2A9DA

Crystal structure of recombinant chicken sulfite oxidase with arg at residue 161
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
372
structure length
369
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 94
structure length 369
sequence length 372
chains with identical sequence B
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a9dA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a9dA01
2BIIA 1OGPA 2XTSA 3HBGA 3HBPA 4PW9A 2A9BA 3HBQA 2A9DA 2BPBA 2A99A 3HC2A 2BIHA 1SOXA 2C9XA 1XDYA 2BLFA 2CA3A 3R18A 2A9CA 2CA4A 2A9AA 4PW3A 1XDQA 3R19A
chains in the Genus database with same CATH superfamily
3C2AL 3G7TA 1H3VA 1ONQB 4PBWD 3QNFA 3B9KA 2WQSA 3WKQA 3GRBA 1QUPA 5AVQB 2LTQC 3SEPA 3TO4A 2UZXB 1YEIH 5CWSB 3OKLA 3RNKB 2VITB 3I3EA 4TVSa 3GO1L 3LAFA 4POZC 2OL3B 4F37F 2WLKA 1FV1A 4JKNA 3JWOL 3RIAK 2RHEA 1TETH 3FH7A 1BFSA 1GOFA 2YD8A 1SRDA 4XMVA 5EF0A 3PLYA 2ICWB 1CMOA 3JTBA 1HC1A 1D5BB 4UAHA 3I6KA 3KPPA 1PMYA 2F54B 3ZN6A 1RJYB 2VLKB 4HJSA 3BGAA 5HYJD 3U82B 2FQDA 2XWBA 4KJWD 4JGMA 3FB7B 3RHWF 4OTXL 2X4PB 1OO2A 2XX1A 4WI5A 4K7PY 2PXYC 4HK0B 1CXHA 4JQVC 5I6XB 1HI6B 3HE7B 2B9BA 1GZQA 5IM7B 1P7QD 3LIUA 5ID0A 3U48A 5DEGA 1J1OH 5D6DA 1ZCRA 2VSDA 5FV1L 1BMGA 1U93A 4FABL 5IHZA 3DV6A 5BRQA 1RZJL 4OZHE 1MRCL 4YE4H 4MB5A 4NQSB 5D71H 2IDTA 5E6SB 5IOPA 2H3XC 4MJHA 1U8KA 2YSTA 3UPAA 4M7LH 4B96A 3ZTDC 4ZXBA 1J5DA 3DBXB 5AKTA 5F1NA 2F5BH 4MZ2A 1AZUA 1QYGL 2VDQL 2ZYHA 5E4EB 2EIZA 3QUMH 1FVDB 2ALWA 3DSFL 4MJ2A 3TN0B 4FFYL 4BRVA 1AE6L 3PGFH 1BLNB 4PS7A 3GNML 4IKLA 2GEQA 4R0LC 2BNUA 4UI2A 3O6FD 5L8LB 4NT6B 3H55A 1CVSC 2DWXA 1TMCB 1X44A 1NC2B 1UD5A 3ETBF 5DZPA 1G9NH 6PAZA 1LVEA 2H6PA 5AALA 3HNVL 4O2CA 3PIQA 4U1JB 3DSNB 4L1LA 5CNHA 3D2UB 4OF3A 3OJVC 4L37A 1X5ZA 1L9SA 1QLRA 4H0GA 4NKIH 2JKLA 1IBHA 4LNRB 4F7EA 2CRZA 1QQDA 2BJML 3FO9B 4MD5A 2FLRT 4AYMC 5BO1H 1U6AL 2CO6B 3DOSB 3HR5A 2XN2A 4ZMXA 2QMKA 4L05A 4K4KA 3RX8A 1MH5B 1BOGA 3GMQB 4ELMB 5IMKA 5D2NB 3DARA 3WN5A 1NBZB 3MFFB 1CTOA 2KKQA 3VXMB 1PF3A 3W39A 4WW2B 3KLHC 3P2TA 3HZVA 4M61B 2OTUB 4YPGB 5IESL 4U1KB 3B2VL 1AIFA 1U8IB 3EO0B 1JGDA 3IMWA 3WG7B 3ASNB 4D7PA 1KTCA 3WKNA 1NBYB 3ECQA 1FFNB 2GC4C 1JWSB 1SLWA 3IDNA 2NY1B 2JI2A 5HHPA 3PQYE 3CHQA 3N5AA 4FYSA 4O2FA 3EGDB 3K6FA 2WXHA 2DDQL 4TTDC 5C2UB 3ZL1A 7FABL 5GS1A 4LSPH 4JX0A 3S4SG 1IFHH 2UY7B 1NGXA 3K4DA 3K5SA 1PEZA 4TUJA 4OJFH 3WV0A 4QMEA 4HJUA 4BM7A 1K8DB 3WIAA 5TDOA 2Z1PA 1X4ZA 1URIA 2F19H 1MCFA 4XB3A 5KAQF 3BUPA 1JTPA 3L17A 4I0KA 2B3IA 5DHVH 1QP1A 4DJMA 2VDNB 4GMSL 5EORH 2WP3O 2EH8H 2B1AH 3MLZL 3B6SB 4PS3A 5GISH 3L5WB 2VISB 1AG6A 1XAKA 5I76A 3QNXB 2VXQL 1MRFL 3RJQB 3MBWA 1MY5A 2W5PA 3CDZB 3NRPA 4CDHA 4JKPH 1ZE3C 3DVNB 3DUHA 4APQC 3AUWB 2H8PB 5EZLB 4CGUB 1NCIA 2OCJA 2ARJA 3EO1B 1KIPA 5J11C 1OAQH 2BVYA 5D72L 4EIZC 4PS8A 1X5FA 2ALAA 2MCPL 3WIIH 4FQXA 4MKMA 4HJ0D 4CKVX 3WXVL 3ROLB 1JV5B 4S1SL 1KB5A 4U1GC 1LE9A 1QPKA 2GJRA 3S35H 4R7DB 5KOVC 2AK4E 4N2GA 2JK5B 1N18A 4ODUA 2VQ1A 1U8JA 3N55A 4JO1H 3GSOA 1S9VA 4KK6D 3EHBD 3GRWL 1UM6H 3GBDA 4Y1AB 1S7QA 3IXAB 4JZJB 4U6VL 2X6VA 3BGFB 3RA7H 4CDGC 5TDPB 1KPVA 1T04A 4ZAKD 1OGAA 4EUPA 5AVUB 1O9ZA 3UPCA 4HC1L 1YYLH 4JDEB 4PRHD 2V8MA 3OLDA 3BD4A 3WGUB 4DVBA 4L4TA 3CDGB 2BDNL 4UT7H 3NCMA 3QQ4A 5DUML 1CL7L 2WLJA 3BIAX 4WI4A 3UBXG 4CL7A 1WA2X 1WZ1H 1BM7A 2PO6C 4N8CH 3PP3H 5I6KA 2UY6A 5DQ9B 3O9WD 3B2DC 5F3BB 2AF2A 4QTIL 1BVKB 3JV0A 1FGNL 4XZ4A 4JLRA 3AWGA 4TQPA 1QNIA 4UT6L 1II4E 3SE8H 1WISA 3MJ9A 4MAUL 5D9SA 2KYIA 5IKCB 3FQ2A 5HPOA 4I9WD 1VGEH 1OHZA 1RZ8B 4UIMA 4PV1C 3PCYA 3F7RA 2PXYA 3MV7A 4JQVA 3OZ9L 5KYNA 1CICC 2Q8AH 2GKIA 5FYJE 3O45A 1NSNH 3CZEA 4BZYA 4ZT1A 1G4RA 1DJXA 3AT0A 3QQXA 5ICXB 4OCYL 4OIBA 4BFKA 5J4MA 4DPAX 4NLHA 4AQ1C 2VABB 2CKBH 3O3AA 4GO8A 3WHXA 1PZ2A 4HF5H 3BP7B 3RWHB 3JUYA 4U3SA 1FUNA 1NFDA 3KPMB 2ZYSA 2XBZA 2AV1A 3NCYS 3QIBC 5AVVB 3LZRA 1T0OA 3U6RA 4DCQB 3K6OA 2PCFB 2VL5B 3RWJB 2N01B 1WIPA 4TM9A 5CEZL 2V9QA 2R83A 2D2OA 2HPTA 3KWWA 3BZ4B 3RWEA 2A0LC 4NUJB 1EXUA 3MHZA 2EKJA 2HFGH 5G5DB 4F15B 1CL7I 4I48B 3CD4A 4MJ5B 4R0LA 2FBRA 2ICES 5LBSA 4UIKL 2D8KA 1NFAA 1KYDA 1MLBA 4NKMA 3HB3D 3BWAA 4LMQE 2CO4A 3EJPA 4NUGH 1J0ZA 4IYKA 4PRPA 1BYPA 3IJ9A 3K71B 4UB0L 4HUXA 3NBNA 4ODTL 1PZDA 2LVCA 3L9YA 3TEXA 3TURA 4XVSH 2OCFD 3KH4A 4FQ1H 4NFBA 2FHFA 4EUPH 1IT9L 3PUCA 3C08L 1RJZB 1FVEB 3S5LB 2W9DL 2MTPA 4UV7H 3I50L 3UAEA 3NIGE 1JYNA 2CLRB 4MNQD 5FKAA 4LSQH 3LH2L 1G9MC 4JFWA 5JW5B 4G8GB 1PJ9A 2X10A 3OJDA 3ARFD 3WI9A 5E1QA 4R83A 5FYJD 4OBRA 5I9QC 4URTB 2N4IA 4G7VH 1T1WA 3SQRA 4WW2F 4K7PL 3DO3A 3CC1A 4XP5L 4XWOD 5CGMA 5JHLL 1HCVA 3HLKA 3QDMA 4JUTA 1T5XB 2VN6A 1CDJA 1DZBA 2K0RA 3HLAB 1CDYA 2B59B 2X09A 1OOWA 1CLVA 1RHHA 2BY0A 3NSJA 4QXVA 4OGQC 1H3UA 3BQUB 2XTSA 3AXIA 4OD1L 3V7AG 4N0CC 2MNJB 2FAUA 2FO4B 5GPRA 1QG3A 4U7SA 2DQ6A 2E6QA 1XD1A 5DYFA 2CBMA 2H45A 1RIUL 1C5CH 4OJCA 3FULA 3FN9A 3CVHA 5F21B 4S1RH 4X7SH 2BO0A 2UWEB 3MLVL 4Y5VC 1O9VA 3KCPB 4QDGA 3F04A 1BHGA 2GJ6B 4M6AA 5DZ9A 1FNGA 4S1DC 1HHJA 1ZLEA 3SDDD 3VX1A 5DHYB 3GI9H 5A2IH 1Z9SB 2OJZH 3GSRA 4UQEA 3WTUA 2R1XB 2YUXA 2GI7A 5C9KA 3EOTL 1OP9A 