4OQTA 2JTYA 3VW3L 3S36L 2DS4A 5A2JH 2Z31A 2XTJE 3DGDA 2GJ6B 3EDJA 3VG0H 3DIVA 3OJ2C 3LZQA 4YHZL 1I7ZA 3WSQL 5B39G 5CP7B 1XF1A 3HVDA 2EDWA 4NZRH 1EHAA 3SPGA 1ODAA 1IJ9A 1KBPA 1XH0A 2BVYA 1DANT 2GIMA 4OJCA 4EEEA 3QQDB 3C75A 4IMKC 3B2PA 5T3XL 1MCLA 1U8LA 4NAJA 1KV3A 4K15A 5DUPL 1GYUA 4ZXBA 3TJEH 1U42A 3U36B 2ILLA 3T3ME 4X4XB 4M6NH 2Q20A 1X5HA 3HNSH 3VXMD 4N2LA 3UTSD 3FQUB 4LCWA 3SGJC 5DFAA 2X7LA 1DZBA 3BPCB 3L4WA 4AGQA 4YHIB 4Z77A 3TM6A 4MDIB 2WXOA 2VQ4A 5DTFB 1LWJA 4BIKA 3QEUA 2VXQA 1RK0A 4QRPE 1N2RA 4QGYA 3VFTA 5CKAA 4PJEE 3C12A 3ZK0A 5JHMA 2Q7NA 2CZNA 3WE6B 3B2UC 4JO1L 5BZWB 4G83A 2YMTA 1W8OA 2OR9L 1A4JB 4XMVA 2DL9A 3QXWA 5GGQL 2MOQA 3VVVA 4ALAC 4O2CB 5EN3A 1UACH 4YSEA 3QXDA 2ZSVB 1G7QA 1SEBA 3GIZL 3GMPA 3Q6FB 4W4NA 4QTHB 5D2LA 4P04A 4FXKC 3DHJA 3WFEH 2ADIA 1JUFB 1PFOA 3WAJA 3VGGA 4S1RH 3NCXA 4BWTA 1H6EA 2BP0B 1Y6KR 4JDTH 4FMKA 4ODSL 1DQIA 2N4IA 3LS4H 2JI2A 3MZGB 1SVZA 3NQKA 3PE9A 4LLUB 4LSSH 3RIAK 3C8HA 4KTGA 1QKZL 2Y0SA 5IJDC 2R2HA 3WJMB 4A2EA 2Z93B 1QZ1A 4MHHG 1R3LA 4PRID 2F58L 4S1QH 2WBJB 3KPRD 3QDJA 4BSWB 4K3EL 2FT8A 1I3UA 3MREB 2O6CA 4AWJC 1S9VA 1D7CA 4AEHL 3ZZ1A 1T5XB 1KGXA 4QEGA 3KBEA 4PVNA 5G55A 4GEJA 5C0ND 1FNSH 1G1OA 1XGYH 3PP3H 1SJXA 2Q3ZA 4J28A 1ZWIA 1R5VA 2YD2A 4CC4C 4JK0D 4TULH 1JWSB 5KW9H 5HY9B 3A0OA 1CWVA 4HK3J 3BEVA 4N2IA 1MW2A 3NDYE 1ZVSA 4OUOA 4W4OC 4X6CF 5BRZD 3E1F1 4EIUA 4Z7UA 4IRJC 4K71C 3CWGA 3IE4A 3U7YH 4ZFGL 4ZS7L 1UH2A 3HKZA 3QIWB 5JUEL 1FIGL 3GM8A 1BREA 5BMFL 5E1AA 2UWEF 1BBJB 3RL1A 4WU5A 2J1YA 1R9FA 1MCOH 1H3PL 3GSUA 1OD7A 5SWQA 3ZL4H 4L8BA 4V33A 5TE4H 3OKYA 3OJVC 5DQ9A 4Z7QF 4OZHA 4Y1TA 1WCQA 5FA4B 5FO2A 4X7DC 5E8DL 4R7XA 5IHZB 1F45A 2CO2A 2FB4H 5LGJA 2HFGL 1CDBA 1AJ7H 3HG1D 1NUNB 1X5KA 4P46A 4HG4K 5EIIA 5DEFA 4ZYKA 3OKEA 3HR5A 2D7PA 4OJYA 1R5VB 4DGVH 5IFAH 5E56A 5DC9B 2EDFA 3Q01A 3Q8AA 4ZO8A 3FOMA 1K5WA 4DKDC 3I6KB 1WAEA 2EXYD 3KXFD 3VM7A 3GLAA 4HK3N 3H54A 2FX9H 1YEDB 4ODHL 5C0IA 2AMGA 4M5ZL 1U8NB 1E6JH 2IAMC 4A2MA 1S7RB 2ZKHL 4A39A 4HOWA 4Z7IA 3VYPA 4K7PX 1L0XA 2AXFA 3AADB 4XC1L 4OKVA 2E75C 3EJQA 3T4AC 4O2FB 3ZE0B 4AQ8A 1T1ZA 5E5RB 2ZP0T 1GZPA 4FL4B 2KC0A 5CGYC 2QVKA 1G9NL 4OSUH 1GYWA 4KK8D 5LBGA 3T4YA 5DC0A 1NZRA 3QH3B 4KMTL 1XL6A 5KVGH 3GMLA 1NL0L 1NMBH 3ARRA 2F6AA 5LBVA 1QPXA 4Y4FA 4LRIA 2F61A 5FFGA 2HKHL 1TVBA 2EECA 3WUWA 4L29B 3FUHA 1SJEA 2UYLA 5DK2B 3Q6FA 1CGTA 1G7QB 1SEBB 3GMPB 4NUGH 4PTTB 5D2LB 3KBPA 1N67A 3MA7B 1I1FA 5ISZA 4BK4A 2Z91A 2GTQA 4YSSA 2Q3AA 5F6HI 3QYMA 3WHXA 2F54E 2ORBL 1A4JA 2J57A 5EHFA 3ABKB 1OAZL 1T2QL 3LH2H 1RZJL 5BZXA 4Y8AA 5DVMA 4F5CA 1FSKB 3TL5A 5D5ME 3IFPA 1G4RA 4XCCL 2DWDA 3JTTA 3DOIA 4FQQA 4YHOL 1ML0A 2J8UE 1UZ8B 1H8SA 3GHPA 4PP2B 2IAMD 4XAWH 4KK6C 4WW2A 1Q9KB 4DFHA 3QJHB 3QDAA 4KKRA 1O6TA 3FH5A 1K3ZA 4JFZL 4OFIA 4YHIA 5D2LE 4CJ0A 3NH7H 1O6SA 3IFOA 1S78C 4HUUB 3VFMA 5I28A 3NJVA 4C4BA 2HP4A 4EZMA 1JPSH 3LYRA 4HV8A 5ESVB 1JD9A 3M46A 3FQ2A 1XVSA 2R56L 2QQNL 1OAJA 4NENB 1SMDA 3I84A 5FHAH 3OL2A 3BGMB 4P2OC 3CFBB 1VB9A 4Y5XC 5D7JA 3UJTH 1JZ6A 2NZ1A 3CFQA 3JZ7A 2X87A 4TL4A 4YXHL 3WTYA 1RVFH 3RNQB 5DWUL 1UYWH 2R56H 3NCCB 4WIQA 3L4ZA 3HNTH 5BXFB 3O6FC 3SPVB 3WD5L 1IGJA 4N0YH 3CVBA 3UROR 5FGBC 5DJZB 4GSXA 1NGQL 3T04D 1H9VA 5JPNC 3OJDA 4JGMA 2JI3A 5D1ZB 3CMGA 2KLTA 3ZOAA 4OJEH 5HI5D 3OZLA 1WSST 2E9IA 4BK5A 3CIQA 3HN5A 1I8IA 4XTRD 3DX3A 5IQ9A 5F96L 1AGCA 1OF0A 4IOIB 5KVFE 4C4KT 1A21A 1EO8H 4KXAA 2K7PA 4M8VA 2OZNA 5DRZB 4UU9B 3CMOH 1NIBA 1QRND 3ESMA 1WFIA 2A4ZA 3IJ8A 1IAIL 4LCWE 3QZWG 1AZCA 3QE5A 3NDZE 1UB5A 4YDJB 2WLJA 4NZUL 4QRUA 1N6QL 3APFA 1HHIA 4M93C 3F7YA 5EU3B 5T3XE 1G7PB 1NLBL 3WKYA 1JCKA 2DH3A 1OB1A 4MMXC 2Q87A 1QFOA 4PV8A 4HHAA 4YSDA 1J1XL 4R97B 1BF8A 4MBRA 4AIZA 4UNVA 3KLHC 2BOCB 2QPDB 5F0JB 2HRHA 2CHWA 4NO3B 3VXRA 3QVAA 3UBGA 2WWMC 5G5DB 2WCGA 1K8IB 3HOGA 4N2CA 3IRZA 1RZKH 1EWHA 4YK4B 2VABB 1GSMA 3HBZA 3IFNL 4Q6YA 2XX0A 1OPOA 2V9UA 3QZBA 4M4PA 5I8CB 3L3KA 4FHBD 4HJGB 1ZIAA 1ZT7A 3O8XA 4ANXA 2DLFH 3C6SB 3CFEB 4HK0B 1J86A 3MBXL 1WGVA 1NLDL 1VFUA 1LEKB 3S3SA 1E9QA 5KAQF 2UY6B 4LLWA 2LVCA 1MWOA 3AXHA 3HG1B 1UWGL 3UAAA 2JWYA 4H1LA 4OZFA 4U31A 5BS0A 2AKRB 2OMZB 3ASNB 1CBJA 2AEPH 2AQQA 4L8DA 1RZIB 4F15C 4KMTH 5D96C 3WELA 3KHQA 3WN6A 2YPKB 1H3GA 5KYYB 1G7MB 1P9MC 2FQEA 1NA8A 4J8RB 4K0OA 2PP8A 4KVNL 3OMNB 1B90A 1XF2A 4H44C 5K39B 3WY3A 3AUVA 4LSDA 3IGAA 4NN6C 2DIJA 3O6FD 2D9QB 3EYSH 3IM1A 3GK8L 3I85A 4AEIH 4LEOB 4C83B 5JTWA 5I0DA 3B9VA 2NR6C 2ZOWA 1E9OA 4ZMOA 3NJXA 1T3FA 2DBJA 2PR4L 3NTCH 1I8MA 4EXPX 4P2OD 2EIDA 4ZOCA 1U95B 4RFEB 2OZ4L 4F8PA 5J4MA 1G6VK 2P43B 2XWXA 2IWKA 3TO4B 1NUFA 1ZA6B 4WI9A 1VCBC 2Q9OA 5HJBA 3HPJA 2XZCH 4F9LC 5IMLA 3GEWB 2X4UB 2B20A 2HX7A 1T4WA 2EDYA 2PW1A 4KKCD 4OCRH 5C0BA 4NNPH 5KVEH 3GM0A 1RV6X 