1OGPA

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
388
structure length
388
Chain Sequence
PGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE OXIDASE
publication title The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 103
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ogpA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 1ogpA01
3HC2A 2BIIA 2XTSA 3R19A 2CA4A 1XDYA 3HBGA 2BLFA 4PW9A 4PW3A 2BIHA 2A99A 1SOXA 2A9DA 2CA3A 1XDQA 2A9CA 2BPBA 2A9AA 2C9XA 3HBQA 3HBPA 1OGPA 2A9BA 3R18A
chains in the Genus database with same CATH superfamily
2A4CA 4OZGB 5HDQH 1FGVL 2KDGA 1A7NL 1U3ZA 2ZOWA 4GKSB 4IU3B 1CT8B 2FE0A 4L1BA 1HOCA 3TX4A 4A38A 1F2QA 3HG3A 3EO0B 3K6SA 2WHVA 2IGTA 2WD0A 2YLHA 3CVCA 4P9HH 4YBLC 4QXUH 3SJVD 3DVNA 3BZDA 1NGZB 4HCRL 3BAWA 4JFEB 4QOKA 1KBGL 2MWCA 5EOCL 5EB9A 5HDLA 5T1KD 5KS9B 3DA0A 1OCWL 3DSNA 2JIXD 3BJLA 3GIZH 4HF5L 1XF4A 2X9XA 5GS2D 1J1PL 5F7DA 2J6EH 3HE7D 4KI5F 3L95B 2GSIB 1KT2A 4Q58C 2PCXA 3KLLA 4V1DA 2AP2A 1X5GA 5L4JA 3O0RL 3L54A 1KJ2A 2AMUA 5AOKA 4J12A 5JPNB 5IVNA 1LGVA 3B5GA 5HGHB 4A55A 1CTOA 3ARTA 4O2FB 4YX2L 5EPMB 1I9IH 3TVMC 2QMKA 1FSKB 2Y1ZA 1YNLH 2YUVA 3DHUA 3KYKL 3MXWL 4H0IA 4Q52A 1I8IB 3BUIA 1LWJA 2NDGA 5IESL 4LQFL 4XODA 3QJRB 4JFZL 6PAZA 3AAZA 4K3DH 3IMRA 1CFQA 3CFCL 4MHHI 1KJ2H 3UH8A 5L8JB 4G7VH 5LNGA 5GSVA 1I3RB 5K69A 4YMPA 1R3LB 5C0BB 1LK2A 4JDVB 4YHLL 5FYKD 4PM1A 5DZPA 1A4CA 5GJTL 4F2ME 1K4CA 3PAVA 5A6IA 2CA4A 3TIEB 4BWTA 3SPCA 5KSUB 1MDTA 2QADC 3RZCD 4R0LA 1URIA 2QGDA 3U25A 3KHOA 3V0WH 3TF7C 4R2GB 5F8RC 3F6IA 3LS4H 1T1ZB 4PJAF 5GS0L 1K8IA 3D2UB 4ZX6A 5CFHA 2A6KB 4Y8AA 4ETQA 1XSJA 2YEZB 1KTDB 3ME0B 5DD3L 1TIUA 3HMXA 5LG6A 4PGBA 4EQ3A 4XH2A 2I5YH 4XNZB 1ITCA 3SO3B 4X8XA 3VGGA 5ID1B 5CGMA 1PAMA 2YKLL 2WGXA 5C0AE 3MRKA 3V5KB 1VKXB 3MCLH 2UZIL 4PJBE 1P5VA 1DVZA 4JR9L 3HKFA 4G9FB 4KPHH 1YAZA 3D6GA 5J56B 5BV7H 3FT9A 4R84A 3RHWK 1J0HA 4L4VE 1OD7A 4ZMZA 5TF1L 4OSUL 1U4FA 4MGXA 2X9ZA 3WNOA 3L9RB 3MNZB 1WZKA 2G0LA 1U3HB 3ZHKA 2YD5A 4N0FA 4S0TD 1JK9B 1DVFB 2ICEA 2DTSA 1FN4B 2YUWA 4GMSH 3VX0A 4WI9A 4MD0A 3HC4L 4LVOC 1L6ZA 2OSLB 4Y4KA 1TLKA 3EH3B 1D5MA 3IETB 4DPCX 1NGQL 1T2JA 4WHDA 5JW4N 3MMEA 1WFOA 2IDFA 3GXDA 5JIDA 4EZJA 1DBML 1PYWA 5TE4H 5FWRA 1PEZA 1GYVA 4D7PA 1Z9LA 2CKNA 3N42F 4PJ9A 3F01A 4JJ5A 3CN4A 5EUOA 4LCWE 3EG9B 5CSZA 1XEUA 4NYLB 4KY1L 4M9PA 