1LEIB 1AHMA 4ETQA 1OSPH 3G6DL 4AZUA 4GRWH 1U8LA 1CFQA 5ACLA 4RGMB 5JLZA 1HWGB 1QX1A 1RL1A 1KZQA 3BC9A 2I9LB 5L8JB 1HEJC 1HHKA 2OJEB 1RZFL 1B4JH 1MJUH 5LBSH 4AMKL 2WZPA 4CSTA 3KZ8A 3SPVB 2WBXA 3IWUA 4ZFFA 2C7FA 4BH7A 2VDKL 1JRHH 3NCWA 2BH0A 5F6HJ 1BZEA 3NQKA 4UQCA 4WO4D 3WXWH 4MA3B 1A7QH 2XZAL 3ME0B 4XCFH 4FLQA 3D39E 2ZX7A 4GW1A 2GABA 3BVUA 2L0DA 4M5YL 1LXMA 3QCVL 3UDWC 3MRKA 3M1BB 4XX1E 3SYOA 1R46A 1BJ1J 3US1A 4DZ8A 2AJYH 5E95B 1FCCA 3VYOA 2BMKB 4WNSA 1XB3A 4LVOC 4X0KB 4GQZA 4HUUB 2AJUL 4KKAD 4IDLA 3NACL 2NZ9D 4YDZA 4Y2DC 3H3PL 4HV8A 5D1XC 4PJ9D 5HHVH 4YX2L 2OK0H 3ILQC 4XOEA 4PJ8D 2DYRB 2WN3A 2XRAH 4GS7B 3KPSA 2ZUQB 4KGJA 5EWIH 2X1OA 5IF0B 1CQYA 1X7TA 4Q56A 5T3XL 1MNNA 1IGJA 4YK4B 1RK1A 1XEDA 3HEIB 3HBGA 4RMWA 4WWNA 4X98A 3EDJA 3NEOA 2D03H 2X05A 3TH2T 2YD7A 1T1XB 4F9LA 5DSCB 1FH2A 5LNEA 2V2XA 1HZHL 5B38A 1ANUA 3RWDA 4KITB 1NCDL 2J1ZA 3MUUA 1F1DA 4JFFB 2CMRL 3P30H 4QXUH 3GZKA 1GGBL 4GKNB 1N0XH 1YPZE 3GSXA 4L8SC 1GR7A 3OZLA 4WI7A 5B22A 2PO6A 1N26A 2VIRB 4NZTL 4YUEL 4AUJA 2CJUL 4F8QA 3MO1A 2J6WA 2X1XR 3QNZA 3DETC 2WJ7A 3FUNA 1JNLL 4WKXA 1AFVL 5F9WC 3RL2B 5EU6A 2F6AA 4FZEH 1IZJA 4Y19A 3Q6FA 1DYZA 2AANA 4HWUA 3RKDD 3RVVC 1NCWH 3GSQB 4WDIA 1PL3A 3L3OA 5IVZB 3ZYZA 4NYLB 4RNRB 3CZJA 1TZIB 3FO1B 4NI3A 1KULA 4HKJB 2AJVH 5FXCH 4JG5A 1LJMA 3FPYA 5HGDB 3OKNB 3DIDA 4PV9B 1T22B 4WHCA 4ZMPA 5HGHB 3LN4A 5IG7A 2C9SA 5IB1A 4WJ5A 1X5IA 2XWEA 3A21A 1G7JA 4ZPVA 4AQ1A 4HPYH 3D6GA 2ZKHH 2BS71 2FJFB 4ISVB 1ZIBA 5DMIH 4BFIB 4DKEH 3MJ7B 3IM1A 5CJOL 3Q06A 3QUXB 2QQKL 1W2KT 3AABA 5JO5A 1LO3H 5F6HI 4APQB 1TR7A 3QIBA 4M8RA 1ZGLB 2M26A 4AMWA 2IAMC 5J11B 5DD5L 2W65A 1MLCA 2FX7H 4U2YA 1EQWA 3WMSA 2EDHA 2VDOL 2VE6A 3EYOB 5AOLA 2LU3A 3MRRB 5FEBA 2WHVA 3E6FA 4U1GB 3GC3A 5GHWL 5ETUA 4NO5B 2EIDA 3D85A 3SKJL 5LCVA 1YRKA 4UF7C 1R3HB 3AZUA 4NRXB 4DP8X 2YAHA 2X4UA 3RWCB 5FHAL 3OQRA 5BQ7B 1TPXC 1I9EA 1MAKA 5KSVB 4MAYB 2L7JA 3VG0H 5D4JA 1I9IH 1JPEA 2MOVA 3B7UX 4DO4A 3S4SB 3QWOB 3MRHB 4U31A 1IBFA 3BN3B 2V5MA 4XR8C 5F89B 1KC5H 1W6WA 2AEPH 4GAYB 4XE5B 1XCXA 4KKQA 5LAXA 2IXQB 4AZ8A 3ATAA 2GITB 2NY2B 1WSST 4PIRF 4UZUA 3SBRA 2BP8A 3CSFA 5CCHE 2ZZUT 1ROCA 1T0NA 3O6MH 2HLAB 1I53A 3T0XA 4BHUA 1I75A 5DJ0B 2IBZY 2VDML 5DLLA 5AAPA 2GPZA 2ROXA 4N4YB 4XNXH 2PW1B 2VB5A 5FPIA 4X4ME 1GCFA 1LE5B 1T2XA 1FLTX 4GJTB 1MIMH 4LQ1A 5HHXH 5J9PA 3Q8AA 3L3HA 4OJDH 1BZ7A 1VLXA 3QG6A 5BJTB 2Z4QB 3S3SA 3D06A 2OP4L 3QDGB 4V1DD 2CHXA 3WFCH 5KBDA 2VRAA 1A4AA 1NM4A 3MNMA 3X13B 4UM9D 4XO4A 1AHWC 1CICB 3PWPE 4X8JB 3TASA 3BRGC 1DVFC 1NFDF 2D0GA 4HWEL 1DUZA 1A6WH 1ND0A 3HE6D 3MLWH 4Y5VA 1P4IL 1OSEA 4N0FB 3S2AA 1TO5A 4AGNA 3LNIA 4QTHA 3L5HA 4PRAB 1MNUL 1OARH 2EDQA 2YPLB 5DJYA 2Q8BL 1RY7B 5AUMB 2ZCKL 5GGRB 3VH8G 3N1MC 2E0PA 3QG7H 4C4KO 3DHUA 1DANU 2ZNWA 1I8KB 4FZ8L 4QKXB 2E9WA 1Y0LB 3L1GA 1LO5B 1MXDA 1Q9LB 1TT6A 1SPDA 5DCCA 3TEZA 2H3KA 1E5YA 2DM2A 4NQVA 5BZWA 4A67A 4O51A 3ALWA 2YUZA 1Q94B 2R29L 4JCMA 3UBXB 1P5VB 3GO1H 3M17A 4CMHB 4ZMZA 2IANA 4FQLL 1NLBL 5I66B 2GB2A 3QXAB 3EGXB 1S9XA 3LZPA 3VJ6A 1HYSC 4AYDC 1H6FA 2FO8A 3UDWA 4QJ4B 2EEFA 3NESA 1BD2A 1JL8A 2EYRB 3ULVE 4NNYB 3GBNL 4F7CB 1XTLA 4N26A 4P8QA 2E8YA 1P4UA 3F62A 3WNNA 2ZF9A 5LGHH 4OTXH 5I26A 4EN3C 2XHNA 1FL3A 4Y2DA 5AAWC 5A2KH 1PYWB 1RZIA 2X9YA 4CVWA 3EJQA 3QAZC 1JCKA 3FUFA 1KJVB 2VH5L 1DUYB 4J8RB 4Q97A 4P99A 4HIIA 3DOHA 1YN6A 3NSCA 5C0IA 1RZJH 1GSKA 3ESOA 3TT1H 3VWJD 4F93B 4PJ7E 1MRCH 5AAMA 5KSAB 2FJUB 4NP9A 4W9GC 3CFCL 3N6YA 5F3HA 2NW3B 1HKLH 1PSKH 3R0MA 4MCNA 5ADPL 1KZYA 3ZYIA 4R9HA 3CFEB 1FFPA 1INQB 1OCRB 3AROA 3PWVB 3AGWA 5DZOA 1QTPA 2A9DA 3LKQA 4A68A 5B1KA 3LPGA 4KUCD 2EH7L 2QPUA 3GNMH 3VXUA 2WSKA 3T4YA 3IJYA 4RWHA 5E03A 4OZFA 4TS6A 5GRJH 4LOVA 1HCZA 4HDIA 1FH5H 3UBGA 3HI5L 2C1PA 2YGVA 2P8MB 1VAHA 3SD2A 3HKZA 2WWNA 1KCUL 2WYHA 3HNVH 3QK0A 5KUKA 5EN2B 2DOCA 4KK8D 4QPEA 3KS0J 1I7TA 2VLJA 3STBA 3MC0A 4GXUN 1I8LC 4MJ4A 5GIRA 3ULVD 4BBWA 2Y2WA 2VM4A 4IJTA 2AXJA 5E4OA 3RDTD 1CTNA 5B8CB 4PJGA 4R2GC 2GK0B 5AOKA 2BJMH 1PZCA 1HU8A 2BXYA 2F54E 3ARBC 2VLKE 2X88A 1ZIAA 5J56B 1U6AH 1I1YB 1MXGA 3A6CH 4XX5A 1TSRA 1U4FA 2X1WL 2WGXA 4X7TA 3QEGL 1TYRA 2IAMA 3QORA 3C60C 3US0A 4RQQB 3KAAA 5I1AB 1XCWA 4DHLA 5DHXB 1MFEL 5DFTA 3WLWD 8PAZA 2OPCA 3WUZA 3Q2WA 4K8RC 3QZMA 1TF4A 2WTRA 4Q6IB 1KY7A 4BE5A 2V2TB 1BM3L 3EYFB 4QRRA 1KOAA 5I6MA 5IESH 3B2VH 3RVTD 2B7DT 4R7NB 5IR1B 1H3GA 2Y7LA 4K3DL 5D1XB 3U4AA 3L7FB 2DQFB 4XC1L 3O3EB 3W0WB 3WE6A 2DIJA 2ARWA 2UYLA 4X9HA 3V2AR 2DDQH 7FABH 2EJ1A 1T1ZA 3V9FA 2EIJB 1PW3A 1ZAGA 4JVPA 4LLWB 4RFOL 1V54B 3TEUA 1BQHG 1AGDA 4ZFOA 2FWLB 1V7ML 5J6GA 2E86A 3QXDA 4L8SB 3MJWA 2VXUL 4TN9A 1A7BA 2Z7UA 4ONHA 2JLPA 5SWSB 3MLZH 4JFEA 3FT3B 4Q2ZA 2JXMA 1MHHA 2K7QA 2J2ZB 1MRFH 2VLKD 2VXQH 4KKBD 2VLRB 2BSTA 2QHRL 2XTJC 4PV8B 2XXFA 3DYOA 2QDWA 2ZOKB 5DEFA 1ERNA 5H37H 3CN2A 3HE7D 2Y2TA 3ASOB 5C0GB 1A6AA 1S4IA 4XCCL 5D72H 3VRIA 3L5IA 5E00B 2ADFL 2KDGA 5I30L 4ELME 1E4XI 4PWIA 4S1SH 1DVFA 4MLSA 4CJ0A 4NZJA 4MYPA 1NGYB 2X6AA 5GGSY 5IMMA 5MENA 5D2NE 1S78C 3ZZSA 2DQHL 4A38A 3LZNA 1U3HD 5ILTL 3F2LA 1D5IL 1HILB 3GSWA 3HCVB 3KPQA 4U1MB 4KY1H 3VXME 