4ZX3A 1XGRB 1OM3H 5DHVB 3VRIB 1PG7W 3KG5A 5EO9B 1QUNB 3VQMA 3B5TA 2FDBP 4NO0B 5DVOA 3QJZA 2EAEA 2WZ6A 3L7FA 3MRIA 2VMDA 3ULUH 2HT4D 1DZ0A 2JIXA 1JCVA 4JPIB 5BMFH 4J3OH 1T03H 2KZBA 1HSAB 2QADD 2X3BA 3ZUCA 2G30A 1NGPH 1I8AA 4F57L 3AS2A 1IC7H 4MQXC 3JVGC 3A4AA 5C70A 3V8CA 4L9LB 4L2LA 5D93C 4F7EA 1EGJA 3BQUB 5MERA 1K4DB 2IF7A 4DKFL 1IGYB 4TM9A 3VRJB 4CU8A 2WLIA 3UZEA 3O8XD 1NGZB 3V52L 3X1BA 4F37F 3FT4A 3P3SA 3W0WB 1GZQA 2B1HL 5D6CB 4NKMA 5EBWB 3UERA 1CUOA 1ROCA 1Q4NX 4WV1B 3UZQB 1BXAA 1E28B 3C60D 1L7TH 2BSEA 1BVKA 4D0DB 1WC7A 1NBZB 3KL3A 1DLFL 2EXYC 3KW8A 1NPUA 4FFYL 4U1IA 4XO9A 3TO4A 1LDPL 3NIDB 4EN3B 3H3BC 2R2EB 2BSSB 2GC7C 3GIVB 4ECNA 4YDVA 1E67A 2X41A 2ZX8A 3DMMD 1HWGB 3N0PB 4RLDA 3P77A 3WIIH 2V5YA 5EU5A 3EJYC 1U8MB 2L7UA 3NRQA 2I26N 3VWKA 3WS6A 3U2IA 1ITBB 1QLFB 2F7RA 4KROD 3DSNA 2XA8H 3IGAB 2DWXA 4N2KA 1MCWW 2YAHA 4QYOA 4Y5XB 4R7NA 3TJEL 1QYGH 4P2OB 1MREL 3C5ZA 2NNXA 2K8MA 3LOWA 5IP4A 3G6JB 1N0LB 1PKQB 2X44D 5C0AB 3VX0A 3O4OC 3P0YL 1PEZA 4JFDA 2XETA 4H1LB 2X0VA 5F9OH 4AIEA 2R2CA 4U3SA 3L5XL 4WFHD 1SN2A 2CBPA 1DO6A 1JRHL 5FYKH 5J1SC 5GS3A 5E9NA 3ZLQC 1LEKA 4LVEA 3ES6A 4KJPD 4E68A 1SY6A 4HCRH 2MQCA 3UIYA 4BQCA 3SQOH 4KK8C 4AG4L 1KBGH 3O45A 3SKJH 4WEMB 3OQ3B 2Z9TA 5DMYA 2O6DA 1Z9MA 1MJ8H 4J3OD 3UG4A 3NAAH 1D3CA 4KTDH 4RMWA 3QSKB 3CHXA 1ETJA 5K9QI 4WSGA 2XFGB 3C6LD 5GZND 2VERA 1LL1A 8FABB 3NCYP 4KO7A 3I3DA 4AYID 2VUOA 1KBGL 3SKJL 2GCYB 1NPNA 4HHAB 4PV8B 5I24A 5IEHA 3N9GH 4TF4A 1UVQA 1OB1B 4TNWF 5A3ID 5I1JH 2F2HA 3HUJF 1MZYA 3KLHD 1BFVL 1N0XL 1TTAA 1DCEA 1ZANH 2X4NB 3FT3B 4B0MB 1BZ7A 4ABQA 1MXGA 5JLZB 3FNKA 4WDIB 5JW4N 4BCYA 5IBUB 1IEAA 1E5YA 3F7LA 1PDKA 5B1KA 3FTUA 4LPVA 3NCYS 1KGCD 2H6PB 1S7QB 3D33A 1QQDA 5EOTB 2WVUA 1QLFA 2MKLC 2X09A 1F86A 4ZS6D 5JW5A 1CDYA 3JV4B 3DMMB 4OF0A 1ROWA 1X5ZA 1BVLA 4OFYA 4BQ8A 1GGYA 1E2VA 2VLJB 3WN5A 4UOZA 5BVJA 1WF5A 4KXZH 1TQVA 4G43A 1PYWA 5DS8B 4GKNB 4OCSL 1I8IB 1RMFL 1HOCB 2JKNA 1JGDA 2X6CA 2WO4A 4XMLL 3RE0A 2PPCA 4HIPA 3FQ1A 3RIFK 4HLJA 1WC7B 3FULA 1IILE 4HAKA 4XH2A 4CRPA 1PAMA 1OAKH 3WTUA 1U2CA 5HP5A 2BFVH 4QRBA 3KWTA 3ARFB 3OJDB 3SDAA 4OZIF 3D4YA 1YEKL 3W0WA 3FT4B 4JZOB 3DTDA 1W72H 3HE6D 3MBEB 2NW3B 3IU3A 3ZX1A 1WICA 2WBWB 1OP5H 5KVEL 1CD0A 1NMCB 3GO1H 3CDGB 4IJ3C 4L37B 4QRPA 3IWUA 2ISDA 4WO0A 4FI6A 4Q6KA 3G5ZB 3CE1A 3WEXA 4NRXB 2CHDA 4OCNC 4QOKB 2YFOA 1UM5H 1EEQA 2YD5A 3MLZH 3TN0C 3QG7L 4BBWA 3AB0B 3HC3H 4JFDE 4MNQB 1TKWB 3BRGC 5DRXB 1SUJA 3FPXA 3QWNA 3RFRA 2HTKC 1XV8A 3US9A 4YQXL 5ICXB 5LVEA 4GY4A 2DWTA 3WENA 1QI5A 4OAWB 1YZZA 4OZGB 2KQNA 1M2VB 5ALBH 4DGWC 4OM1L 1VEMA 2PW1B 4P48A 5C0BB 4G82A 1C9SA 2F08A 3IRCA 2XWCA 3E8UH 3QRLA 4EXKA 4JCWA 5C0FB 5ID1A 1TTGA 4R97C 2X1WL 2GY5A 5KYXA 3TO2B 1R46A 1UB6A 3A3YB 4XZUA 4H8WC 1JZGA 2QL1A 1LO5B 4RSYA 1OW0A 3CDZB 1BWWA 3S6CA 1MJJA 3WHXB 2D3NA 2WKLA 4DO6A 2FQGA 3GLDA 4K9JA 3HNVL 4L8CB 1ZLVH 3AWEA 2CO6B 1DVFD 2IQAA 3DVGA 4U6XB 1OP3K 2UYLB 3VFNA 5DK2A 4D3CH 1A3LL 2G2RB 1TVBB 1N12A 1XB6A 2PTTB 5I76B 1KYDA 1G7MA 3Q1SL 1HQ4A 4ZW7A 1NUDA 4LEBA 1F4XH 2QDVA 4I4WB 1BQLH 2F19H 4OVVA 4X6CE 4L8DB 4TSAL 5F9DC 4Y9GA 1BQHA 2AKRA 3AWGA 4CN1A 1J0YA 1MHHB 4OZFB 3OXRA 4PG9A 3HC0B 5L8KB 3PJLA 2EICA 1T1ZB 2MRYA 5F3BA 4ORGB 5F9OL 4JFTA 1OT4A 1P7QB 5HHOE 3NG5A 3UO1H 1PZUB 2WO3B 1TENA 1RZFH 1R19A 1JZJA 2QLVB 2VLRD 5IROC 2EDTA 5DHYA 4LEXL 1U8NA 4KUZL 1WD8A 2P8PA 4HJGA 3L3KB 5KBMA 3ML9A 2JKXA 5I1IL 4KX9A 4H8HA 1K8IA 1QRNE 1N59A 3RPKA 2BY1A 4PRIA 1S8DB 4MNGA 4NO3A 3VXRB 4FNLL 4JS7A 3MMEA 3DLQR 1BEYH 1A14H 3OKEB 1W8NA 5DEFB 4BFBD 1SMAA 4DQOH 4GW4B 5GGSA 3EJJX 4DPBX 3LTVA 2ZUQB 3SEPA 2ZX7A 3NGBB 4P3DA 1AAJA 2OYMA 4NXSA 1T20A 3FL7A 4HKZA 5SWQB 2VR3A 3O6MH 3HFFA 1WE5A 3RDTB 2WW8A 4J39A 1D5BA 4XMWA 2YS4A 4CN6A 1OSEA 2TSAA 3D09A 4NCC1 4GUOA 1E40A 2NYKA 4PG2A 1H3XA 2L7JA 3X2QB 3JV0A 4W9FC 1WAAF 3H42L 4XPHH 5HI3D 4YPJA 4CDHA 5JPNA 4LQFH 4YN3A 3ZE2F 4PW3A 3LKPB 5IBTH 4UU9A 1F8TL 1U4FA 3QCUL 3QUXD 3EBHA 2OFQA 1EZVY 3TV8A 1N3NB 1OCOB 4D94A 3MLTB 2VLKE 1X4YA 3EOAA 4YHYB 1YEHL 4XXCC 5HGAB 2JF1A 1JHKH 5DHXB 5D1ZA 4WFGD 1XCQB 1CPUA 5E1IA 1AXTH 1GC1L 3RZWA 3NVQA 1ZRUA 2DLHA 3QDJB 4UOW0 4BXSV 1ITCA 1UD4A 2V5RA 2E86A 3C08L 1KXVA 3MAWA 4P4RB 1OAUH 1GS6X 4OM0H 3WJMA 3K6NA 3ULUE 3H9SE 5KS9B 2RACA 4CSTA 5D6DC 3FO0L 5E6YA 2JCWA 1DBJL 3BWAB 3GMMB 3GZKA 1B2YA 4JN1H 1NLBH 1W72B 4HXBH 4CC4A 3QUZC 4YLCA 4LVHC 4FG2A 4KKZA 2YUXA 3RP1A 2NY7H 3MJ9L 1FZOA 2QQKH 3OKNA 5CEYB 1I1RA 1JUFA 5IWLC 3F64A 1I1AB 1R47A 1FVDA 4XC3H 3E6FB 3TA4D 5LAXB 3HMWL 3Q05A 1KCVH 1N19A 3K1KC 4HV8B 1ETZB 4Y2DC 3MBXH 1I9JL 3TF4A 3H85A 3ZHFA 2BDNL 2ZSWB 5AWNH 4WFFE 5F8QC 5BUAA 1CGWA 1E9PA 1YY8A 3B3IB 3GJEB 4WY7H 3RGVD 4EUPG 3WIIL 3FSVA 1QLEL 1M05A 4WW2B 3ZHDA 3GUTA 1R6VA 4D0BA 2ENJA 4UIMA 3H9SD 3WE6A 1RLBA 1JFQL 4KMQA 5E2WL 2ZG3A 3UTOA 5EOCL 3T8XA 3GNML 1G9HA 4FQQB 1MFMA 3JWOC 3RDTD 4UIMB 3FU3A 5EU7E 3SOBH 4FZ8H 2NZ9C 5I1EH 2MJWA 4G8GA 4N0UE 4PRHA 4WO4A 3H2PA 2E6PA 3A47A 4HJTA 5TE6H 3BAYA 3MCLL 3U4AA 3CZGA 4UM9A 5EOCH 5B38B 1S7WA 4PTTA 2JB6B 2IADA 5IVXF 2J7LA 4XPGH 1ZHLB 4ZXBB 4X8CA 4GBXA 3N6YA 2DDQL 3BIBX 2XACC 4WUKL 1LLAA 1OCZB 1A5FH 3UAJA 1B3JA 4IMLA 3V4UL 4PRBB 1IC5H 5C86A 4H8QA 3LZNA 3QQDA 3F84A 4IBQA 4JG0H 3GMMA 5IMMA 3QH3A 4PS4L 4R26H 3T4YB 1C16A 1L9OA 3AREC 4NO2A 1TF4A 3VFOB 4R83A 1KN2L 3MO1A 3UO1L 2G4GA 2H6OA 1IX2A 4X6BA 1SXNA 3CVHB 5A2IH 2H0PA 3A24A 5BRZB 2FSEB 2LTQC 4FQJL 4Z95L 3FOMB 1KJ2B 4TTDC 1MAML 2FJHA 3MLYH 5AL8A 5I1HH 1RFDL 2NY3C 1W2KT 2OR8A 2ZKXA 1HEHC 3GSNH 3HKFA 3OZ9L 4NQDE 4N8VG 3ZL2A 5FYLL 5J13C 1A9VA 5LGJB 4KY2A 3U1SL 3T3MF 4G8AC 3ZE0E 3GMNB 5I73B 4MLIA 5DQ9B 5JHDA 3BPLB 2A77H 3UBFA 2QVFB 5J06A 2DLTA 3ARZA 1EUTA 2ED8A 1WBZB 4GUPA 3DV6A 1DBJH 3ZW3A 4QF1A 5TE4L 3R4DA 4I89A 5IESH 3UX9B 4R90L 3NIFF 2QKIC 4MB5A 3S37H 2YBGA 3HMXA 4YJZL 1YEGH 1UGKA 5ALBL 3S88L 4KZDH 1ZWIB 2AQRA 4F27A 1AC6A 1PG7L 2Z64C 2YWYA 2BW4A 4M5ZH 4PJXE 1NGWB 2DQFB 5IJCC 4FNPA 1BAFL 5C07E 3U4KA 4LU5L 2Y9RT 5FHBL 2P9RA 1RULL 4JY4B 4WI8A 5EBLB 4QRSA 5B7FA 1M7DA 5DHYB 3LKNB 1PZ2A 4X6CA 5JYLA 3MRLA 2YMXH 4E5XG 3MFFA 3DV4A 3LRLA 3OKMA 4HIJA 5F3BB 1HEZB 4JFQA 4OLWL 3CC1A 4AGNA 2WVVB 1F6FB 2E9BA 1CBVH 2K1MA 4HALA 1BLNA 3JUYA 1CFBA 2YN5A 3BKMH 3O4LD 3VG0L 2G2PA 4N9GA 2GTWB 4X4MA 1PMYA 3H56A 3D85A 3GSVB 3S36H 5DURD 2G2RA 3VH8G 1L4IA 1HE7A 3OAWA 3CC5B 1LNUA 3P40A 4ODWB 1AHWA 3U82B 3ZJAA 5HXMA 2ZSVA 4P5MB 1QNZH 2VLKA 3OLDA 4NP4H 1CDJA 4UTBL 2P5WE 2K6ZA 4X4KA 3UTQB 1BFOA 5CR8A 4Y5YB 5DK3A 3EYOA 3O0LA 2H1PH 4NIKB 4L3CA 1J0KA 1MVUB 2VR4A 1MHPH 2R9HD 4ELMA 5I18L 4CADB 4Q9QL 1SY6H 2FX7L 1UB6B 4AVIA 5HSFA 4KUZH 4Y89A 3TO2A 3A6CH 1UACL 1P7KA 3BIAX 1IU1A 3JXAA 1G9MH 4GUCA 5E6ID 3NFSH 5K1NA 1SXZA 3FN3A 4TQEH 2RMNA 2ADJB 5L7XL 4XHJC 4V2CB 4Y2NA 1SEQH 5FGBA 1ZIBA 4LBEA 2NXZB 1E5CA 4JFZH 1KLFB 5AB1A 4AUYA 3D08A 4ZOAA 4C54A 4UMSA 4FLSA 4Y1AA 3BPCA 1DYZA 4DHLA 1LK3H 5DA0B 3RL2B 1QFUH 4OAWA 4OZGA 2ZF8A 3RGVB 2HZHA 4N2NA 4X4XA 2VDOH 5GZOA 5BV7B 2ZP9A 4CSSA 1HHGA 1SHXA 1U8IB 2A7BA 4WJ5A 1KGJA 2FQDA 2LQRA 1RVFL 1U8LB 2HLFC 3ZTJG 5B8CA 2DM3A 1OAQL 1G5GA 1P1ZA 3KDMB 4QOKA 1QSED 4N87A 5CLZA 5CP7A 4L37A 3CDGA 5HGGS 4TRPH 3I02B 4LQFL 1MCIA 3WFCH 4IRZA 1YY9C 4X6DF 1BZ8A 3AJ7A 1CLCA 1PVHA 1EHNA 2P8LA 4N8VA 1PY0A 5F3FA 4AYMC 1L7IH 2DQJH 1FPTH 2KHAA 4MFHA 3VI3B 1R5IB 4QNPE 4WU7A 3VVWA 5C2BH 5SX5H 5L88L 2A6IA 4M6OH 1R75A 2EKSB 4GG6A 1MH5A 3L4UA 3QARA 4GMTL 3ECQA 3VFWA 3WDIA 1JGDB 3LS4L 4HKXA 3AUWB 1ZT4A 4LMQE 1J9TA 3M1BB 3IJSB 2EABA 1NCCL 1GC1H 4NC0B 4ALAL 1MFEL 4M93B 1A47A 1ACXA 1BQSA 1OM9A 1UQSA 4FJYA 4ZSOE 3GEFA 3JWOH 2C8NA 3KPLB 5TPWL 2VDRL 4GP8B 1ANUA 1QQDB 3LNFA 3DHMA 3H7LA 4X8JA 2KT6A 4YE4L 2ZOTA 3SKOA 2DWSA 5EZJA 3TH4T 4FMFA 3JZYA 3II2A 2C3XA 3RAJL 4OV6F 1PZ5A 5F0PB 3O81A 1IEAB 5CJXC 1AS7A 5F7KC 3RVXD 3O3DB 2VE6A 2XVBA 1AVAA 3N2JA 1CDCA 4NQCD 5GS0L 3SZKC 3EFDL 1VKXB 1S4IA 3CLEL 1DUZA 5B8CC 2FHBA 3DGGA 3LDBB 3ZTJH 5E24E 4O5LH 3V5HA 1KIRA 4AQ1A 3QZOA 5KOVC 2DV6A 4WI0A 4Q89A 1AQHA 1T6BX 1FNLA 1NANI 3O45B 3T6QC 5DUPH 1Q0YH 3FQRB 3N1GC 4CJ1A 3FT2B 2H3NA 4KVCH 3PQYB 4WK2B 4OF5A 4H8VA 1BIHA 4HH9A 5I17B 4QAWA 3JWDH 5FO9A 1WHPA 3S3JA 4S10A 5ADPH 3OLGA 3SIKA 3UBXI 4H8WL 1U21A 1N70A 4AG4H 3UCQA 1OCRB 1B6DA 3IU4H 3NSFA 2NY5H 2QSQA 2VLJD 1SVBA 1KELH 3MRNA 4PPTA 1QEXA 3IGFA 4OZIE 3I3EA 3VXTA 4AUJA 4QXGL 3SDYH 5C0DA 3WTVA 1P5VA 1PY9A 2ZZUT 3ECVA 2ZOOA 3L5WA 1I3RB 3SOTA 3SDCD 1JPFB 3N40F 3WO4B 4N5ED 1U3NA 1UZ6E 4TQ8A 1XF4A 4JDTL 1HKLH 3ZR5A 3I9GH 3P77B 3KVPA 3T2OA 1CG9A 4JAMA 4JO8A 1XAUA 1BZ9B 2X2HA 5E94A 1TSRA 4U1IB 2NY3B 1NBZA 4PRNA 5B3SB 1ID2A 1TTRA 3EBGA 1CT8B 3U46B 4MNQD 4PJXF 1GYVA 2QQLH 3WS3B 4ZX5A 4GAGL 4WV1A 5DGQA 4EOWL 3VXNB 2EO7A 5D6CA 5EBWA 5HYJD 2B15A 1GXEA 2RAMA 4HC1A 3OVUB 4AQAB 3HG0A 3B34A 3APNA 1A1NA 3OKOB 4MZRA 5AVUB 4OCRL 4JFVA 4JJ5A 1OGTA 1OTUC 4JFEE 3T0ED 4AH2B 4JRXE 2P24B 1Q94A 2VXUH 1EAJA 5KYWA 2J71A 1ZTMA 5CS7A 5J6GB 4MCZB 3W0WD 2VDRH 2PYEB 3ZDYF 1EPFA 2NY4B 2ZNXA 4JPIA 4KO6A 1NCTA 2YGNA 5EU6B 4KTEH 3VXOB 2BNQE 4L5FH 3BPNC 4UQ3A 4BKLB 2OMUB 2W07A 3PQYD 1SGKA 4ELME 1G6RA 3QUYA 4M5YL 3HFML 2X4SA 3ZKMC 4AIXA 3FU0A 4JFHE 2QSCL 1AI1L 4AI7A 5JO5B 1V5JA 3SE9H 3UYRH 3O41B 4JQIA 3REVB 3VMOA 4AV4A 4JJOA 4OT1L 4ZSOA 1JN6B 1PX4A 1WUZA 3WFZA 4KJYA 1L0YA 3X12A 3CHQA 4IRJA 3SD2A 1QHPA 4JG1L 1DJGA 1NCHA 1NCNA 3IFLH 4Y8DC 3T4AA 3DO7A 1ZA6A 4JHVA 4IBVA 4JPVH 4I77L 2HT4C 2R39A 1UM4H 1O7DE 4P9MH 4AYFB 1RAMA 1TZHA 4X5LA 1I9IH 4FQIH 2WHVA 4M7LH 3KWUA 3HTLX 3WUZA 4XWOC 1DJHA 4AYSA 1T6WA 3D39D 3G6JF 4JO3L 