6CGTA 4MZRA 1F97A 4UZSA 1JGIA 2FSEA 3NJLA 4XP1L 3AG2B 3GRWH 1KBKA 3IRPX 1AC6A 3AQXA 5EBGA 2XN9A 1EEZA 1TQSA 4U6VH 4ODHL 3NDZE 3ARQA 1V3MA 3FQXB 3S36X 1PG7W 2NW2B 3ET9F 4LL9A 1KGUA 5C97A 2FECL 2P8LA 3L8QA 4JFOB 4JQIL 1M2VB 1OTUD 4UM8A 4A04A 3O4LB 2DYPA 3KYOB 4HC1H 4W9ZA 1ETA1 5C07B 1JZ2A 1D7FA 4JY4A 4OZIF 4N1HB 3C5SB 1A7OL 4HEPA 2UVFA 3I3BA 5BZDA 4P04A 1T6WA 4U3HA 2XTLA 4FFVD 5DUMH 1KXTB 1CL7H 1T7VA 4YN3A 3VQ2C 5DHDA 1F42A 5E94B 2BNQB 1NWPA 4DEPB 5EO0B 4BDVA 2ZX5A 3V0DA 4L2LA 5D6CA 1BXUA 4MMYA 4QTIH 3CV5A 3LVEA 1FGNH 2GY5A 4X8GA 3VD5A 3JWDL 4BGLA 3V8CA 4XCNA 2DQDL 5CKAA 2HT4C 4WWKB 1WHOA 3DECA 1FJ1B 3C6EA 3GXPA 2EO9A 2O6FA 4EN3A 3KPRA 3NJIA 5AAWA 3VFMA 1YEFH 3SQBB 4AGLA 3D12B 4LCUB 4DUWA 3IRZA 1R0AL 5AWNH 2VXVL 1XCQB 4OKVB 4XMLL 4OCYH 5CGTA 4M1CC 3CIAA 3WO4C 5AVTB 3TU6A 3NEXA 2Q7YB 2XWTB 3GLZA 1XR8B 1ITBB 3VXMD 3O2DL 3ZTCC 5AENA 1JZDC 1TEGA 2ZF8A 3HNSL 2I60L 3F3HA 4Z5RB 5FO7B 1MJJA 2ZOWA 2FECI 1AGBB 5AZEL 3HJEA 4RDQG 3MGTB 2FEJA 3PAZA 5E0QA 4ZFZB 3VGFA 4Y1AE 4JPVL 1I3RB 1T1YB 2FLMA 2NY1D 3PP3K 5E8EB 3T2NL 5CEZH 5HI3C 2CBOA 2HJKB 2DIBA 3EGSB 4HKZB 4FI6A 9CGTA 4F91B 3CAFA 4W9FC 3CMOL 4MLIA 1IGIL 1I8IB 5FO2A 3SB3A 1SMAA 2QSTA 3RWFB 2MCAA 4G8IA 1J88A 4G59C 4ZDHB 3TV8A 5IP4A 3GMMA 4ZSOB 3ULUD 4UQ2B 2ZNXA 5CLXA 4K7FB 2XKNA 5E5MB 4NCC2 2ZX6A 2NTFA 2QR0A 1OWRM 3V5KA 4N2DA 1AMYA 4IOSD 1PCXA 4UB0H 4ODTH 4H44C 1RK7A 4J1UA 2IQAA 2XFGB 2N1TE 1IT9H 1I8LA 3C08H 3V0AC 2EUWA 4J7RA 3D2TA 1C08B 2W9DH 5MP6L 3I50H 2Z1KA 3TVMA 1UQSB 3SDAC 1L6ZA 2ORBL 3QJOA 4BUHA 4XNZB 3E0GA 3UOAB 4GRMA 3LH2H 5DD6B 1ZLVH 4E9WA 5ICZA 1JFQL 3N44F 3ARBA 1CU4L 1A0QL 1IX2A 4D9QE 4AJ0A 3T6QC 1T3FB 1KDIA 1FYTB 1SF5A 3DMMC 3MN8A 4KO6A 4MS8D 4PVLA 2XXCB 1V27A 4PREB 3C60A 4K7PH 4GFTB 4AYFA 4XP5H 5JHLH 4NXKA 1AQ8A 4BQ8A 2EADA 1OB1A 4I18C 3ZTNH 4HUVB 3W81A 2J6EA 4OCRH 1BZ9A 5EMYA 5EBMB 2R8SL 5F0PB 5AYTA 4Y1AD 2DQJL 2LOEA 2P26A 4OV5B 1QLEB 2BVEA 2A74C 4HEMA 4ZQTA 5FK9B 3CSYA 2JIXB 2ZKMX 5ES4B 4Z7UA 1RIUH 3Q7JA 1TSHA 3F8UB 4HSCX 3QAZB 4G6KL 2R56L 3IMSA 1CD9B 3MLVH 1QRNE 4GI6A 1EJOL 1KLFA 2F9BT 2MTAA 3RGVB 2BRRH 2X4SB 1FWXA 5ICYA 4MDIA 1A66A 1QOKA 5ISZB 3BT2H 4M7ZC 5TGBA 1MY7A 2E6JA 3JBG7 4K71B 3IJHB 3VH8B 3EOTH 1WZAA 2NNXA 2J12B 4OZ4A 1QSED 3PREA 3G6DH 5CZVL 2O5XL 5EFIA 2VL4A 2PPFA 3PDDA 1ZGLP 1ZSDA 1ZVSB 3WY1A 4ABVA 4FQJL 5T3ZE 3ZMEA 3BAXA 5DJ8B 1AD9A 5DQJB 1MWOA 1YYCA 1RZFH 4D9QD 3KXFB 1DJZA 4AMKH 3BGMB 3FU7B 3RUGA 1K4CB 2BLFA 2AVFA 1YECL 3BSZH 4G8GE 1LLAA 1EGJA 4L3CB 4R4NC 3CFBA 1KIQA 4PJ5B 1BWMA 2XZAH 4PJGF 4GRLB 3O2WL 5F2FA 2IV8A 2V9TA 3SO3B 5I73B 1BLIA 2CJTA 4M5YH 3D4GA 3EBAA 4DGIL 5J06A 4PGDB 2X70A 4M3JA 2LABA 3QCVH 4DEWA 1SXBA 3AAZA 4GW5A 3V6ZA 1JE6A 4G42B 3VDAA 5FWQA 3LEYH 5F88A 2AJUH 3NACH 1HHGA 3G5VB 3Q3GA 5IMOA 4Q0XL 4ZUUA 3SPCA 3QEQA 5BW7A 5KJ7E 3KHQA 1KTJA 1B0GA 4ZUSB 1Q9WA 5B3SB 1NOLA 4F92B 1QRND 2COQA 2EXSA 2WQ8A 3OAZH 3U2SA 4GQ9L 3LXAA 1CFTA 4GBXD 5E7BA 2GBAA 1ESOA 1GC1H 5LB1A 2UWEE 5EOCL 3OMNB 1NCDH 2GJ6E 3ILPB 4WEBH 4BWWA 1PZ3A 2VW6A 3DO7A 3D3VA 1ED3A 4MXQD 4XWGL 3HC2A 4MD0B 4ZW3A 1GMIA 3IT8D 1XAUA 4J3TA 4JHBA 4YUEH 4X5RA 5EN3A 3REWA 2CJUH 2VN5A 1ODAA 1IQWL 3QULB 1JNLH 4J6IA 1AFVH 1M3JA 3G5WA 4NENA 1G7IB 1SJMA 3RIFF 1H8NA 2HVKA 4G8GD 4YSUA 4Y4HD 4YHOH 2V7HA 3FUKA 3VXQA 4HPOL 1IO4C 3L3KA 4YDKL 2WZ5A 4J2QA 4BFEA 4F1SA 3H3BC 2QL1A 4AQAA 4AIEA 4BUQA 2NYZA 3D69A 3W82A 3CTTA 5GGUB 4FA7B 4H8WC 2DEWX 1EIBA 2WQAA 4AEFA 2FIKA 2WM0A 1M7DA 3MACL 3MLXL 1A1OA 1W72B 2ITFA 4L5FE 2Z31C 4WU7A 5CJOH 3WNPA 5LAPA 2QQKH 5SWQB 5C0JB 4ZW8A 3E6HA 3HKFA 4OQTL 1JK9A 4R26L 3PL6C 1JGEB 4DOHB 3ZE2F 1XMEB 1HESA 1G5AA 1KBWA 1BQ5A 2H1PL 3TA3C 3UG5A 1CO1A 3QJFA 2HCZX 4PRDB 4GG6F 2VDOH 3M8OL 3RFZC 1AP2A 5EO1A 2GJ6D 3DTXB 4GW4A 1XO8A 2J57A 5IREA 2XN0A 1CXKA 4W9EC 3SKJH 3DBSA 5F1KC 3NSDA 3APDA 3PHQB 3V0GA 4Z7WB 2GBTA 3C8KA 1WCBA 4OCSH 1YN7B 4PW3A 1R5WA 5A3IC 4JFFE 5FHAH 3VQLA 3MV8D 3B2XA 2FVNA 4XMKL 1UZ6F 2W0KA 3FB5A 3L9EA 1ZPLA 3TTYA 4CC1A 2ENQA 4I87A 3BH8B 1FBIL 4X9IA 2BWQA 4JO3L 3EBGA 4YEFA 3BP4A 5TFSH 3SDAA 1JF1B 4A6YL 1KEGL 4EUPG 3JV6A 1BQHB 1OAJA 4UQDA 4PGBB 3DX0A 3KM2A 2ERJC 2NX5A 5CN1A 1QI3A 1R9FA 2E9BA 3G04B 2G5BB 1BFOB 4LKXA 1H3PL 2VDMH 3JVFC 3RY6C 4GUOA 3CK0L 2EXWD 2ZCLL 3EJCA 3P4LA 4I18A 1FL5B 4G1MB 4IOIA 4P9HL 3GSUA 3ZSSA 5IMLA 1J0IA 5DI8A 3HZKB 1RMFL 5GGVY 2NOYA 3ABGA 3NFPA 1L9PA 3B3BA 3QUYB 2MSPA 3H9YA 3OAYH 2A74A 2ZSVB 2FEDC 1U2YA 2O30A 2OP4H 2R23B 4H0LC 4YHIB 4Z7OB 1NEZA 1OAUL 4GOSA 3WU1A 4BELD 4PRID 5DR5L 3MBEC 3BEVB 2BZCA 1P4IH 4LVEA 4OAWA 1YQVL 4F20A 3ZZ1A 4NOFA 1VERA 3N91A 2AK1L 2AQ2A 1MNUH 2X6MA 2A9NL 2Q2EB 2WAHA 1JI2A 1HHHB 2WINA 3FFCD 4E42B 3WL9B 1HTYA 3LKPB 3L6FA 2X3AA 1Z7JA 3RIKA 1E9OB 3MNZB 2HT2D 4NUQA 3OB0H 1G7HA 2OXGA 2DJUA 4HGMA 4N0YL 4FKEA 1YZZA 3F7PC 5HDOA 4TQIA 4Z7VA 3MJ8B 3MRLB 4IBWA 2OTPA 3K7UA 1KPRB 2BP0A 4ODSH 4EVNA 2R0KL 3LNGA 3SKMA 2MCMA 3ZT5A 1E6OL 2L8AA 2ZPKL 2J7LA 4H8HA 3ULVL 2GSIA 3U6XA 5DD3L 1QBML 2R29H 2P44B 1IGML 2LVEA 1NLBH 5D7IA 1WV7T 1T2QH 4WQOA 1YEDA 3MA7A 4PGEA 1WA0X 5F7WC 1ZA3A 5IK3B 4YHYB 2FL5B 5AVRB 5AG9A 2NNCA 2ZTBA 2ITDB 