4F57H 4ZW5A 1JS4A 2NX5D 2EDRA 4JKPL 5TPWH 1S9WA 5ID0B 1V3LA 1VEOA 3M86A 5AL0A 1XF2B 5H8DA 4Z7OF 5JXED 4LGSB 1FL5A 3GS4A 3TF7C 1M53A 2V17H 3SGEI 5DJ0B 2NPLX 3F7KA 2F53B 3TO4D 4QT5B 1I53A 1JV5B 2X9ZA 3D8MA 3QBTB 1RZIA 4N2GA 1INEH 3G6DL 3MRHA 5T33H 3U4BH 1T2XA 1X5YA 1F1DA 3PP4L 4TPRH 5I8OL 2FEEL 3POCA 1W91A 5I9QB 1NDTA 3ESVF 3OLEA 2NR6D 3L8QA 1T80A 4MKMA 5JQIB 3EFDH 5EF3A 2W0FA 5K9OA 3MRKB 4LLAA 3TBTB 5I75B 2J6EA 4TVPD 4Y16A 3FUFA 2F0CA 2XCMC 4IKJA 3LV3B 5BJTB 1THAA 4NO0D 1RPUA 4WW2C 2JQZA 3BISA 3V95A 1SY6L 3T0EB 1EXUB 4O51B 1L3WA 1OIOA 2I27N 3CZNA 3J7HA 1IQDB 1MIEL 3C5ZC 4WO4C 1EDQA 3DX4A 2P48B 3QCVL 4NZTH 2CJ3A 4NYLB 1G87A 1XDTT 3NAAL 2XPGA 2DKMA 1EEUA 4HUXB 4RMSA 3EXJA 2R7EB 4F93B 5J7CC 3P11H 4U1SA 3SYQA 4LO9A 3FU7A 3QXAA 4NQDA 3EYSL 1TIUA 1SJHA 4MX7B 1M7XA 1SXBA 2HT3C 4I2XA 4R2GD 2VJ0A 3SYOA 1LD9A 1S7SB 1U3HB 4PREA 5SWZA 4XAWL 1CLOL 1HK6A 2Z0BA 1FNGA 2WWMD 2GJPA 4EI0A 3BP5B 5TTRA 5I71C 4IIQC 1FV1A 1KCRL 4X4ME 3ZSSA 2E9WA 3CCHB 2VCOA 5LGYA 1JK9B 1NANH 5BVPH 5TDPA 3JV6A 5DD3L 3US1A 3E7JA 5CJBA 1UYWL 5AW5B 4A7GF 4KK5C 1EFXA 4N3UA 3V79C 4I88A 2F1AA 2W65B 2V8LA 2DAVA 2HN7B 2KMWA 3GK8H 4TNEA 1CL7H 5J1AB 4HPYH 2ZX9A 1O5DT 2HX8A 3WLWD 1A66A 4JQIL 3HPLB 3VI4F 4KY1L 4WNJA 4D9RD 1A3RH 1KCUH 2D4FA 4G6AD 4JY6A 4C57C 2L8AA 3UAEA 5IFHL 5DJZA 5D8JH 3DMMC 1GJWA 3ARXA 4ZMYA 2Q7YA 3A22A 4R7LA 1LP9A 3LRKA 2EXSA 5IM7A 1JV2B 4GLRI 1E65A 3DJZA 5BNXD 1KEMH 1IGJB 4UI2A 3DIFA 5BXFA 3MNVB 1RZKC 3GRWL 2CU9A 2J44A 2EUXA 3V52H 3S2CA 2AJUH 9PCYA 5L0QB 2VISA 1SYVA 1X5JA 4MMYA 5C0BD 4I1NB 1XO8A 1AE6H 5CO1A 4PLJD 3EW3B 5FYLH 3TZVC 4JRXD 1X9RA 1BPVA 5IBLC 4ZMXA 5IQMA 4JDZA 5EOCJ 4K3DH 4PWGA 3NJNA 2HMIC 5KSAC 3PL6C 2MWCA 4H4NA 2BWIA 1FNEA 1ND0B 3GZQA 3GMQA 5C8JA 2NMSA 2X38A 2ZYRA 4ZODA 2P42B 4IGBB 4RWHA 2K9FB 1WUNT 2D0FA 1BFSA 4RA0C 1BZEA 1UZ8A 4KROC 2BNRE 1HHJA 5HYSB 3BKML 2YQBA 2YAQA 3IFPB 1NOAA 5B1BB 4KK9D 2AABH 3TBVB 4BCXA 5HDRA 3E1ZA 4WWKA 4BEIA 1GGBL 4JFYA 2X10A 3TONA 2XN9D 2JXMA 3KEDA 5ADPL 3W37A 1HZKA 2E46A 3CPLA 3IKKA 3D2UD 4N2BA 1X5FA 4ANUA 3QI9A 4FQ1H 3ZUNC 4G6KH 2VUKA 3C2AH 3D9AH 1BAFH 2ITFA 1KTLB 4UQDA 5C7ZA 4I0PD 1VLXA 2V5SA 3NA9L 3ZTCC 1KPUB 3PWLA 5ILTH 1OK0A 4FYTA 1NIEA 3QUKB 4MAYC 3HZVB 3CLFL 3GMLB 1I8UA 1DVQA 3V7AG 1XGZA 3AU0A 5CZVL 3ZDYE 1EEYA 5HHVL 3C60C 2ZNWA 1F6AB 1AP2A 3TEZA 2YXMA 2AQNA 1GZPB 3VD2A 2HH0L 4JKNA 3DX7A 5ES4B 1WISA 1M4KA 1S7RA 1GL4B 4MMXA 4XNQA 2K78A 3U7WL 2R1XB 5CINH 5ETUA 1CXKA 3QG6A 4JO4H 2R59A 2N7AA 4QRPD 4ICWA 1YYCA 4ZO7A 1D5IL 1KC5L 1GHFL 3KLKA 3HAEA 2ADGB 4FXGB 4N2OA 1V27A 4KKCC 1YLBB 1OGAE 5DJDB 3VI4B 1YMHB 2H2PC 5EIIB 3SDAD 1A6PA 2W0KA 4GQQA 4QWWD 3UC2A 3O9WA 3KE0A 4HS6B 5F93C 5IHZA 2DW5A 5C9KA 2NY4C 1DANU 4HOXA 3SSGA 1JZFA 4OZHB 5DD0H 4UUJB 1T0NA 1G9EA 2WQWA 5BRPA 1B0RA 4A2DA 1TEYA 3CZKA 4OLYL 5D1ZI 4XVUC 5E8NB 4FQXC 3REWA 2A6JA 5AKSA 5GHWH 4WU5B 3GXNA 4YC2C 2QMKA 3CH8A 3KL0A 2CLVA 3QFJA 4XCYA 4Y4FD 1JPTH 4UWQB 2CGZA 1A7NL 2IGLA 2FEEI 3KBHE 1EBPA 3PWPE 2XN9B 4UT9L 4O9HH 2A4EA 3QWOA 1MWAA 1DBKH 2I32A 4P5SA 1YEHH 4J2XA 2WMPB 1XGPA 5HYSG 2UXVA 1OAXH 2KS0A 2O1AA 5AYUL 3CAFA 3O4LB 5B3JF 4WTWA 3ILPA 3MV9D 1ZT1B 4DT2A 4UT9H 3LKRA 4C58B 1K6QL 4XNDA 2E0PA 3T65B 4Q8BA 3CXFA 1KTCA 3VXPA 4ZMLA 5J89A 2AJXH 4ODUA 3V0VB 3O6KH 1DLHA 3V4VH 1S7TA 2CKNA 4L1SA 2E7HA 5T5FL 4JKWA 4ZK8A 3FTXA 4GAYB 1QPPA 5T5NG 3PPEA 3L54A 1XT5A 5I6XB 1DSYA 5T3XD 4H8PA 3UFIA 1JGIA 1V7NL 3AG2B 4IBYA 4QCIA 3VDAA 3T0BA 4CDGC 1MNNA 5IW1B 4I9WE 1GAFL 5BUGA 4YDKH 4FKEA 5BZWA 1VGKA 1MWAL 2FIKB 3TVMC 4LP8A 4RGND 1DFBL 4ONGL 2VMCA 5FO8B 3UPRA 5EUOF 1DBAH 1N2RB 3F3HA 3BUIA 3C8KB 2DWYA 3NABH 2B1AL 5DTFA 1DBBH 2EYSA 5FKPA 5JYMA 2ZWZA 4LNVA 2EIZA 5JR1L 1E5BA 2X4TA 3BVNA 3LN4B 3FQUA 3EO9H 3OHXA 3FCSA 3GI9H 1MRCH 2DQIL 1ZXKA 1EJOL 4LDLB 1T04A 3QPQD 1LHZA 4GFXA 2IANE 2HG5B 3H9SA 4L4JA 1PSKH 15C8H 5EO0B 2FYYA 1CICD 2OA9A 3KCPB 1M71A 2XDHA 5IBUG 3BI9X 3WJJA 5EC2A 4AXWA 1VSCA 1IBZA 1X9UA 1YECL 2IC2A 5GS1B 5IF0B 4PSRA 3V0JA 4FHJA 3CVHH 4XPBL 4GQRA 1P4UA 3TCXA 4RGMB 5FOBB 5AAMC 5LGHL 5I8KL 1ZLEA 5F72S 3A6BH 5CNHA 1I7TB 3NJJA 3ZKSD 4BA0A 3ZGIA 2QVTA 2WZ0A 2EVFA 5E4AA 4MA1B 3IMVA 2VR6A 5EUOB 1GZHC 1I3GH 4MDJB 3NCJH 1U8PB 3FAWA 1H0DB 4X80L 2QMJA 4XMKL 3MNZB 4KMLB 1Z3GH 1KLGB 1FRGH 4EO5A 4LCIL 1OPGH 2BVQB 2R0ZL 4YUEH 2O5YH 3NEOA 4ADJA 3L3JB 1JZ2A 2X2UA 2X4QB 4ETQA 4FADA 3LH2L 2J2ZA 2MQGA 2W60B 4PJ8B 3TO4C 3RWIB 3MV8A 1XSOA 1INDH 4XBMA 1RFDH 3GSNA 1ASQA 4OCSH 2TSBA 4GP4B 3C5XA 3ARBD 3PGFL 4KRPB 4LSRH 5FKAB 2Q3XA 1UXSB 5BZDB 5BO1H 4QJ4B 3CU7A 2HFFB 2DPKA 1OVZA 4MD5B 5BV7C 1UURA 3FFCB 4DGYH 5IB5A 2CM6A 1EXGA 3IMWA 5IIEB 4HWUA 3X1NA 4WKZB 5ANMB 4U1MB 4LSQH 1WA1X 4QHNA 4DH2A 4FD0A 5E0FA 1HIMH 4G7YH 1TCRA 3M7OA 4QTIH 3PL6D 