3F6JA 3PV6A 4XGZA 3VFSA 2YKKA 3Q8FA 4GO6B 2ZXDA 4U33A 3QUXD 4L0PB 1ACXA 2RCSL 2W0LA 1KY6A 1D6EB 5CMAA 3FYIB 5HI5D 4PBDA 4DQAA 3LQAC 4AVKA 2XPGB 4BXSV 3REVA 4POUB 1IILE 2HT3C 4L8DB 2XV6B 1G7LB 2HTLD 3DMMB 3QDGE 1KYAA 2VH5H 1DSWA 3QFJD 3C5ZB 2W9LA 3H9SD 3O2VH 5SWZB 3SCMC 2DWSA 2GTWA 2H26A 3DGCR 1L9QA 4IK6A 1SXCA 5C0FB 2Z35A 3SYQA 3MUGA 3ECWA 1U3ZA 1COBA 4JO2L 2WO2B 3TIDA 2IH1B 5CP3H 2YPLE 3H1ZA 1I7UB 2NNFA 3Q5OA 5F1SA 2CIKA 5ADPH 3CH1A 5CGYC 5CEXB 4PQXA 4I88A 1OLZA 4Z3GA 1JPFB 2YEQA 1J9CT 4S2SB 3I9AA 2C7UB 2O6PA 2PWHA 1Z9OA 2XG4A 4EEEA 5CN3A 4XZUA 5E9DD 1NAKL 2JKJA 1VFOA 4W6XB 4OIIH 5EC2A 3CVBA 4YIQA 1JG9A 4XMTA 1HJCA 5F0LB 1BQLL 1B6DA 3QUMB 4NO0B 4JFDB 4ZOEA 4NWTH 3ZOAA 1ASPA 2OV0A 2DWDA 3B3IB 1KCUH 3LKSA 3FQTA 1KB9J 2K45A 3QZWG 4Q14A 5DJCA 1RJLB 2EZ0D 2X9ZA 3ARGD 1LDPL 1PKQA 2FD6H 2Y72A 4YAQB 3DYMA 4MMZA 4X6EB 5K9OA 2NXYD 1S7WB 1N12A 4KDTC 2Z31A 2A6JB 1T7XA 4ZNEA 1EK3A 4A7UA 3P73B 5JPMB 1CDCA 2AFNA 1HEZB 2W0PA 3NSXA 1P4BH 1WIOA 1RPUA 15C8L 4NPYA 4FXGB 3CXHJ 1MFEH 5FB8A 4Z78A 1QEWA 3VW3L 2GT9B 2G5UA 4ZOBA 4NNXB 3ARVA 3TS8A 2O5ZL 3FCSB 1WH0A 3TT3L 3WFEH 2GBVA 4L3ED 1BM3H 4FQHA 1G7QA 4LCCC 1CB4A 1KGWA 1E4XH 1CGTA 2XWRA 4LASH 5CJ5A 3KS0H 1WLHA 2ZXGA 1F1GA 5C70A 4NC0B 2BCMA 4F57H 1GGTA 4M48L 2BC4B 4K3DH 4CBZA 3B2UC 4L3AA 1WS7A 3UAJD 5JW4R 4XC1H 3A5VA 1SN2A 1ZJBA 1JZ5A 1K85A 2K4WA 1W8NA 3EYUL 4MVBD 1KXVA 1CE1H 3K1DA 1PLCA 3F85A 3APFA 3D30A 3GS0A 4LCIL 2BY3A 4MZ3A 2Z92B 2DJSA 3V0WH 4ZX3A 2YQ3A 4R3SB 4MB3A 1HOCA 4W4NA 3TFKD 1KWKA 1E28A 4ZUVB 3DX9A 4LLAA 4RFOH 3QXVA 1BAWA 5JHDA 2IADB 3QW9A 4EO5A 5MEQB 2IWGA 3NJKA 4CVXA 5DUPL 3DV6B 1ORQB 5B3NA 4Z76B 1SJEA 4GKSB 3SQOL 5B38G 3K8MA 1NH6A 2NY6C 3N1QC 4ZS6C 3RYMA 2W07A 4PWGA 4ZFQA 1UZ8A 3R0NA 4KFZC 1EJFA 1VA9A 5F7DA 3Q8CA 3WIHA 5DHVB 3UCRA 4AYID 4YL9A 4J3XA 1VPOL 5F1IA 2DWEA 1SOQA 4N25A 4CSPA 5GXBB 5EA0L 2BY1A 1WICA 3AS3A 3LPFA 5IVOA 2GG1A 3ARPA 4JANB 3QE5A 4XCCH 3ZDYB 4EZJA 1DQKA 3SDYL 5D7HA 5I30H 1PS3A 1XGZA 4OIFA 3ZKMC 3GMOA 4F8TA 1YMHA 3MLTB 2NY3C 3VGAC 5HBBA 3P4MA 5KSAD 2WNWA 3ULAB 3MBEA 4I1PA 5DRWB 1H3XA 2M83A 5ILTH 1KELL 3QZNA 4DKFH 3WSQL 3VD7A 3WDHA 5DMYA 5IW3A 3H2PA 5HI4C 4XP1H 2LLNA 1XL4A 1CD1B 3FZUC 2CDGB 4F7EB 3V7AE 1F45A 4KH9A 4Y4KA 2ATKA 3PL6B 4ODHH 5KYXA 5D7KE 1T21A 1DLHA 1P9MC 2W9EH 4FDWA 5IB5A 3ULUL 5D1XE 3TCLB 4JQIH 3HMXL 3W0WE 4LKCB 2PTUA 2XU9A 1JZHA 3TA3B 4ZD3L 1IVLA 3DUSA 4U1IA 5DFWH 4PP1D 2VDNL 3RFZB 2AV7B 5EUOB 1A7OH 3RY5A 3TJEL 1A1MB 3L95A 3TZVA 3WMQA 3QS2A 2O6EA 1KLGA 2IDQA 2JNZA 1J0YA 2BINA 4G70B 2QBWA 5C92A 2Q7NA 4HCRH 3ZKQD 4RGND 4X5WB 2JCWA 4D8PB 2WC7A 4N6RB 1QZ1A 1UXWA 4XXCC 2VN3A 1RH8A 5SWSE 2C1OA 3VFNA 3BHBA 3JWDH 2ZXBA 3IETA 4W9CC 2VAAB 2DQDH 5AKVA 1TITA 2GSGA 2VLRE 3ATDA 2YJQA 2Y3NA 2CLZB 2PPAA 3H54A 5GGVL 2K70A 3WHE0 2JLLA 2WLLB 4K3GA 3U36A 2Y7QB 2MJWA 1DJGA 4TUJB 2I27N 1TZGL 4H26B 4NGHL 3FRUA 2VXVH 4X4XA 4XMLH 2HKFL 1W8EA 2NSQA 2WQWA 5TDOB 4X42A 1EMTL 4ZUWA 3LNHA 3L3JA 3SCMA 2VLLB 1KMGA 1U8MA 3V0VA 3O2DH 4LSUL 2R2BB 1UB5B 1AO7A 2I60H 3H2WA 4PJHA 2AERT 2OW6A 2VO5A 3NJVA 2F0CA 3RVWD 3NP4A 1FZKA 5I76B 2CKBB 3II2A 3MBWB 4JPVH 3P3TA 2YD5A 1P1ZA 1DQVA 4WFFE 5F7KC 1KT2B 5JW3L 4QRPA 5CZKA 3CMOH 1GHFH 4U6YA 1D5XA 4OGAC 2CH8A 3HHSA 3O4LE 5C0CA 1QUNA 3HN8A 5C07E 4GAJL 2BNRB 2HYMA 2V9UA 4BKSC 2G9HB 2XVLA 1FO0L 5EEUA 3IYLW 2Z7YA 4Z7VF 1TUPA 2N56A 5SWSD 3S96A 2BRQA 2BNQE 3QQ9D 5F8RC 5IQ9A 3MUHL 4K5PA 1UXMA 1J7VR 3SGJC 2KPWA 4AW4A 2WUCH 3BDXA 1JNHA 3JWOC 4NERA 4XMUA 5MP6H 3SGDI 2HFFB 2ORBH 3K72A 1IFGA 4KDTA 4ES8A 5D7IF 1IGTB 1JFQH 1JBJA 1CU4H 3MYJA 4NQCB 4EUPB 3IVKA 4NM4L 1EEYA 2P80A 2QV4A 4LEXH 4JRWA 3QZBA 5D7LA 5G4NA 2NUPB 2Y7NA 3ILEA 4Q4EA 3N50A 5EBWB 5I0ZA 2AGJL 2P49B 3DHMA 3Q6GL 2VO8A 4QRUB 5BQDA 1OE1A 3VE0B 3TWCL 2R8SH 2BSSB 4LCCA 2BZ7A 2NY4C 5PAZA 1V3KA 3OR6B 1N5AA 2A83A 1WBZA 3QCUL 3RBSA 4BFRA 5KW9H 4X5QA 3VXTB 1J8HD 3ARRA 4HIEA 1NCOA 5D9SB 4PJBA 4AIXA 1XGYL 2E9GA 3WIFB 1AQMA 1E7UA 3HAEA 5JXAH 1I7ZB 2HN7B 2PETA 1A9BA 4W68A 4ICXA 4B9PA 3THML 2X6UA 2P5ED 3QNYB 5I5IA 1RP9A 3QPXL 3BI9X 3MV7B 4XH2A 3L3DA 1EJOH 3X14B 4NQXA 1ZLVK 2F58H 2HTKD 3F58L 1ZEAL 3RL1B 4ZSOE 3TGXA 4K55A 4D9LL 4JRYA 1H3WM 2BNQD 3PHAA 4R7XA 4GEIA 1VFBA 4J3OD 4Q9BA 2MKWA 3WHXB 4HXAL 4TVPD 5CZVH 2JB5L 2YXVA 4U3SB 5HDRA 4AMXA 3DXAB 3D48R 4JN2B 3SDXA 4FQJH 2VR7A 3D0LA 3SBQA 1RCYA 3ZDYF 1CDBA 4N2EA 4PJCA 4XXDB 4UDUB 4FL4C 2NY0D 4JJHA 4GRWB 4X83A 3UJTL 3KWWB 3ZYJA 3GXIA 2P8PA 1YECH 2J5LB 3HG1B 4W4OA 3QA3B 3S35X 4NBZB 2ZWYA 4JAMA 5IUSA 5L4JA 1F3JB 1WWWX 1QVOA 1KJ2A 1O6VA 3O3DA 5IVXA 4WNQB 1FYTE 3IMRA 3O2WH 1ES0B 32C2A 4NKMB 3BOVA 2KT6A 3QJQB 4IW4C 5H37G 4DGIH 1E3FA 1WD9A 2LFEA 2OMVB 3QFDA 3RFRA 5IB4B 2X4OA 3O0LA 2R2CA 1SDAB 2XSKA 4Y9BA 4HUXB 3MOAL 2WUBL 1Q0XL 2WMPA 4L9LA 4MRBA 3RI5F 1JXGA 2IIJA 3NIDB 4E9VA 1DLFH 3MREB 4Q0XH 1CYXA 2NSMA 5EUOF 4KNQA 2E75C 4YSAA 5BZZA 5FKAB 4IM8A 1GSMA 4DERA 4ODWB 5I1DA 1RUPL 1P9MA 3MX0A 1WFIA 4P2QB 4Y5YC 1RI8A 3FJTA 1XZ0A 5DJZA 5K59F 3QUZB 1RUML 1T1WB 1RZKL 2QKIB 5C0BB 4I0PD 3LNFA 1ZT7B 1X5LA 5EOCH 1JPST 3EDEA 1S8DB 5DO8A 1MQ8A 2ZG1A 4H2AA 1A6UL 3GMPA 3GLAA 4XWGH 3I74A 5ISZE 1TTBA 1RPKA 5DS8A 5D7SH 4DK3A 4PFEA 3UERA 3FUDA 3KL3A 3HAEH 3FTYA 5ESAA 2Q87A 4YHLH 2ZUTA 4GEJA 1CR9L 1BJ8A 1TCRA 1T0MA 3N1PC 2CDEA 3PWJA 4LO9A 3RTQA 3UTTA 4DP6X 4QAWA 4G80B 4QOKB 1X9LA 2X28A 5T5FL 2A9AA 2R59A 1NMAL 3F64A 5HHOA 3VXNB 5IQ7L 4KJPC 4JKLA 3KXFE 5F0JB 3DX7A 2YEVB 2ZXWB 4LEOA 1FYTD 1R17A 4HPOH 4NN7C 1DVZA 3U46B 3FQUB 3DPBA 1SM3L 4JREC 3I02A 4YDKH 3FN0H 3LS4L 5DVPA 1S7VB 3OWRA 4PJ5E 1ZVYA 3OPZL 2WW8A 5ECGA 3OAZK 1PZUB 4XMWA 3QZWB 4AJYV 2HAZA 3GSRB 2CUAA 3BVVA 1C16B 4HJGA 4LCYA 4YHNA 4PI2A 2IWEA 1Q1PA 2W94A 3B7RL 3V6FB 1THAA 1T03L 3NJMA 2VN7A 3JXAA 4JKWA 1CFQB 4M62L 1IZKA 4FEIA 3LN5A 1IAIM 4XB7A 3SODB 3FO2B 2WQVA 4RA0C 4XO9A 2JIXD 4R26H 3LZQA 3P02A 1KJ2H 1A9EA 4JDVB 1I4FA 1HH6A 2H1PH 2BZDA 2XQYA 4M3HA 3BMVA 2DM3A 3TPKA 4ZFFB 3O3BA 4LPCA 2HLFC 2V5YA 1BPVA 1A7RH 2FGWL 2DI8A 4JPIA 1CFVL 3WLBA 4NO3A 4XP4L 2E46A 1ET5A 3RGVD 1BFTA 2BFVH 2CRIA 3R06B 4X4YA 2CA3A 1OW0C 5FKPB 1LO2L 4L1TA 3GSNA 5TDNA 4KQ0A 4YBLB 3WTYA 3MRKB 3ZLQC 1BV8A 2VYRE 3D25A 3ZTJG 2ITCB 7TAAA 1MF2L 4KK5C 2WIIA 1FBIH 2L7EA 1Y18B 3CZFB 1MCLA 1XVSA 3QDJB 1THCA 4KJYB 1NCBL 3FB6B 3Q43A 4A6YH 5JPNA 1KEGH 4FNLL 1MN4A 4Z7AA 3CLEL 5A6MA 2E9IA 4EIBA 3ZE1F 4X98B 1JVKA 4GRLD 5KVGH 2G3XA 1G7PA 5AFAA 1M1XB 3HUJA 4BZ1A 2XNAB 3HPLB 3U30B 5BVPH 4DNLA 2BSRA 3TYGL 5B38B 3GF8A 3P2BA 1DL7L 4A37A 5D1ZC 4KGLA 3CK0H 4FJ6A 3EYSL 3PJSB 4AH2A 4P9HH 4OW6A 1RMFH 3CSPA 3FUIA 2SODB 1A1NA 1S7RB 4ORGA 2OXHA 4U49A 3AREC 3QNZB 1XZWA 4Q6YA 3V0EA 4ORZC 1JWMA 2HXAA 3VM5A 4HIXL 4ZPTA 5CEYA 4DOHE 1N19A 4DO6A 4U1LB 2OI9C 1FNEB 1EAPA 1OAUH 3L3OB 4F2MA 1DO6A 1UASA 4X7CC 1AG0A 4PJHF 35C8L 2R69A 5K5YA 3VUAA 4AEEA 5BS0B 1EDHA 2NR6C 3I85A 3LPWA 1BGXL 2YGNA 2AK1H 4OD2B 4FXKA 5IG7B 2A9NH 5L2KD 1EBPA 4WJ5B 4ZPVB 2KZBA 2A6DA 2CO7B 4Z7WE 5D93B 3OPUA 3CZLA 4OUUA 5KYWA 3RNQA 5L0QC 5HYFA 4H2CA 5GZND 4O02B 4N0YH 5LGKA 1IBBA 1CYWA 4HA1A 5F72S 5I8KL 1H0DA 3ROOA 7PCYA 2Z4TA 6TAAA 1TQBC 2R0KH 3SJVD 4JZNA 4Y8AA 2BW4A 2ZPKH 4Q7DA 4JRXA 3OAYK 2VE6B 1Q1JL 5IQLA 4IHOA 3FFDB 3T1FB 1QBMH 2YUVA 1HCFX 1WT5C 4FNUA 4N20A 3FF8A 4HJTA 4N2OA 1DFXA 5E08H 5J13B 1CFNB 1DP0A 2GIXA 4GO9A 4LT7A 5AL0A 1T89C 1HZLA 1B2YA 2X4UB 3L4UA 1G1KA 3W3BA 1VACA 5HD8D 3J27A 3KVDD 4XP6L 4KMQA 2ED8A 4NQDA 3N41B 3RJOA 1AKJA 5CJ8A 3QQ3B 1WHPA 5F7UA 1F6FB 2WV3A 2KHAA 4RISL 3OB0K 1TTAA 4FJZA 4DPBX 3CDCA 3SDCB 4AZ8B 1UB6B 4Z7OE 4OZGB 2XX0A 3CMGA 4K3EH 5MERA 2CO2A 3G5XB 1QBLL 3P3SA 4C55A 4S10A 3RZCD 1M6OB 4NX0A 1CLCA 4FQCL 5I6PA 4ERSL 3C6LC 4JO2H 5BVJA 3FCGA 2JB6B 4I4WA 2HSIA 3WKML 1L9NA 4L2YA 4NRZA 5EDSA 5J1TC 3KGUA 1L7TL 3TBBA 1S5IL 1JK8B 1U3JA 3NH7L 4NNPL 5CR8A 5INCB 3OX8B 1N2RA 4C56D 1AKPA 3S36L 1GZPA 4FYQA 1FI8C 1IAKA 1XGTB 4TRPH 3T4AC 1QSFD 2B0SL 1BBJB 1KTDB 4JPWL 1FDLL 5A40E 1FFRA 3SDXF 2ZUSA 4LRNL 1ND0B 1NIAA 5IT2L 4G5ZH 4B9IA 4PJCF 3PGCB 4RRPA 4XVUD 3OKDA 2GUOA 2XC8A 2Z91B 3BP5B 2LU4A 3Q01A 2VZVA 3WDIA 4PUBL 4CNIB 3G5ZB 5LWYL 3TF4A 1OZUA 2E27L 1IGYB 2ENSA 1LEGA 5E1HB 3VWKD 1FORH 5IVXF 1S7TB 4ZW6A 3SY0A 1JZEA 3OVUB 3L1EA 3K2IA 3PP4L 4P4KA 5E99H 1BVOA 5DVOA 4U6XB 4UNTA 1KEML 5DJ2B 4UOW1 3H53A 1AR1C 3KR3H 1AGEB 5F7YC 4LHUD 2NSXA 3ZDZF 4UAOB 1VEPA 5I0XA 3VW3H 1S9YA 2XCMC 3WTWA 4PR5B 5SWZE 4ONOA 3M17B 1NMCB 3VSVA 4GINA 3DX8A 2G4EA 1OW0A 1AZCA 3NOIA 4NC2B 5HVHC 1AD0A 4CMMB 4KQ4H 4IGBD 2X89D 3SE3C 4K94L 4QO1B 4PJAA 2CRMA 5FS5A 4RMRA 3SE9L 3WEBA 1TJGL 3JZYA 5BOJA 3BAEL 4KRPB 5CLZA 4PS4L 1F5WA 3JT0A 3EYUH 3EOBA 3FOLA 2DBLH 2AXFB 4LCIH 4YC2B 2JSFA 2EDKA 3LB6D 3VFRA 2ADIB 4YSCA 3E8UL 3EF7A 4FE9A 4TSAL 1HIML 1N5YH 2XWXA 1JZ4A 3ELAT 4UT6A 2AJXL 2X4NA 5DUPH 1TXKA 2QLVB 4JFDE 4XCYA 4XHJD 3VRLF 2PNDA 4UTAA 1F4AA 3E38A 1ZT1B 2BIHA 2Y07L 3B4NA 4B60A 4Z95L 2BHYA 4BQ9A 1U8HA 5F3HB 5D1ZA 3EFDL 4NQEE 3S34L 1CT8B 2IO5A 2ZWNA 3W37A 5CU5A 1AVAA 5E6IC 3GXMA 1T80A 2WLHA 3NFNA 3C6SB 5I6NA 2GI0A 1FFPB 2JKIS 1AS8A 4OSUH 5HVGB 4ENZA 3LKQB 1E3XA 3BPOB 1M57B 4OIAA 1NKGA 4XN2A 2ICCA 2HX7A 1I1AA 4WJKB 4JREB 4WUUB 3T0EB 3C5ZD 3BAYA 2FBJL 3T4YB 1WZMA 3FB8A 2FEEL 2ZT9C 3IFLL 4JW3A 1LP9A 1RIHL 5CCKL 4KTEH 5HJBA 1KGJA 2WLNA 1NBVH 4G7RB 1KELH 1RZGB 3WSQH 5KN5A 5DMKB 5H4ZA 3PYCA 2DD8H 3AFLA 1I7TB 4P23A 3TNNB 2JH2A 3V5DA 3GXDA 3NIFB 1IM3D 4YBQD 2DKMA 4LCWA 2OM5A 2WVTA 4M7KL 3ULUH 4F7TB 3LKRA 3ELQA 3OKKB 4MJ6B 3HMXH 4HUNB 4BSWA 3I75A 4GXVL 4ZD3H 5FECB 4ZRGA 4GMTL 2BFGA 4HISA 5EF3A 1W0WA 1L0PA 1JAEA 3QORB 3TJEH 2PYEA 5C09A 3FTZA 2WLMA 4Y7OC 2P5WA 4JM4H 4NO0D 1H5BC 3WEOA 3N42F 4E9SA 4MDRA 2J8HA 2XWJB 1NDGA 3N40P 3LDBB 2OYMA 4JG9A 3LEVL 1KCBA 1WT5A 4NQED 5JIMA 2EDXA 1XF2B 1U41A 3NA4A 3VFTA 1UA6L 3VXSB 1B90A 3QIUB 1RIVL 1FZJA 4ICWA 1KNOA 1T89A 2WXLA 3DVGA 3CSGA 4PJEA 3ARXA 4QEGA 4XOCA 4P5RA 4PVBA 2BSED 3HUJF 3GUFA 2VC2H 1L5GA 1KN2L 4AC4A 1DZ0A 4FNTA 3KWUA 5KJRL 2FEEI 3B9KD 3BFQG 5GGVH 2LE9A 3SYPA 1UKTA 1J1XL 4HJJH 4L4VB 4ONGL 1MCWW 3DO4A 3SGDH 3AM8C 4M6OH 3TO4D 3ZDYE 4HFWA 1BIIB 3BP6B 4QGYA 1JZ6A 4XCEA 2A4ZA 4ADJA 3RE0A 3Q0HA 1EMTH 3FYEB 4FQQA 4XNQB 5C7XL 2J44A 3BW9B 3OAUL 1WF5A 1UXSA 1AOZA 3LQZB 1JZ8A 2NNRA 4JFYA 4OLUL 3C6LA 2MRYA 1UXLA 1EAOA 4KTDL 