3UACA 1JK8A 1FVEB 4F3FB 5H4ZA 3O2DA 1BYOA 4RZCB 1E4KC 1E4HA 4UQIM 1Z9NA 4B97A 2JKIS 1A6ZA 2VDMH 3MXVL 3HI1A 5GS2D 1S7XB 4E36A 3DVIA 2P52A 1TMCB 5AUMA 4YBLC 1GA2A 5DHDA 2VERN 3TT3H 2A6DB 2WKOA 2BZDA 4B7IA 4CVUA 2WAQA 3ESPA 2HCZX 3KZ8A 3T0XA 1MXDA 2D3LA 2NSQA 2IWGA 5F7WC 1T66C 5LB1A 4HIHB 4I0PC 3VI3F 1R24A 4LCWD 2Z4QB 1VZIA 4MJIB 5IW6B 4BJLA 1DUYA 3VXQB 3EJUA 3NFNB 5FGCB 3CXDH 2XT1B 3SN6N 5JXEA 4GRLB 4K5LA 5DEGA 1SM3L 5KWYC 2FAUA 4ZTOL 1BBDH 3C09C 1EFQA 3RX9A 3VFVB 2GVYA 3D69B 3O3EA 2Y7QB 3L9RB 4OZFG 1AS8A 4HT1L 2KKQA 2VZTA 3ILDA 4GSDL 5E4IA 4NQEE 3E6HB 5JA9A 5TQ0L 5I1CH 5MHSE 3MJWA 5LAPA 3PAVA 1XR9B 2AEIT 5F3HB 4KNSA 2XWZA 3IJEB 1U8KA 3BUTA 3OF6A 2NY7L 5I1LA 2J6EH 3QWQB 3QR2A 2VDQH 4K23L 4ATWA 3MROB 4NN6B 2LU5A 4A7QA 4QUOA 4U1LB 5L2KE 2KPWA 2PN5A 4DKTA 1E8YA 5D7JC 3ZTEA 3S37X 3TZVD 2B2XH 4J3WA 3ABZA 1IGTB 1KENH 2NY5L 2J6EL 3QUYD 2XPZA 1EV2E 2HRGA 4NT6A 3S5LB 2FEJA 3T8VA 3TVMB 2WOYA 4W9KC 4GAGH 3TBWB 1NDGB 2Z8RA 5FLVA 3EDDA 2DYSB 3BXNA 5ERWA 3VFSB 2UXGA 1GMIA 4HZAA 5DWPA 3LVTA 5I6OA 1F4XL 1P5UA 3ZE2B 2YN3A 4ZUUA 1QEWA 1VFBA 3EGXA 4I1PA 1WAPA 3I6LD 4BE6A 4HCRL 3QFGA 3QYNA 2OSWA 5CCGE 1MNUH 2VXUL 3D5OF 3G6AB 2NNCA 1H6UA 2NUTB 3IDGB 4M6OL 3X3GL 1KTDB 1M7IB 3CN1A 4ZQKB 1BEXA 5KG9B 1KNOA 4WFGE 5D7IF 2MSPA 2IFGA 5KBDA 2OSLB 1A7OL 1DJSA 2N1KA 4OV5B 1MNUL 2GJZB 1AHWC 2FNBA 2NTFB 4CGUB 2Z8VC 1MJUH 3HG2A 5E8PB 2OMXB 1S9KC 1I8KB 2PCPA 1SBSH 2BVPA 5EZLA 3BT2H 5CN3A 1TYJA 5M94B 3UZEC 4ZUTB 1HXMB 4HDIB 1TETH 4K3GA 4Z3EA 1JZ8A 3QORC 2DQTL 1QTYT 1ID5I 4HFUH 4K8RL 5TH2B 5F6IB 3D0VA 3F7VB 2GFBB 3PGCA 1BM3L 2ZWLT 4KDTA 4R2GC 4IEFB 4HBQA 5EV7A 4GI6A 4XN1A 3EOYG 3MBWA 1RJYA 2ZPKL 1R3KA 2EEBA 2GYSA 3QHTC 1YPZA 4X7CC 3UTZA 4OGAC 5DQDL 1NCIA 2CDFB 3HB3C 4P9HH 5C6PB 2R9HC 5G4OA 4AGOA 3EJPA 4FNUA 4NS0A 3F62A 5L88H 3OF6D 6FABL 1I7RB 5GJTL 1J9QA 4P49A 1ZLVK 1BSIA 3C5ZD 2W9DH 4MXQD 4AQOA 4U7MA 2Y5QA 2D73A 2QGBA 4M8UA 3VE0B 5AVRB 4G8IB 2R0KL 4NCC2 4LKXA 2UZPA 3RWCB 4EUPB 4M7ZB 1JZDC 1YEKH 4TLSA 3GPEA 2YAOA 1FO0L 1U3HD 3MV7A 4L5FE 3VM5A 1YNTF 3UBXB 4APXB 3LN9A 1BCIA 4PB0L 4R7DB 2K4AA 4TVPH 5HVHC 4J3VA 2C26A 3TCTA 4AV0A 4ZMVA 3D18B 4JO3H 1RSFA 5CSGA 3SPHA 1ZLSH 5EEUA 2VRQA 4TUJB 4HUWB 4KHXL 4JM2F 4P23B 4FFVD 2CSPA 1AR1C 2V33A 3R8BB 3V8OA 3WIFB 4D7PA 5GSVB 1A4BA 2IWFA 2XWTB 1IT9H 1QFHA 5FYKL 4DUWA 4HP5A 4Q56A 3OR7A 4AYGA 4D2NA 2V7HA 3DIDA 3LVEA 1PY4A 3S3BB 4JCMA 1OP9A 4ZI8A 3OTTA 5E2UH 1G9ML 3WKQA 4IKKA 3WNOA 1E5UI 2Y07H 4PRIE 5C08D 1JNHA 2VDLL 5FUZH 1S9YB 5K9JL 4PJ9D 4KVCL 4PJDB 3PHQB 2ICWI 2ZICA 4JZNA 4XO4A 2BSRB 2G0LA 4B9IA 3R06A 4MA8L 2I85A 5HHOB 2IH3B 4UV7H 1YNTB 3TURA 2V2XB 5ITFA 1PZBA 4AJYV 1CFQA 3DUHA 5CWSB 3GSXA 1GCFA 2GBTA 4RGOL 3PXHA 5F7EL 3BP4B 3HG5A 4XGZA 3T77B 1T4KB 3MUGB 2PYFA 4TQIA 2RCSH 4H26A 2AQPA 1JPTL 3PG2A 2L7EA 1JYVA 1G7LA 1UJ3C 4J4PA 5EU6D 4XVJL 1S3KH 5KSVB 4XPBH 2P7TB 2XZCL 1YQVH 5IMOA 2XX1A 2DBLL 5BO0D 4ENED 2EINB 3AC0A 3OWRA 3VFPB 2X1QA 1MFBH 2R0LL 3NFSL 1NCAH 1G4MA 3T2NH 3OD3A 1N8ZA 5F1SA 2XNAB 2VLLA 2Y6SD 4ZAKD 1LDSA 5I2IA 1YMMD 3U6XS 1DEEA 1AGBB 2MHAB 1HXYA 1K8DB 4J5VA 1F1AA 1OEZW 3TZVB 3L7EB 3VJ6B 5TK2A 3MUHL 3HAEH 1GGUA 5IK3B 3OGCB 3JYBA 1LEGB 1KIQA 4N6QA 4PJAA 4EUPH 4PCSA 4DUXA 1H8LA 1SNRA 2BLFA 2K7QA 2CGRL 1LP9F 3K81A 1PQZB 4RMQA 4DZ8B 1F2XK 4BRVA 1CTOA 4KROB 3FUDA 5LDUA 4OLXH 4OB5H 1GY2A 3ZMEA 3ARDD 4QRQA 3VD9A 1R3IL 1J05A 1WLHA 3O6KL 3KLSA 3NCMA 5AZ2H 3V4VL 5J6HA 3Q5OA 2X89A 3BW9B 3CFJB 1JXJA 4YHYC 5J0BA 4HETA 3KPSB 4JGUA 1A1MB 1EJ6A 2GKIA 3LIUA 4Q9CA 4UILH 2OCCB 5FYJE 3U9UA 3QFDB 4G7QB 1CFSA 3IJHB 4NQEA 4Y2OB 4GB9A 5FB8A 5F1IB 1WAAA 3FB5B 3M8OL 4JM2B 1YJDH 3GSOA 3LNEA 5HD8D 2Z31C 1Z9SB 4PJGB 2DICA 3ZKXC 2VR7A 3RY6C 2OTWA 4M7ZC 5D2NA 4Z7WB 3K2UH 4IBUA 3U6RA 1Y6NR 4MKTA 4MJ6A 4NHUB 2IH1A 3EGDB 5T1JA 2ZIDA 4OD1H 7TAAA 2ETWA 1KTRL 1PZCA 1IC1A 4ZMQA 1IAOA 3ERXA 4OSUL 1B2WL 2IV9A 1OZUA 2ESVA 3VDCA 4LMQI 4XI5D 5DHVH 4IKIA 1O7DC 4QGTA 2WINB 3LXCA 4PB9H 2YPLE 1QFPA 2VM4A 5E2TL 1I1CA 1MI5B 1IZKA 3GZPA 1NBVH 5KBLA 4L1LA 1JWMB 3MV11 5GGRB 2UZIH 4K55A 1RLWA 4POZD 4S0TD 4PRPB 2N59A 1ZEAL 1LK3L 3EUDA 1P6AB 4P0DA 2VIRB 1P4BL 3KD4A 4QKTA 3ULVE 2GTZA 2HX9A 4PJCB 2WO2B 4W70A 3OB0H 3ZPDA 4AUUA 4B0MM 3TIDA 2CDEB 3MR9B 4XC1H 2VDQL 1QNIA 1RUQH 2F15A 3HZYB 3X1EA 4AQEA 1AQKH 1EAPA 1NSNH 3RVTD 2SEBB 3FCTB 2ZUQC 5HYJA 3DHPA 3GDCA 2AJ3B 4GXUM 4HPYL 4ABUA 4AW4A 2D0GA 4U3XA 2CKBH 1P2CB 4A7GA 5JHLL 2D2CC 1A5FL 3K8KA 3LPWA 3RNKA 5HVHB 5FHAL 2RGSA 1E42A 3HBQA 3FN0H 1U91A 1MAMH 1VCAA 3MLYL 4AT6A 4ZDHA 5HDBE 3EO0B 1RIVL 3FQNA 4RIRA 4PTUB 3BVXA 1L3NA 2VN6A 3X11A 2C1PB 5ICUA 1RCYA 2FATL 4AEHH 4AQZA 4LIQH 2XKNB 3SQBA 1BG9A 4N0UA 3II1A 4PRHE 4OZ4B 2V7NA 5GHWL 3RBGA 4CVXA 4Z3HA 1TTBA 3VWJA 1J5HA 3ALWA 2E4FA 