1O7SA 4MJIA 2BOLA 5I1HL 3VCLA 2MHAB 3B43A 3DV4B 1MVUA 3GFUA 3R7QA 4I3SL 2CDFB 5D4HA 3TBWB 4HS6A 2BSTB 2EC8A 5A6IA 3TTSA 3CN3A 4Q58C 5FC9A 5JW3H 2WTOA 3QQDA 3GKWL 3O6FC 1LMIA 4LARH 1PLGL 4RCAA 2QSCL 4HHGA 2PYFA 3FT4A 4MX7A 5DDHB 4TVPL 4GAJH 4LLYA 4HAGA 1Q9KA 2C4FU 5M94B 5EUOE 1EO8L 2BW5A 3O6LL 3T8XA 1FO0H 5MENB 4KTGA 1LEKB 5K9JL 1VFUA 3X12A 1BWWA 4WWPA 3UYPB 4YJZL 3BUDA 3FTGB 1H3TA 1ITCA 1AXIB 2A77H 2EECA 2WBJC 1J87A 1W80A 3EOYG 4Y16C 3ZHKA 2BVPB 5HPMB 4H0IA 1EEZB 1KYOJ 4XI5D 4EKJA 4JHZA 1XSKA 4W1TA 5C8JA 3HMWL 1EUUA 5D2LA 3LV3B 3UTSA 5IHLB 3KWVA 1JP5A 4NM4H 2DYPB 4RSYA 3UBFA 3IF1A 3RWGB 3JTSB 1SEQH 5LGJB 4JFPA 2R2EB 1UWXH 4LDEB 5DLML 4IKIA 5GJSL 2B1HL 4M8QB 1U92B 3B56A 3BEWA 4X6CA 2CAKA 2OMTB 2WP3T 3T0VA 3ES6A 1XR9B 3STZA 2BCKB 4XMXA 1RK0B 3MV11 3QCUH 1WWAX 3AT8A 4EDWL 5LN8A 3V9CA 4XCNB 5E2WL 4P2RA 4ZBJA 2N1KA 4CC4A 4FFWD 3RG1C 3T8VA 2W92A 2MPVA 5CIPA 4JFXA 5KG9A 1HSAA 1OF2A 3VI4A 1AANA 5JIQA 4I1RA 2OQJA 3OJMB 1ZEAH 3CHOA 2BNRE 4KKZA 5C2BL 3FSZA 5E56A 3HZYA 2W59A 4D9LH 4AY0A 5EU7E 2BOCA 4A7SA 5D8JL 1G6VK 1PG7H 2F53B 3JUZA 1UD4A 4HXAH 4LSTL 3HS0B 4RH4A 1E9QA 2JB5H 3BZDA 3F7YA 3IPFA 1WBYB 3B34A 2M1KA 3CBRA 3FT9A 3IE4A 1PIGA 3FCUB 4G8FB 2TRHA 3KLAA 4WRLA 1ZA6B 5E6IA 2LLGA 2OZ4L 2BVOB 3IMTA 3OWEA 3ZHFA 2Y5QA 3TF7C 5BZXA 3EYVA 3GJEA 1FGVL 3H9HB 5EPMB 1NL0L 4NQCE 5TE4L 1D5ZB 2AKRB 4G9FA 2J1YA 2P1YA 3PWUA 3ZZLA 4Y2NA 4N2FA 2P24A 3ALXA 3QJTB 2VMFA 3C5JB 1J1PL 1UJ3B 3MOAH 2WUBH 4KK6C 4NKDA 1Q0XH 4YZFF 1OAXL 2I07B 1B4TA 2YA0A 3HRZC 3QI9A 4EBQL 1FL6B 1HT6A 2OR7A 1FZMA 5EF1A 3EBHA 3D5OF 4U0QB 4BKLA 4KHXL 4L1HA 4WI8A 1NKOA 1A6ZA 2OSLB 1HE7A 4ZAKC 2ZAGA 3GLEA 3LZOA 3P9LB 5ICZB 2WWOA 1OQOA 1RUPH 2XPYA 5FUZL 3TLRA 2DY2A 3ALPA 3CFIC 5TJWK 1M71A 2A73B 2EDMA 1OT2A 2NLJA 1I7RB 1RUMH 3RWIA 3BZ5A 4FQXD 4ZMAT 1BYNA 4R4FL 1AQHA 4PJAF 3MV7E 1FFQA 3DX2A 1NC4A 2JJSC 4XN5A 2F7RA 1MOEA 5D55A 1YEEL 5DC2A 3ATFA 5FUCE 3SSGA 1A6UH 1TVBB 5ESVA 4R84A 4HMCA 1U91B 1CDIA 3QDAA 2OYKA 5T1DH 2WZ6A 5BNXD 1BZ9B 4OFKA 2XA3A 4OI7A 2HG5A 4NZRH 1SZNA 4X7FC 3OKMA 5DJDA 1CR9H 2DTSA 4XBGB 1MPAL 3V4PA 1EFQA 3DXAE 2ADGA 2FHBA 5T5FH 2GW5A 3AUVA 4FNPA 1NMAH 4NXSA 3B83A 3LSOB 1OGAD 2W0FA 4GSDL 2VN4A 3FCTA 4NQCD 1MJ8L 4Z7UB 2RFXB 3IDYB 2ZOLB 4DP4X 4OLXL 4PHZA 1MELA 4GRWE 1FFOA 1WP6A 2TAAA 5AW6B 1ET8A 2KUTA 2BVUA 3HG1E 5I18L 2OMUB 1Q0YL 5AZ2L 3LS4H 1OTSC 3GWJA 4UOJA 4ZUTA 3AM8A 5C0DA 4A1RA 3CFTA 2CR0A 2EXTA 2NRDA 3OXSB 4TLUA 2BOBB 1U58A 3ESVF 5INDA 4HXBL 3B8SA 3CXDL 1NAMA 5E6ZA 3NP3A 1A7PL 4HUKB 1OGTA 3ML8A 1T03H 2FT8A 4QHLB 5ALBL 1DDHB 2YBRB 4HMEA 1YAZA 2WNGA 5EFIB 1DQDL 2Q6WB 4KKPA 3W38A 4N5UA 1YNKH 2R2HB 3NIDE 3FO0L 1MFCL 1PZ5A 1LP9F 3ESMA 4DFHA 1EHKB 1MHEB 2DWTA 3ZMNA 3H42L 3MODL 3UL4A 3VFUB 5I24A 2J8OA 4NFCA 2DS4A 3KCWA 1OL0A 1AJ7L 2EO7A 4WHYH 4R6UA 2PXYD 1OCCB 2FGWH 3MV7D 3QJSB 3WFHA 3H4HA 4XBPB 1KDJA 1PLBA 2CPCA 3O6FA 4IRJB 4P2QE 3KMDA 2AXGB 4XP4H 4DT2A 4JNXA 3KYMA 3HB3C 3PDOA 1NGQL 2YK1L 4BQCA 3X3GL 5C0BE 2HVJB 1EAJA 3JVGC 2VDOB 5IFJA 1YEGH 3TJPA 3Q9PA 4MA1C 1KCLA 3CCHB 4WI2A 3UROR 3LRHA 4IBYA 5AKRA 5C9JB 4FEMA 2X7LB 1MF2H 3AQYA 3STLB 3W9EA 2WBJA 1T6VN 4G1EA 2IEPA 3IU4L 4YQXH 4PBVC 4W9IC 3MRMA 4Y16A 4XPHH 5KBKA 3GMRB 2AQRA 4YNYB 5KSUA 1FG9C 1NCBH 3ARFC 4QOKE 5MI0C 4J2XA 1LTXA 4F58L 1RP8A 4FNLH 1GZHC 2ZWKA 2JKNA 3JWDC 5GGTL 3CLEH 1SHXA 4D9RE 1ILUA 1H5BB 1NDMA 4PEEA 5CO1A 4PJEF 2EDFA 1GYCA 4LSRL 4OZHA 4XWOC 4NSKA 4M9OA 3TYGH 4ODVL 1DL7H 5FV2A 4UDTB 3OMZA 4PRPD 2DAVA 1ED3B 3W5NA 2W60B 4M7LT 4N2IA 4O58L 3WMPA 3EYSH 4ZMYA 5B3JF 1CGSL 3QR2A 4UTBA 5HYJB 3REWB 5FOBA 2QVTA 3BVTA 2C4FT 5T1LA 1CFSB 5D5MA 5FF6B 2VDMB 5FOJA 4GKOA 5E8DH 3VFVB 1A2YA 2EVHA 2H6UA 4HIXH 1OPOA 3GJFA 1DJYA 1A02N 4PTUB 1ADQH 2CIIA 1P7QB 3EYQC 3QUZD 3L3KB 3O11A 1KCVL 3CBJB 2E59A 4AIOA 5AL8A 4MD4A 5I75C 1VDGA 4KZDL 2APXA 4TUOA 4LFHD 3SDDC 4NAQA 5KS9B 1BGXH 3P1VA 3QDMD 3KNBA 1TU2B 5EBLB 4AGPA 3IJ7A 5AVSB 5JW4M 2R1WA 5CHNA 3N9GH 5E6YA 1E65A 5IW6A 3DJSA 3L81A 3QCTH 4RMVA 4OKDA 4LSSL 5IW1A 3OXRA 2H9GB 1RUKL 1M7DB 3ZO0A 1A1OB 4KOCA 5D7JC 4LLUB 2PR9A 3S8GB 4XPBL 3PS6A 4FTVA 2ZSWA 4K2UL 4Z3EA 5HYSG 5BPPA 3B7TA 1N67A 2JI3A 1EA9C 4Q9QH 4D9RD 3QDJE 3V52L 2Z93B 3QJFB 3DUUB 1ID5I 2HRPH 4WO4C 4IBQA 1G43A 4EN2A 3ZHDA 5E8NB 3BO8A 4XBMA 5LDUA 1Q1JH 1F56A 1HH9A 3HBPA 2ZXQA 3EJYD 4P2OA 3CU1A 4NO2B 1TENA 1Q72L 4DGUA 2EDBA 4P57A 1WFOA 1HE8A 5D2LF 4IJ3C 1JVLA 4CILA 5I71B 2MQ3A 3E2HB 2ZCHH 3HHMA 5K9KA 1WCQA 5LXVA 5HHQB 4CADA 3T2OA 4KKAC 4J4PA 1G6RA 4TUKL 3NCBB 3CFDB 1JHTA 3HRZA 4PJ9C 4TL5A 3PQYA 3TIEB 3I6LE 4PJ8C 5GJTL 3TH3T 3ZR5A 5JYMA 2DM7A 2WZPD 2UXGA 2ZCZA 2EYTA 3J2PA 2DWYA 4RISH 1MW3A 2MPAH 3MNDA 1NGZB 3RVUC 3KPNA 3VFPA 1QBLH 3C9NA 5DD0H 4MKTA 3T77A 4KXBA 3L3GB 2EDOA 3X11A 4L1SA 4ERSH 1IBDA 2HFEB 4UTBH 2YD0A 4XT1C 5BS0E 5C08B 2JJSA 4PRNA 3FUEA 3WKMH 1A3RL 4NRYB 1I1FA 3NJFA 5EU4B 4MSWA 2XA8L 1SYSA 3H7LA 4M4RB 4TNVK 3GJFH 4IOIB 2QQLL 3W9DA 2X3CA 5TD4A 4PCYA 1M42A 1QKZL 1DFBL 4NNPH 3U0TB 2IALB 5F1OB 1KSRA 2EUXA 2WWKO 3RKDC 3VXOB 1Z3GL 3AT9A 2VW7A 1IC5L 4PD4J 3KPSD 3S36H 3MRQB 5L8KB 1BEYL 2KERA 1HXYA 4P5TA 1ASOA 