5E5LA 5F89A 4UB0H 3V0EA 3TBYB 3EZ8A 3BLBA 4M4RB 1HSBB 3ARGC 1W15A 2YUVA 1NFDB 2GK0B 4TUKH 5I8EB 4QRTB 1T21A 5ICYB 3W11D 1JDDA 3ZZSA 2GBVA 3V6FA 2FWOA 5DA4A 4TUOB 2CXGA 2X3CA 2AS5M 2JH2A 4GSRA 1JERA 1SXCA 1U8CA 4L8SB 3M7FB 3SCMC 3BZ4B 2F54A 2WP3T 4G42B 3FUMA 1NUGA 2Z35B 1G7HA 1EO5A 4XPHL 3RHWF 3ARWA 2OYLA 3G5VB 4I7ZC 4QHLA 1YN7B 4BZYA 3CBJB 2C9XA 2EC9T 3QNXB 2I9LA 1VA9A 5FW6A 1YHPA 2CIIA 4QHMA 4L4VA 2AJXL 1DN0B 4N2AA 4YDKL 2I9LB 3KCWA 3QNXA 2TRYA 3ARGD 3HN8A 4Q2ZA 3G5VA 4QHLB 2V4LA 2E56A 3MJ9A 4NJ9L 1BMGA 2FJFB 5C0EB 3NJIA 4WHYG 5CN1A 2EE6A 2R23A 4HISA 3BZ4A 3OAYH 4G42A 3VCLB 3HMWH 5T3ZE 5J5EA 1UKTA 2ZKWA 3DPDA 3CFKA 1P7QD 2EKJA 4L8SA 1MHEB 3VWKC 4IHOA 5DXWA 4OQ1A 3NIDE 4N3TA 3V6FB 3KGTA 3V6ZB 2BO0A 4DP1X 1FO0A 3MJ7B 4MS8C 3UZVA 5IHBA 3SD5A 4ZUSA 3DBXB 2HFGH 2WV3A 4F7TA 1S5IH 3NCBB 4R3SA 2A1WH 2YKLL 1CF8H 4LSPH 3DJRA 2CM5A 5CD5D 3CG8A 1LTXA 3U7WH 3ZYZA 4GAJL 3DPBB 3VWJB 2VXVH 5KVDL 2EXWD 3V9FA 4UBDD 4GS7B 4JE4B 1ZAGA 2W8CA 3DYMA 1J7VR 2ED7A 4Z18A 3P11L 4Z7NB 1IIIA 1MI5E 1JF1A 1D9KD 1ZTXH 5EUKB 1RJCA 5JW4R 5F6HJ 1QR1B 5PCYA 2H45A 2HFTA 5IVZA 2O61B 1D5ZA 4G9DB 4YPGB 2PXYD 5AWNL 1SN5A 5HHQB 2CKBL 3HB3D 3V6BR 3VTMA 5F1OB 4AT6B 4ONFH 1J18A 4XBEL 4JRXB 4D3CL 1NTDA 1LO4L 1LO3H 1TG8A 2P5PA 3WHE0 4LRNL 3D07A 3FTVA 1FH5L 1MFUA 3HNVH 2VJXA 4PJAE 3BRFA 2MMXA 1FORH 1F02I 3W11C 2H0JA 2H26A 4Z7UE 3PWPA 2C9UA 4QRRB 3QUXB 3MOQA 3NJGA 2LGNA 1R4XA 1Z3RA 4H0LC 2FATH 1R0AL 3PAZA 4XP6L 4B9PA 3FU6A 1UD8A 3L3HA 1WWAX 3NK4A 4G1MB 4UZUA 5TGBA 4Y4KA 1AMYA 4FE9A 4EAEA 3O6ML 4XI5C 1UWFA 5M7QA 4NQVA 3P4OA 4B9JA 4YLBA 3S2AA 5DZAA 4AM0A 2HJFB 1S7UA 3D2UB 4FQXB 3S5ZA 5IG7A 3NK3A 4AZ8B 4WWOA 4UTAL 3UYOD 5DS2A 2EYRA 4LOEA 5LN4A 1DQDL 1T22A 3F58H 5FCUL 3KMDA 5D1XA 2X89D 2BW5A 2TRHA 5EBMB 1BPLB 4PI2A 2EE0A 4I5BB 4H8UA 1XR8B 1J8KA 2OR7A 3OAUH 4L1TA 3UTSE 1B9ZA 1MSPA 3L17A 3PF2A 4MXQC 4UQBA 3D0AA 2FJGB 4OF6A 1BD2B 3B9KA 2DYPD 1VJSA 4XBGB 4MA1C 1N5YL 4IRSD 3T6XA 3D3VB 4NN7B 4QHPA 1Z5LA 3MGOA 4ILDA 3ASWA 3ZHKA 2E59A 1HZLA 2EC9U 2C1OA 4J3XA 2GK2A 4AGLA 1OAYL 2OQJA 4OF3A 3EHBB 4DKAA 5IFHH 2ZD0A 4MJ6B 2EH7H 4UINL 3GXPA 1QTSA 3AM8A 1WA2X 4B3VA 1A9EA 4TUUA 1XF5A 3BKYH 1TYEB 2KLSA 2ADFL 2HUEA 2NY6B 4KQ4H 4J6RL 4WW1B 4NHCH 3DSFH 3O3UN 3BDXA 5KZCB 2XBTA 3D85D 1EK3A 1MHCA 4TSCL 1FFOA 1RHFA 2WJ7A 3L9YA 3SGKC 1X5MA 2I7SA 3N06B 1BFTA 4OI9A 1X5LA 5HI3C 4AGPA 3STLB 3SY0B 1JNNH 1HHKB 1FFRA 1P69B 5I1GL 3IFLL 4NZRL 1CU4L 4LKCA 4ZXBD 2PR9A 5IV2A 2NW2B 4XRCA 1NMAH 1D2PA 2GT9B 2HXAA 3QK0A 4KNUA 4ZW6A 4HOMA 3S4SB 4GI8A 5E03A 3VW3H 4DN4H 5CJOH 2A9NL 1PQZA 1ORSA 2PWGA 1IEHA 5HHNA 1S7VA 1A3LH 2AQ2A 4K7PY 3DX8B 4OFPA 1U93A 3FBKA 4DTGL 5IK3A 2IPTL 1KG0B 1SM3H 2DEYX 2PMZA 4IIQA 4JHUA 5D1QC 4HGMA 4KUCF 4KXCA 4DEPB 2ZUXA 4DERA 4NSKB 3IDYB 4QI3A 2EH8H 3NCEB 3QIBB 4WI3A 5CJOL 3LQZB 2P5EB 4YSPA 1DQJB 1DVSA 5DJ6B 1HKLL 4E9LA 1DEEB 1E27A 4MA7H 4MCNA 7PAZA 2P47B 4NM8H 1DJYA 2APBA 3QHZL 4PRDB 1BLIA 2HB0A 4BZ1L 2OR9H 5I0WA 5E99L 4ZD3L 1A2YB 4IYKA 2WK2A 3VFPA 1HWHB 3RFZA 5L2JA 4MYPA 3RPIA 1IKFL 4BM7A 2QQLL 1ZSDA 2WUCH 4PU2A 3RWFB 5IGXH 5HDOA 1CTMA 3QUXC 4LT7A 3L95A 3HE6A 1H15A 4EN3D 1T1WB 3IU4L 1WBXA 4EI5A 4Y2LA 3QEGL 4GG6E 4FFWC 2X1XR 5DO2C 2Q8AL 3QUMH 1SFHA 5IROA 3ET9F 4L3ED 2XN1A 5D6DA 5GRUH 1GTFA 1W9XA 1YYMH 1CFQB 3VWJD 2I24N 3HZKA 4IW4C 3TBBA 5ITFB 3T0AA 1TOXA 2V2XA 3P3UA 4M1GL 3MOBH 3UTTA 4XN8A 4NDMA 1ORQA 3QUHA 3ZY7A 4NQXB 3NP3A 3T8MA 1HT6A 4PJDA 3FO2A 4DW2H 2PP9A 1OTSC 2AF2A 2VDNL 3IXTA 4EI5D 3LEYH 4PJBA 4PJEA 1JXKA 3FHEA 4OB5L 3VXMB 2WZAA 3U48A 5EU4B 2W9LA 5CSZA 5DQJB 1KTKE 4HIXH 3ARPA 2BC4B 4MSWB 1E6OH 1TJIH 1OCWL 4TSBH 4X6FB 5GJSL 3J27A 4ODBD 3U0WH 2BP8A 4PJ7F 5IOPA 3TNNB 3GLZA 2P5WB 4IHBA 1NDMA 1G7JA 4P23A 1QBBA 2X4RB 3CK0H 1UJ3A 3NSYA 4ZOEA 3VU1A 2DM4A 2OMNA 1SYSA 4ODTH 2NY0B 3A5VA 3MYJA 3SKNB 3DSFL 3BIKB 1LE5A 4PP1C 1FL3B 1NEZB 2G75B 3D18A 1ET7A 5FS5A 2ESVE 1T89A 1FL3A 1NEZA 3IAQA 2PTUA 2GG1A 1TZGL 2C7UA 4XMXA 5EN2A 4LIQE 4JFXA 4ODXB 2EILB 1IGFH 2FJUB 4K7FB 3FQWB 4CC1A 3EYFA 5GS0H 3CFDA 4XXWC 2ZUSA 1E2WA 1E4XL 5D70L 5CEZE 5IOPB 1L9RA 4G8IA 2O26U 2CRZA 3VE0A 4ZPTA 1MJ7L 2WYZA 4CSPA 3TJHD 1T0MA 4IS6B 3KS0H 5D7EA 4M5SA 3HLAB 3AREB 4GO8A 2OZ4A 1NWOA 3ETBJ 4L23A 3ZDXF 4R4FL 1OWWA 4FFVC 5E4OA 2ESVD 1JGEA 2XZZA 3VSTA 1QYGL 4ODVH 1OOAA 4Y19D 5IJBC 4G8GD 4HQQH 4FFTA 5AOMA 4ICXA 4JDVA 1AQDA 1IE5A 4RWYL 1UM4L 2CRYA 1RP8A 3PYCA 4NJ9H 2DQIH 5HVGB 1ZHBB 5T3XH 1R1CA 2B3RA 3CFCL 4FQ2L 1A7QH 3F12A 4ZX6A 3F00A 3CDCA 5F7BA 3SHSA 2WIIB 2AK4A 4U1HA 4TTGA 3BP6B 5EZLB 3SE6A 2BVPB 1UOVA 2B7DT 2PLTA 3P9MB 2IJ0C 3NN8B 1WBXB 1T1WA 2VW4A 4W9GC 5AFAA 3A21A 2AJVH 3AACA 4F7KA 1OSPH 1NAMB 1QLRB 5L2JB 3RFZB 1MREH 4PJCE 4ZMPA 3IDGA 2NUTA 1SHWA 2VDPL 2MPAL 1U8JA 3BZEA 