4G6FD 4U7MA 5IJVA 1L4IA 5L2JB 2B0SH 4KROD 3G08A 3GTVA 1K5WA 3ZRSA 3QIWA 3LKNA 4LRNH 4XXWA 1KF9B 1NGWB 1ETZA 2AK4A 4WNJA 5IT2H 4IIQC 4J12A 4GSQA 4X6DA 1DJSA 2IJ0C 4PUBH 4WUKL 1ML0A 3ARZA 5LWYH 3NYKA 3QARA 2E27H 5A43C 3V4LA 4Z7NB 3I6LD 3D34A 1CLZL 3P77A 4XHQA 4NAMA 1KXHA 5B7EA 3AWFA 5EU6D 4Y1TA 3DJTA 2A4EA 2XYCA 1CG9A 4Y19D 5J12B 4HZLB 1KEMH 4NBXB 4EXPX 2Z8WC 3GXUB 3QBTB 4BD4A 2KLTA 4YOKA 3R18A 1VKXA 3O6KH 2X4QA 2GSIB 3OQ3B 5FO9A 3AJ7A 4OZGE 2DKUA 4ALAH 3D09A 3G6JB 4NWUH 4PP2A 2RR3A 2H6OA 1D5MB 4B5EA 1G6RH 1U8CB 1E5CA 1AZBA 1JZFA 4M7LL 3EHBB 3JVGA 1FN4B 4GPVA 3WNIA 4K94H 5TH2B 3WJMA 1J5HA 1BX2B 2F5BL 3SE9H 1F4YL 1DEDA 3QUML 2O5NA 3X17A 1R5VA 4LVHC 5KSBF 3VSTA 3BAEH 1A3ZA 3QIBD 4QHUA 2WKOA 2EDLA 5HP5A 1T4KA 1O6SB 3UZQA 1CWVA 1ZK5A 2WB1A 3QDHA 1S7SA 2C3VB 2QFPA 4YSQA 1T5WB 4PRHB 4R96A 3WCYA 3E8UH 3ARFA 4JY6B 1HIMH 3K1KC 1GGIL 2A0LD 2WPGA 1GZHA 4FA8A 1G9NL 4NZDA 1KBGL 3D9AL 4EI5C 5CD5D 2AJXH 1E67A 4XMPL 2H26B 3D85D 2AJZA 1KGYE 4WK0B 3O9WB 3HPJB 3BVNA 3L1OL 2Y07H 3HNTL 4NKIL 3DI3B 4Z95H 5C3IA 5JIHA 4JM2A 1MFUA 3EFDH 3S34H 5JDSB 3WY3A 4C4KT 1BEXA 3DROA 2E5EA 1XIWB 4QF1A 2AQQA 1PU0A 1KB9K 4BYHA 1IUZA 4FNRA 4PJDB 4AV0A 1AQDA 1KLUB 4MFHA 4JDZB 5H94A 3EH2A 5KS9F 3LRSA 4YDJA 3JV4A 3VU2A 3DGGB 3PGDB 5EC1A 1IARB 2FBJH 5CBAA 4F7MA 1NCGA 3UTQB 3CFQA 3HE6C 4WGKA 3IFLH 3QO0A 1XGQA 3F12B 3MNVB 3JWNH 1RIHH 4OCXL 5CCKH 1YJDC 4N85A 1BXAA 4QT5A 2VZOA 2AP2A 2RQ8A 3CHSA 3CXHK 2VZTA 4DWHA 3MCKA 3NPZB 2QQQA 2EVGA 4LIQH 5E5UB 1VENA 4Z0BL 1PKQB 1SOSA 3QZOA 4MMZB 5B39A 3DURA 3ZBMA 3RGBA 1E6JH 1XDQA 2CHNA 4RAVA 3PAYA 2DV6A 2N7AA 5D7JA 4N0CD 3L45A 3Q2VA 5MEPA 3M45A 2Z8SA 1IFHL 1N8OE 2WXQA 1E0OB 1JV2A 2XWDA 3IDIA 4NJAH 5I16A 2ATPA 2D3JA 4OJFL 2C9AA 1XMWA 4FG0A 4A7TA 4WO4A 1EEQA 5BUAA 2A6IA 4AQOA 4GI8A 3LEXB 3EIFA 43C9B 1JUFA 1DN0A 4FMFA 1RJCA 2X40A 5ACZA 3LEVH 2IPKB 5EORL 1X5XA 3QGVA 2OA9A 1UA6H 4YDVA 5GISL 3PXJA 1L9RA 1RIVH 3NZSA 1HEHC 3U4EA 2WYTA 2ATAA 3ZHNA 5I17B 2OBGA 3ZO9A 5DJ6B 5GRXG 4WGWB 5FA4A 2AXHA 1AXSA 4MNQB 4OZHF 1ZWIB 2A9BA 1KN2H 4I85A 2GTZA 4N2HA 4P5KA 4AG4H 5KJRH 5B4MD 5HJGA 1YUKB 4P46C 4PJ8A 1R3KA 2AJ3A 4P9HC 5DMJB 4KZCA 1KACB 1J1XH 1P84J 1F6AA 3DRTA 4K73A 4LOFA 4ONGH 3WIIL 3TEYA 1HOCB 5J7CC 5I8EA 4OLYL 5IEKA 5H2BB 4WUUE 3T0EE 3VWJC 5IJKC 2E7MA 2IAND 4ATWA 4U7KA 5C7XH 3J8F7 3OAUH 1SNRA 4PG9A 2OULB 4EZLA 1FRGH 2LLLA 1PBYA 2I25N 5J6SA 3K6NA 4OLUH 4U1HA 1UM6L 3IFOA 3V0FA 1BD2D 3RX7A 3TBYB 2Y5TB 3MRNA 3QHZL 1GOHA 3EW3B 4I3SH 4KRPD 4O2EA 2H0JA 3ZQWA 4OM1L 3DJRA 2RGSA 3ESPA 3NIFE 4Y2DD 4D7BA 5IUCA 3OF6A 1ASQA 2WY3B 3BRDA 2UZYA 1PLGH 3N3EA 5EG6C 1TTFA 5AB0A 4J3OH 4UT7L 2QSCH 5DHMC 4FC3E 4Y2OA 3K91A 4TVPH 3D39A 4KAQL 5I74B 4D0CA 5I75B 2D31A 3VB9A 1EO8H 3GGWA 1IFRA 5GS3A 2AEIT 1W0YT 2YA1A 5F6IC 4N8CL 2A3TA 3P4MB 5K9JH 1TJIL 5DWUL 3O8XC 4LF3B 4QYOA 4JVWA 3ULVC 4H1LA 3DJZA 3VXSE 3QWRA 2YD9A 2NY5C 4G43A 3ZRFC 3GMNA 4YXHL 4WEMB 4Y88A 3TL5A 3CN4A 4RMBA 1VGEL 1T7WA 4BIKA 1TQWA 2DN7A 4F5CA 3DETD 5KYXB 5IB5B 3HMWH 4ZZFA 3VDBA 1YCSA 3B8YA 5KYUA 3PABA 4DQOL 3VXUD 2YIHA 3G6JF 4NC1E 4U1IB 1NSNL 3RVVD 5LN4A 4I5BA 1UOKA 2C34A 1UT9A 4L4VE 2J1KA 3GSVA 2AMGA 3TZVB 1BZQK 3AS0A 5T1KA 2DIAA 4RAHA 4HF5L 2ADJA 3A24A 1YPZA 5A7EA 2WXGA 4RRPM 2FJHB 4N2AA 2VLJD 3RVTC 5EO9B 4FULA 2EC9U 2CK0L 3D05A 3T3PB 1UXWB 4NP4L 4YPJA 1QBAA 1IEBA 3E80A 4EDWH 3ZKSD 3V5HB 4PJ9B 3PWLA 1CE6B 3H0TA 2G3MA 3FHAA 2A2QT 5E2WH 1YNTB 4DETA 1KB5L 4KKNA 4K9EC 1U8NA 1OGSA 3LPOA 3L4YA 2CU9A 5A2FA 4I89A 5KZCD 4YHML 2IAMD 5AW0B 3QORD 2XFXB 5GGRY 2YZ8A 1XF5A 5GS2D 3PNRB 2IDUA 4IEFA 5CEZE 2H41A 3FRUB 4XRCB 4Y5XA 2FO1A 4LVNB 4PGCA 2APWA 1XGPB 4AM0Q 4DP7X 4EI5A 4Y4FA 3L3JB 1LNUB 1AGCA 2YS4A 3V0VB 1CGVA 5MENE 2YAPA 4FQ1L 4QRRD 4QLRA 1P53A 1QWUA 5CZXC 1U8PA 3OLIA 4QRTB 5DMGD 1UWXK 2V37A 2O1AA 4OVVA 2R39A 4KKBC 4UV7L 1SYVB 4UQ9A 4KV5E 5FYLH 3MRIA 4N87A 3P9MA 2W38A 3KBHE 4ZTPL 4Y1SA 5HYSB 5HGBA 1JSYA 1WPCA 4TNEA 2QEJA 2QVKA 3A4FA 4UILL 1DSYA 1E40A 1EANA 4KKRA 3HE7C 3ASWA 4XB8A 4AIZA 5I6XC 8CGTA 4AWJC 1K2DB 4U6YB 2H32H 3E3QE 4BFBD 1FGVH 1D5XB 1KYFA 1NL0H 5TE4H 1XH3A 5D1QB 2NZ1A 4UM9A 4U1SA 2FT6A 1CXEA 1IEAA 3MMEB 4OQTA 3GHPA 3ESUF 4WZ9A 3HE6A 3ISWA 3F01A 3MJ9L 1C8PA 1X5AA 3FSWA 2X42A 4E9QA 1SJHB 1HQRB 3AGVA 2DMCA 1OAXH 1SVZA 4AM0A 3P4OA 4JFED 4EBQH 2E3VA 3N43F 5IQ9B 4PRBA 2HX8A 4BK4A 4WKZA 3ZL4H 3WEMA 4KHXH 5IV2A 5E4EC 7CGTA 4J5VA 3FAWA 3TN0C 4PB0L 2V7NB 3PWNA 5B3JE 3QHTC 3WYRA 1PD0A 5HYEA 5CEZD 1R34A 1CK0L 4GG8A 4GP5B 5B7MA 3GI9L 1DVFD 2OJZL 1KCSL 3SBWA 5MEND 1YEEH 5IJCC 2IBZX 1QFUH 4NKOA 4MCZB 1YO4A 2PWDA 3IMBA 2PR4H 3NQIA 2R4RL 3P0VH 4U1NA 4HGKC 5EUKA 3HBZA 2FT7A 2F53E 4X4MA 1Z5LA 2XN9D 1ACYH 1MPAH 1WBZB 1KIRB 5LBSL 5ABAA 4P05A 1H6EA 4Z3TA 4YGVB 1DO5A 2IWKA 2JV6A 3BH9A 4HIEB 4HS3A 3OTTA 4KWUA 4PJBB 4GSDH 1MJ8H 3HAEB 2QFRA 1VFAA 1X5YA 2DYPD 3PWPA 3WXWL 2FQGA 4XCFL 3CUPA 4U05A 4YR6A 4OCNC 4P46A 5GRUL 4HWBH 5I18H 5D2NC 1Q0YH 5AZ2H 2XG5A 3HFML 4FG6D 4OLZL 3V4VA 2WKGA 4TL4A 2XZCL 1OF0A 1SJXA 4LAQH 1D9KA 2V3FA 5CR1A 1ZHKA 2AJYL 1U8OA 4HXBH 3CXDH 5LUMA 3KYAA 4U6HA 1TJHL 4PIBA 4A2DA 3OZKA 3ERXA 4MNHB 3PHOB 1DQDH 2Q3ZA 2OCCB 2NY1C 2OK0L 5JQIB 1YEJL 3VFGL 1R3LB 4V1DB 4ZX4A 4IS6A 5GGSB 3H42H 5EWIL 3MODH 5I1JL 4OFQA 4J23A 2FX8L 4P9ML 3LZFL 1AJ7H 4EN3D 3KPRD 3EJJX 3T3MB 4Z3HA 1E4WL 2DL2A 1HDMA 3WOVA 4Z7QB 1MCSA 1NGQH 4Z7IA 3X3GH 4J3UA 4MTMA 3NIGF 1EH9A 1N0LB 5K39A 3BDYL 2X4RB 5DURD 4WU5A 1TZOA 3AACA 2J4WL 3UJJH 3WEXB 4CW1A 4EMZA 3O8XA 2NUTA 1WAAE 3CVHL 3WTSA 2P46B 3P0YL 5BV7L 3GMLB 3HZMB 4WI3A 5JOPE 3BX7C 2KDYA 4CN4A 4TPRH 1OGPA 3IU4H 4XOBA 1MRDL 2ED9A 4JL2A 1NCWL 3TO2B 3DGDA 1OAKL 4HEME 2X6BA 4X6BA 2VOTA 3DPDA 3LN9A 4F58H 2JCCB 4Z7UE 1SDDB 1DE4B 1WD8A 2OMXA 3N0PB 3I3DA 4WEEA 4GSUA 3ZK0A 3LRLA 2AAVA 4HMDA 3MA9L 4YSDA 4PJ7A 3BPCB 4TF4A 3SPGA 4A6YB 5I5JA 4MA8L 3FL7A 3T3PF 2FYYB 4YXKH 2UXTA 1OD9A 4ODVH 4HPYL 5F93C 3FTXA 2HJFB 4DK6A 1TO4A 4O58H 2FJSA 1JF6A 2CHWA 1YNTF 1MW1A 4JZJC 3BGFC 4FHJA 2NNAB 2OX5B 3TVMD 4R2GD 2UXFA 3RTQB 1B0RB 4GUCA 4OVUA 5CN2A 1ZKAA 4FJYA 2RH0A 2FX7L 3ZJAA 4PWJA 2W95A 1UKQA 1E9PB 1OAZH 5ANMB 4F9PC 2XVGA 3IB4A 1QA9A 3IJEA 2E7LC 4LEOB 3APNA 5CCJA 2G5RA 2EIKB 2PPEA 3C60D 1QPXA 2UZXA 5CSGA 5CWSA 2VITA 4WHDA 4QXWA 3V8OA 2I69A 4Y89A 2OL3A 5B7FA 2EDYA 3IKCB 1Z0NA 1YUHB 2CXGA 1R5IB 5E51A 4YHNB 1UOWA 2ICWA 4LSSH 4N24A 1MJ7H 4ZOCA 3E7JA 2IQ9H 4LBEB 1LO4L 1MHCB 5KVFL 3VG0L 4XTRD 5F9JA 2HVBA 4AQ8C 1I9IL 3ZE0B 2F54A 5ITFB 2VLKA 4B97A 4IBVA 3SPHA 4K2UH 3H4FA 3FB7A 5ACMA 4X9FA 3M7OA 2X4PA 3TEWA 1ZOXA 1E27B 2C5DC 3QEQE 2ED7A 4HK0A 3UEZA 4MB1A 3V52H 1HI6A 2AQSA 3HE7A 4TQEL 2DBJA 2ZOTA 5IM7A 3QXWA 4BFOA 1QSZA 2BIIA 1JZJA 3L3IA 1KWGA 1NM9A 1S7XB 2X2UA 3O6ML 3RAJL 4YDIL 4TSCH 2CWRA 4BSVB 2HMID 3IJSA 5JNYB 1WZLA 4NFDA 4NJ9L 4XNXL 4FP8L 4G8AC 1U42A 4NQSA 3D25B 3RDTB 1TFPA 2N7SA 5HHXL 1MIML 4PWKA 1N59A 3DDGA 5HYJE 5MEOB 3H56A 3DBXA 5GJTH 5LNDA 1YYMH 1FVDA 4XNMB 1YPZF 3TN0A 4F15C 3BKML 2FB4L 1BLNA 3MRDB 3F7KA 4GBXC 3QHFL 3WELA 4CBPA 1DQQB 4NT6A 3MLWL 1J05B 3RPIB 4A2FA 5LXGL 4PMEA 3OBAA 1IC4L 4JJ5B 1NC2A 2CCLA 1YSOA 5EIIG 5KS9E 4WTQA 5B21A 3M1CA 4OGYL 1GAFH 2M2DA 4U1JA 4XOAA 3DSNA 4B3VA 1EHXA 3D2UA 2XA8H 5DVKA 3IGFA 5JOFB 1XXDC 2QQLH 3FS9A 1UOLA 4FG4A 1QKZH 1DFBH 2ZUXA 4NHUB 2OXHB 3P11H 2G30A 3FO9A 3L4CA 4RDBA 1RAMA 3D18B 3QEQD 1E5BA 1KGXA 3MRCB 1Z3GH 1IC5H 2QV2A 1C7SA 5LCVL 2CO6A 5CEYB 1QEXA 3DOSA 1A7NL 3P4NB 2NMSA 5JXEA 1BEYH 2HH0L 3FONB 3MRPA 3MRBB 4IKJA 4PMFA 1A4JA 1MH5A 3GMQA 4ELMA 4POYA 3NN8B 5D2NA 2VZ1A 1NBZA 3MFFA 1P6WA 3VO0A 2C4XA 4WUKH 1XH2A 3GZOA 2Q7AA 3IMVA 4FXKB 2EAEA 4IHBA 4WW2A 2OTWB 2AEQL 4YPGA 4WFHE 2OTUA 3BQUC 3VTTA 4N2LA 5DUBA 4U1KA 3EO0A 1U8IA 3ML9A 5C71A 4OUUB 1JN6A 1CLZH 3OKYA 2Y2YA 2JJTA 5LGHL 1NBYA 3FXIC 4H4NA 4PYGA 3T3MF 3US9A 2V17H 1B2WH 1FFNA 1T6BX 1JWSA 1XCTB 3MOQA 4S0TD 5ERWA 5DA0B 2HT4D 3UABA 1AHKA 2L7QA 3AXLB 3EGDA 1LM8V 3FTSA 4D8OA 2EYSB 2UY7A 1TOXA 4DUXA 3TT1L 2C9UA 4OQ1A 1U3HB 3V0IA 3O41B 2N7BA 3U25A 4TSBL 3QJVB 1HKLL 1UTDA 1PSKL 2GUYA 5T5NF 1FFTB 4WHYG 5C08E 1E5ZA 1KGCE 1RZKC 4IOSA 4HIHB 5JA9A 4RGMC 3NZHH 1S46A 1VACB 5E8OB 3L5WA 2VISA 2X44D 2XWCA 1F4YH 3QNXA 1PGRB 3GUTB 1GJIA 4MWFB 2VAJA 2PTTB 1AKJB 2YN5A 1YY8A 3DVNA 1OP5H 2DLGA 2H8PA 4LL4A 1UC6A 3FT2B 2WWMD 3EO1A 4WI6A 4TNWK 5K69A 2OMBA 3OLGA 2OJ1A 5GRJL 1GGIH 2XT1B 3OKOB 1FH5L 2P9RA 4MQ7B 1KBGH 3D9AH 2ZQKA 1BZ8A 2ZG3A 3BZEB 4XMPH 2H2PD 3ROLA 1JIBA 1JV5A 1T0PB 1BQSA 2P47B 4JRLA 4OB5L 4Q4IA 2RJMA 5B1JC 4WFHD 2RACA 1E8ZA 2D7TL 3L1OH 4PWFA 5GS0C 4FCAA 3HNTH 1HKFA 1L3NA 2JK5A 2DIEA 2EXWC 1BF5A 5A16A 1P7HL 2XY1A 3BAJA 5JIDA 4OF5A 3FHEA 2MEJB 3CC5B 4Y1AA 5J8OA 3TBTB 2Y9RT 3IXAA 1EJ8A 4BHUI 1WUZA 4TLKA 1G0XA 3BLKA 4JZJA 5BOPA 4Z7NE 3A6CL 4GFXA 1EO5A 1IV8A 1XF3B 4GS7C 4YFDB 2ZUQC 1F86A 5TDPA 3GLDA 5I5RA 3SDAD 4WWID 4Z1PA 1CGXA 3OR7B 4YK4C 3GK8L 2HKHH 1MFMA 4HBCL 4JDEA 4F9PA 3K80A 1J0HA 3QS3A 2E7LA 2OMWB 4FI7A 5HDBB 1WIUA 1TJMA 3INOA 1AC0A 4OCXH 3FQRB 4UT9A 2HUHA 1JDDA 2NX5D 5C08D 4PN6A 1KGCD 4PJFB 1IQDB 3G6JE 3OKDB 2VERA 3K0YA 4KUCF 5DQ9A 2ARJQ 2VSKB 4QWWD 5F3BA 2HT2C 4Z0BH 1BVKA 5GRZA 2NCMA 4XC3L 3QVAA 4AQ8A 4TULL 4MRCA 3QPQC 5EZOL 5TQ2L 3NZUA 1RZ8A 2OYPA 1HX0A 1PFOA 5EV7A 2GHZA 4PLKC 4PRHE 3TWYA 4Z77B 3D0VB 3ULVF 4A2EA 5ICXA 1FSKB 4TNVF 4O4YL 4X99A 2YD2A 2VABA 3TNMB 4K5LA 4JFQB 1A25A 2DL9A 4LGRB 5CM1A 3RWHA 1VGKB 2X9XA 1XB6A 3PJLA 2YHGA 3QUXC 2YPKB 1IC7H 5F9OH 5HI5C 1NEPA 3T08A 1X4XA 3RWJA 2PCFA 2VL5A 1PAZA 4HKXB 4PJ7F 4XPTH 4I9WE 4PJDE 2HTLC 3BZ4A 3MKKA 1HQ4B 4H5SB 4NUJA 4QJ5B 4IBLT 4HCIA 5G5DA 3W56A 4NZFA 4I48A 4OLYH 4MJ5A 2VC2B 4LPWA 3ZXAC 3DK2A 4HFUL 2AITA 2ZE0A 4KC3B 2X4NB 1I31A 4GKLA 4KY1L 3WE1A 5KVMC 2I5YH 3HN3A 3BWSA 5CILL 1UFUA 3V6OA 4E9YA 2AZAA 4RGOL 2YR3A 3FU9A 4AQEB 4MAYC 1IL1B 3TXAA 3UFIA 3QHZH 1RJZA 1OKEA 1FVEA 1PKQE 3S5LA 3BKCH 3SHSA 1OSYA 4XP9L 4OM1H 4D0DB 4P2CG 1K4DB 2QADD 5JW5A 4G8GA 4F7KA 4ZNEE 1Q9OB 2D7PA 3KBPA 4HH8A 3RPBA 2NY2C 1A5FL 1AYRA 1WGOA 2F7OA 3UO1L 1HFUA 2YO3A 4KAQH 2K6WA 1IJ9A 2X1PA 2XUWA 4RAUB 4BFJA 1TJIH 1WEJL 5DWUH 1T5XA 2K8MA 1QSEB 1UWGL 2EZ0C 3EFFB 5IHUL 3CNKA 1EVTC 1LD9B 3HLAA 4GAGL 3KWTA 2B59A 4JCWA 5DXWA 1PTZA 2A38A 1QO3B 4E41A 1FO0B 4P23B 5AB2A 4YXHH 3BQUA 1J86A 1K5NB 1UCTA 1XIWD 2G0KA 4H13C 4XN9A