3FRPA 4GT0A 4OGAD 2DH2A 2IAND 3IK2A 2KZKA 4K5NA 2NY0D 3AT8A 4Y2DB 3KPSE 1V05A 3TN0B 4QJ5B 1G9MC 5D7IB 4YUEL 1A25A 3FO9A 3MJ8B 1QNZL 2HT2D 4NP4L 4RCAA 3CV5A 3CLWA 1U93B 2DRUA 3P30L 3DX8A 2E7BA 4UQCA 1OKEA 3BXNB 4HHWA 1NDGA 4LIQL 3CNKA 3PJSA 1CDUA 1V3JA 3T0WA 2Y72A 4LLVB 4EDXB 4E9TA 1UEMA 4P4KB 4Y4KD 3S4SA 2PTVA 2DQUL 3H9YA 4ZFFB 5C0CD 3MRGA 1BAGA 3EG9B 3DGCR 3RA7H 2GT9A 4HD9A 3B7RL 3UXFA 2JB5L 4XRCB 3WKMH 2YRPA 1S78D 3S48A 4ONOA 2AK4B 1E8XA 1VZGA 3EFFA 5B7EA 2C4FU 5GRZA 1ZHBA 1YEIH 3CZFA 4YZFF 4QHKI 3IJEA 1PGRB 1E50A 1P84K 2O5ZH 4D9RE 1MHCB 3SPCA 4PVLA 3SDAC 4G70B 2XVKA 4Z7VF 3QNYA 2O5YL 3UMNA 1XF5B 4L1DA 2H9GA 2LU7A 3VX1A 3IAGC 3EYUL 4Y4HB 5DEGB 3HLAA 4L3EB 3OM3B 4PLOB 5HJ3B 3ARBA 4TYUA 4MJIA 5IW6A 2Z4QA 1OF2B 1MZZA 1RZPA 1WFOA 1R24B 2NX5E 2VXQH 1RUML 3QQ3A 5BS0D 1XIWA 1CD1B 1AR1B 2R1YA 4YEFA 4ODXA 2IAMB 1GW0A 1GAFH 2C7UB 3HE7D 4GW5B 3B9KB 4K7PL 4O02B 2NXYD 4Y9EA 2FJGA 4AC2A 4EKJA 2DIAA 3MLSL 4WK4B 4F58L 2VDOB 3SGDH 4XNYL 3V5DB 1NAMH 3KPMB 1TCMA 1OHQA 5AW6B 1HIML 4G7YL 5D1XB 1Z9OA 1S7XA 4Z78A 3TXAA 1UJ3B 2Z0UA 2X4RA 3B6SA 2YD3A 4X7FC 4PHXA 3WLBA 4IM8A 4HJ1A 3IXAB 4NKDB 5FC9A 1JK8B 1FVEA 4F3FA 1C12A 4JPKH 3SDXF 3UG5A 3T3PE 4EI5C 5FF6A 3N55A 5CSZB 5EU4A 2JCCA 3B37A 5IVOA 1FA4A 3VXMA 2Z65C 1MUJB 3WN5C 1T66D 4HOZA 3FSWA 4XP9L 1U8QA 3DX9A 1MCQA 5DFWH 1ZLWH 1JNLL 4UT7H 1MRFL 3PWPB 2NUPB 2XTSA 4L3FA 1UGNA 4G6KL 2VNCA 4JREC 1JPGB 1VENA 3UTTB 1TNNA 1X7TA 3HZKB 2HMID 1QRNA 3DBSA 2Q2EB 3NQIA 3QJRB 4OIAA 4HA1A 5EIVA 2EDHA 3RWIA 2NY5C 4OFYD 3WEOA 4PJ8A 2WWKO 5DC4B 2YLKA 1HINH 3THMH 4I18B 3LZPA 2DI7A 1E43A 3L95B 4QXUH 1KLGA 1KBKA 2G3XA 1ZSDB 1R3HA 1AC0A 4HEPG 3ROOA 2OKMA 5D7KE 5E2WH 5BV7L 1ASOA 1P4BH 3ECWA 3FN0L 3O3BB 4JM4H 4OLYH 1A2YA 1UOKA 5DVNA 4GKSA 5EUOA 5HHXH 3OHXC 1WTLA 1QA9A 1C5CL 4N90E 3DPBA 1MY7A 4LCUA 1T1YB 4UOJA 1IMHC 4X83A 1BVNT 1RIHL 4UV4L 1RUPH 1DBMH 1EXHA 3NCWA 1LO4H 1HH6B 3T2QA 1TVDA 5DZOA 4ZUSB 1F90H 3CXHK 2BNRB 1FO0B 4IIQB 4XN2A 1KG0A 4UTAH 1JPSL 3IBEA 5J11C 1HC1A 5DZVA 1AD9A 3W2DL 4TNVK 1PNDA 1SRDA 2AZAA 2QQNH 1RKRA 1QBML 3CHOA 5C0JB 1J8HA 3C5JA 3FCGA 1OCCB 4A2GA 1LMIA 5AAMA 3BWSA 4NKOA 2H6UA 3JVGA 3IGLA 1H3WM 3H6JA 1JSYA 5EZOL 2ARJB 2NX5B 2QTVA 4DGYL 3RUGE 1IBGH 1BXUA 2NY1C 4HJJL 5IVXB 2X4TB 4KX8A 1BW8A 1DN0A 1K6QH 4L4VB 1WBYA 1QBMH 4G71B 1KJVB 1KEGH 4LSSL 3UOAB 4DO4A 4S1SH 1CL7L 1BZOA 2DTSA 4ZFGH 3MXWH 1D6VL 2NY0C 3BH9B 4NC1C 4Q6IA 4WHYH 3BAEH 4EDWH 3U7AA 3CZJA 3KDPB 4G1EA 4LPUA 2WLMA 1ES0B 3WFDL 2OSYA 3ZXAC 4WUUA 1VPOH 4QCIB 5HI5C 4HWBA 3QCTL 1MFDL 3F6LA 5IB2A 4K3HA 1YJDC 1T21B 2QPEB 3INUH 1EEZB 3LKSB 5IBTL 3FO0H 3QQXA 2DD8L 4N2FA 4JPKL 4ZBJA 3MLVH 1BMWA 5INDB 4WVRA 1B4JH 4HEME 4GAYA 2QZ5A 2MCMA 2Z7ZA 4HLEA 2V7NB 2IMNA 3V0IA 2WP3O 5JZ7C 2VYRE 4X7EC 1SQ2N 4ODUB 2OS7A 5D5MB 2O6EA 5C09A 2JQMA 2X6BA 1E5ZA 2ZKHH 2CIKB 3IDUA 1LO0L 3EH4B 5C0CE 3M8OH 3MLSH 4FQLH 3QPXL 2CBMA 4KZDL 5EORH 1PBYA 1ZDQA 5CILH 3DDGA 4I9WD 3WS6C 2YZ8A 2EO1A 5LWYL 4JUTA 3VFUB 3DJ9A 2QZQA 1WS7A 4FQXD 2VZSA 3K5SA 1NL0H 1IM3D 3HAEG 2WZ5A 5DD6B 2PYED 5DRWB 2EEFA 2FK9A 2E7CA 2CJUH 3DXAB 2DIEA 2YPVA 4WHCA 4RDBA 1QLEB 3O3AA 1XH1A 4BUHA 1E4WL 3L3HB 3L5HA 4Z23A 4X42A 2VR5A 3IMUA 4M9PA 3O3AB 3QIBC 4NUQA 4AE0A 5F1NB 5DCCA 3DXAA 4RAVB 4DZBA 1RHHB 5GGSY 2H4EA 2IAAC 2JKWA 4EN2A 1E2ZA 5EFIB 3U1QA 4LBAA 4UUJA 4XNMB 2Y3NA 2ITCA 4YXKH 1Q1JL 3C60A 4JRXA 4XAKD 1AXSA 3GIZH 3X17A 1YMHA 2YHGA 5EBGA 1NGYB 4BFOA 1A7OH 5C09B 1F3DJ 3DARA 4EQ2A 3IPEA 3P3RA 1NFAA 4JL2A 4AL8L 3TT1H 3PWPD 5F7EH 2XG5B 3CUPB 1AH1A 1A64A 2R1XA 5ETUB 2WLKA 1X3DA 4YAQA 5CD5C 1ZVNA 5ANHA 5T8IA 2JV6A 4PJIF 4PWKA 5H94B 5I6PA 4XCCH 5INDA 2IH1B 1J8RA 4NHUA 4L1HA 3ZMNA 4Z7WA 1EJFA 3B4NA 1DN2A 4Q52A 4Y5VA 4H7VA 2AJUL 3HZVA 4IMKA 4XX1G 3X14A 1J5OH 5B38G 2ZE0A 1KXQE 3FB5A 5AZUA 4G1EB 4MCYB 2Y7NA 2H2PD 4BFEA 5AD0B 3ETBF 4FNSA 5KUMA 1OP4A 3FZUC 1FCGA 4Q6IB 1HZHH 2F5BL 4C8XA 2XZQH 1HILA 5IQNA 4LLDB 5EZOH 4EKXA 4AK1A 4KDTC 3CFIC 1TFHA 1KCUL 2FLMA 1CL7I 2J43A 2VXTL 5EF2A 1YN7A 1U0QA 4FXTA 4G5AA 2G4EA 3S8GB 3GXUB 2V6HA 3BVDB 5AENA 3U9PH 4WUUE 4NN5C 4DZ8A 1YUHB 4GO9A 4YBLB 5C0JA 3FTGA 5DZNA 5CMAB 1AD9B 3P4LA 2FWOB 3NZSA 5TF1L 4KI1A 2BNUB 1MIMH 2BNRA 3RWEA 3PS6A 4ZMWA 3L9EA 3DXAE 3ZYOA 1HH6A 1HSBA 4FRWA 4I77H 3OHMB 4EZJA 1DVFA 2MPVA 3RVWD 1K9TA 1T1YA 4KPHL 5D70H 1N8ZB 4YBQC 1IM9D 3KXFE 4LVHB 4LOFA 4XPFH 4HKBA 1SF5A 5ACZB 3VGBA 5CN2A 3TOPA 3CTTA 2Y7LA 1XHHA 2XY2A 3NCFB 1JMXA 1TEGA 1MCJA 2FBJH 2Y4SA 3DIFB 4JVUA 1QUPA 4X99A 5L4MA 2PYFB 4MXVF 4ZDHB 3WBDA 4UQEA 3E38A 1U91B 3B9EA 2X9XA 1V7ML 5ECGA 3VXSE 4PGBA 4W9CC 4X5WA 2H32A 4N5EC 1QRNB 3I6GB 4OLZH 3SCMA 1P2CA 3GMRB 4MQ7B 2IPUG 2HN7A 1EHXA 2W65A 5J1AA 1YNTA 2H8PA 5CLTA 4YVNA 3CHPA 3GGWB 3JWNE 3SDXE 3S34H 3R06B 4UT6L 4B5ZA 5FUOL 1FHNA 4E0RA 1NCOA 3PQYE 1F4AA 1HHHA 1L9QA 2UZYA 1FV1B 3P0YH 3U30B 4EIBA 4Z9KB 2CDEA 1JIBA 3MR9A 1M56B 1JZ4A 5JQ6H 2V7HB 4ZMAT 4M7KH 5J1TC 4RGMC 2GTZB 4WTZA 2A9DA 4BD4A 5L8LB 5SWZB 3NRPA 5MENB 3HA0A 5T1KA 5I15H 5J3HD 1WA0X 3CVIH 2E9GA 1BD2D 3JQOB 2ICES 3PWJA 3R18A 5GGRA 4MRBA 4U1SB 1TU2A 4JREB 2WNKA 3DOSA 2X1PA 2Q8AH 3BE1L 3VH8B 3MLWL 5D2LF 1JFHA 4YHKL 4ZFZB 4W68A 3ZT6A 4R7DA 3EF7A 4KK5D 4O02A 4XP1H 5IEKB 4ZG1A 5IB4A 2ESVB 1DSWA 1CO1A 3P02A 5DVLA 4JHAH 4DIXA 2OYPA 3T0EA 1CD1A 3GC3A 1JXDA 3Q7JA 1ZGLA 2EEXA 2AJZB 3MRJA 3RWCA 3V0WH 1W72L 4IGBC 3ZIYA 4Y16B 3J2PA 2F7QA 4WFED 5HJ3A 1MFNA 4PY8J 4UDTB 5AW8B 1QTPA 4HCGA 4TMPA 4JQIH 5IZ7A 4KQ4L 3BPLC 1Z32X 4X5PA 3N44B 4H88H 4PAZA 3ABLB 4QT5A 2QFPA 4M7LL 4FKKA 3MBWB 1L9MA 1MAJA 4YQXH 2QPSA 1PZDA 4HS8L 3V0GA 1Y07A 4G5ZL 4NQSB 1CFSB 4QOKE 2Y5TA 2OP4H 3QWRA 2A9MH 1A1MA 3KPSA 2D7OA 2Q1EA 2BVTA 3GJFA 1KGCE 1AYOA 4AYDC 3EG9A 2QDWA 3SE9L 3PP4H 1TZIA 5I8OH 1CXIA 2AK1L 5J3HC 4PS8A 2W80C 1CI5A 4DKFH 1JL8A 4ADIA 3IB4A 5DQDH 4LLVA 1QSEE 1FZJB 4ZSOB 3CQQA 1PLAA 4U1NB 2R29L 2ADFH 1TSHA 1YNKH 3G6AA 3IWVA 3LB6C 2DLGA 3Q0HA 2KZ1B 1SLUA 2QADB 4S1DD 2VLMD 5CXPA 1KIQB 3HC3L 4PJAB 1I1AC 4N8PA 2YPLD 5DK0A 4X7SL 3VJ6A 3TZVA 2XICA 2ZWKA 3LMJL 3HI6H 3QEHA 2BP5M 5IQ7H 3BUQA 3WKPA 1JZHA 2JJUA 2B9BA 2DTMH 1TJGL 4I3RH 3TYFB 1Z0NA 4U6VL 1OK8A 3VWKD 1T83A 4RMVA 2DQHH 4XWOD 1NMAL 2A99A 1OTTD 4CNIA 2P24A 4W9LC 3S3PA 3EO1B 4KU1A 3BD3A 4MYWB 3S5LA 4NT6B 2V8MA 1A1NB 3OKOA 1O6VA 1W0VB 4KI5E 1HS6A 2Q0ZX 2WQUA 5EEYA 3NN8A 4G6ML 1S5IL 1T4KA 4Q58C 2E27L 3TTSA 1UD3A 3DYOA 4M1GH 3DX0A 1RY7B 4B9ZA 1OB0A 1RIUH 4PJFB 3VG9C 3BVWA 5C0CA 4PRNB 4QKXB 3VSQA 1CYGA 1N6UA 2LTQB 1AQDB 1BQRA 2WNGA 2Z7WA 1KB3A 4FOMA 3CN0A 1IAMA 4H25B 2FUQA 4FLOA 25C8L 3MRDB 3D0LA 3GTNA 5I75C 1NH6A 2DKUA 2Y7QA 1E4JA 3L9RA 4GRWE 4P4KC 2VMFA 4WENB 2P5WD 5E99H 2GIYA 3RY6A 3CH1B 3D05A 1JPFA 5DS1A 3UTPD 1I3RA 4FL4C 3ZT7A 3EH3B 1WTGT 2I7OA 1T0MB 3FB6A 3KH3A 4HWEH 5FECA 4BZ2L 1P7HL 3OMAB 4G7VH 1QACA 2BWDA 1H6TA 3LIZH 1IVLA 5GSVA 2CWRA 3VXTB 3VO0A 3CFDB 2VZ1A 3SO5A 2XKSA 2W95A 1YQ2A 4K7FA 2AZUA 2H7WA 2O5XH 5H35B 3ZHNA 2FRGP 3DETC 1M7UA 1USZA 2R2BB 3RWDA 1GPOL 2E9JA 5IHUH 3KPQB 1JZ3A 4ELKB 1D6VH 2R83A 4EDWL 3CHRA 3TV3H 2XRAL 1IBBA 2DQCH 3BIKA 3FCBA 5DUML 1LE5B 3ZE1B 3LSOB 3X13B 3WXVH 2EDBA 3MV7B 3FUJA 1FE8H 4M62H 4NXKA 3F85A 2WPGA 3NPSC 4E41A 2EADA 3TNNA 4OCWL 3R7QA 3V5HB 1E3XA 5HD8C 2K8QA 4X9BA 2OMYA 1ED3B 4KKQA 3DROA 4GW1B 4XR8C 3O2VL 4I85A 4WGWB 3WD5H 1ZV5A 1TJHL 4DOHE 4HWNA 5SWZE 1RPQA 4HWZA 5I1GH 1IAIH 1SLXA 3QIUD 4PJEB 4MD5A 3P4NB 1QP1A 1OP5K 2FT7A 1RULH 1MRDL 2LLLA 1P7BA 3RKDD 1PD1A 3T6ZA 3W9DA 4E42B 5BZDA 1UXSA 5IREA 4W1TA 5DMKB 5GZOD 1ORQB 2WLLA 4O2EB 4FCAA 4TKWA 1CI3M 5EZJB 2QLYA 3SKOB 1YAIA 4HMDA 3Q06A 4Y16D 5TH2A 4LARL 3MX0A 3FH8A 3GSNB 2M26A 2H2SC 2VM9A 2FBJL 3TP4A 2EH7L 3S37L 4G2AA 1MQ8A 2PCPB 3NABL 3VGAC 3N85H 4EI5B 3EBAA 3L3JA 3U0PA 3HE6B 3MBED 4R0LA 3VXRD 1AY1L 2GJZA 1AQ8A 1EO7A 4AIOA 3Q3GB 3IPFA 4JBSA 4WKXA 3S0PA 1DQKA 2WXPA 4YWGH 5KYUA 4NZUH 1N6QH 4LCCB 1GGCH 2EIBA 3W5MA 4LVNC 2YMXL 1E7UA 2H1PL 2OI9C 1WZLA 2ZYHA 3QEQD 5FA3A 4ZFOA 4PRPE 3N5AA 2FSDA 2BH0A 4J2QA 1COBA 9CGTA 3L08A 2DDQH 4L4VD 2ORBH 1FN4B 4NZJA 2B08A 1DJXA 3FQXA 5CEZL 2WB1A 1KTJA 3WXWH 4NO5A 4HU8A 3K46A 2F1BA 1BF5A 1T5WB 2FYYB 3WNNA 5FPIA 1R3JA 3OMZA 5ERWB 5B1CA 1HHGB 2IDSA 3BZFB 3JVFC 2WUBL 2XWEA 4MAZA 3VAEA 3GUFA 3KPOA 4FQPA 3Q44A 1KN2H 1IGTA 3KWWA 2GIXA 3G5YB 4OFKA 3WXWL 4XP4L 3X1GA 4WUUD 5KJRH 3QFJD 1GYCA 1UWGH 1E8WA 2YPVH 1VRSA 2WSPA 2JKRM 3II3A 4PIRF 4LBEB 1X4ZA 4OI7A 5FO8A 2UX6A 2IFFL 2DQGH 1HHKA 1D2OA 4WZ9A 3SY0A 2BRQA 5BW7A 2PYEE 5A2LH 1CE6A 4W93A 1T5KA 4TL5A 2RQ8A 2Y6SC 4PRHD 3R0MA 4XHQA 2XV3A 3EYOB 1A9BA 2FGWL 3LXAA 1PD0A 4HUKB 1AR1D 1DVXA 1IEBA 4JR9L 1AHWB 3IKCB 2R0WL 4HD5A 1C7TA 1OL0A 2CGYA 4CL7A 3RX5A 3O11B 4PLKC 4PD4J 3QW9A 2VLRB 2GTWA 4RFNC 1MEXL 1IM3B 2X88A 1Z5LB 1Z5YD 5EF0A 4NGHL 2WVVA 2ZOLA 3HHRB 1A6TA 4UT9A 4F58H 3QEQB 3QQ9C 4CN4A 1N8OE 1NAML 4OCLC 4MJ4A 1PG7H 2XY1A 4P5TC 1JNJA 3OQRA 3VTTA 1M7DB 5E8EB 3TBSB 4AEFA 4J3TA 2XQBH 3PWVB 4JFOB 1IFHH 5F9WC 1G1KA 5ICZA 4PV9B 2YRBA 5IG7B 1B4LA 1URZA 1S7UB 3D2UA 1XGPB 3FJTA 4JN1L 4PJ9B 1HAWA 3PUUA 4OGQC 4P99A 2P5EE 1CBVL 3IDMA 4Y4KB 3TPKA 4BV1A 5FFLA 4NN7C 1ILSA 3QQNA 3UTTD 3SDCB 4YDLB 3O0RL 2CLVB 3QFJB 1IRAY 3U7YL 4E9RA 2I5YH 4HJ0D 4YSAA 5I19L 4Y1SA 4PR5A 2A6JB 1JG9A 1MLCB 1B0RB 3BWUC 1FGVH 1XH3A 1AHMA 1WS8A 1OARL 1EVTC 4XMUA 4DGUA 3K2IA 4X0KB 1IGCL 2Y25A 2XQYK 1D6EA 4WHTB 3MV8B 1NAKH 2ZCLL 3ARVA 1KYOK 4ZW8A 1ZA3A 2QQKL 3FW6A 2GEEA 5CFHA 5ITBL 5HHQA 3IYLW 2CCVA 4H0GA 2PPDA 1D5ZB 4G9DA 5TE6L 5D7LD 5LXGH 2AEPL 5F71A 1HINL 2DMHA 3L9BA 3QUZA 3THML 1CIUA 4MJ5A 1CXEA