2BIPA 4ZFOL 3V0JA 4JQXC 5JXEC 2OMZB 2LGNA 4I0KA 2YSSA 4X0KA 1YJDH 2VR3A 4AEEA 3N40P 1NCTA 1E0OB 2AJYL 2CJTA 4KZ0A 1T0NA 1UCTA 1U58A 3DLQR 3SDDC 3K4AA 4KK6D 5BRPA 1YQ2A 2LAAA 3VXSA 4CVXB 1MHEA 2JQZA 1MZZA 1W72A 2Q9OA 8PAZA 5CJOL 2I9LB 1G1KA 4IEFA 3P9MB 4JHBA 5HDBF 1M7XA 2EVFA 4R6UA 4MXQC 2ZCHH 4APQB 3LKSB 4ZO9A 1DJSA 1UASA 4QCIB 4IBZA 3ZDYE 5DMYA 2H1PH 1AC6A 4EF3A 3H9ZA 2WQ8A 4HEPA 3U9WA 1R5IA 1NUNB 1USQA 3JUYA 1R3HB 4XVOA 5I1EH 2AJZA 1QATA 1W72H 1ROWA 3FQXA 4HZLA 1KEML 4MAYC 3TBSB 5KW9H 2DDQL 1OCCB 4GBXB 4YHKL 4DP1X 2DQUL 5DMGD 4N86A 3REVB 3SE9H 1KB5A 4GQ9H 4MKTA 3RNQB 3U6RB 3DRQA 1RJZB 3OKDA 4PCTA 4G9DB 1MCPH 1R3IH 4QPEA 4AYBA 3ZZSA 4BZ1A 3CFJB 2YUXA 3T0EE 3GSOB 3NIGF 1EHKB 4LP8A 4EN3D 5HDOA 4FI6A 1BQLH 2PYFA 3BDXA 4QNPF 1IIKA 2IWEA 4JFFD 3FFOA 3OGOE 3V4VL 5C0JA 4U3CA 1OCOB 3NCJH 3F04A 3JWOC 4PJCF 3RWEB 5EU3A 5D7JC 4CC0A 2FH8A 2FWSA 3B3IB 3D50A 3EO1A 3O2WH 4PMEA 1O6SB 1Q1PA 3VU1A 2EACA 3KWWA 3AS3A 5BVJA 3DTXA 3ZDXB 4G71B 3JT0A 4C56D 1L0QA 4PS7A 2BXYA 1A1OA 1N3NA 4YE4L 3BGFC 3UEQA 1FFTB 3MSPA 3KBEA 3QCTH 1R9FA 2P44B 2L8AA 4OGAD 3GRGA 5IVXF 2NY7L 5C3LD 3LZRA 4LNRA 4J3OD 5HJ3A 1Q9OA 5F72S 3PU7A 5ISZE 3B5TA 2NY5H 4ZO8A 2ZX9A 6FABL 2WUBH 3GHEL 2AK4A 1HXMB 2J8UE 3FB6A 1CD0A 2JCCE 2XA8H 3QPQC 12E8L 2VB5A 3EOBA 5IMOA 3AXHA 3IAGC 2J12B 4HFWB 3X3GH 4KH2A 2JELH 4B9YA 1F5WA 2YC1B 4NOFA 1QYGL 3MRDA 3O8XD 3V0VA 4DETA 1F6FB 3SKMA 5E6RB 2H26B 1QBLL 5EU4A 5IF0A 1ZXQA 1FFPA 3GIVB 4FG6C 1BJMA 3D9AH 5D96B 1J8SA 3VGBA 1AFVL 3O6MH 4P2AA 4MLIA 1T1YA 5G55A 1O9VA 1QR1B 3CDZB 3CLEH 3M1BB 4YFLF 2B4CL 5ALCH 3NN8B 2KT6A 4AYDC 5C09E 3INUL 3WTVA 2RFXA 5DF0A 3UZQA 4FAAB 2QQNL 4M8QA 4KK5C 4JKKA 1QRND 2FX7H 4EEEA 2XTJE 2DICA 4Y0GA 3WGUB 1P4UA 1RZKC 3WEAA 2YPVH 1Z0MA 2CK0H 4WFFE 3MRJB 4BSVA 4UINL 1IC4H 1DUZA 2GI7A 2HCZX 2YPLD 4MA8L 4MS8C 3BKMH 3VW3L 5T5FL 4APXB 3WNJA 5DHMC 1BREA 3SDXE 1NICA 4F9LA 5TDNA 1OAUH 2Q3ZA 1DLHA 5I71C 2I9TB 4M9OA 4QRSB 3CZSA 3E6FA 2Z31A 5TGBA 5IGXL 3Q2CA 5IZ7A 2O5YL 1QSFD 2DBLL 5I8OH 1NOLA 1CLYL 3H0TB 3OAZH 2PNDA 2FJHB 5BVPL 4Z95L 5F7YC 2KHAA 4JQVA 1NC2D 3QZOA 2NZ1A 5AW3B 3C5ZD 3GTVA 3L2MA 4HIHA 1Y7VA 4FTVA 4HLJA 2VQUA 3ESPA 1EGJA 2UXTA 1QA9A 1RZ8A 4Y4FA 3MV7E 4KKRA 3ZE2F 4PJ5E 1CYGA 3IMTA 1FNGB 4G6FD 2G2RB 2HFGH 4XCNA 4MAZA 5J5EA 3KDMA 3PP4H 4LK4A 2X4PA 5IW3A 3B9AA 1DQMH 4TM9A 2CO7B 4GLRI 2FSDA 2O6FA 1JHKH 1CD8A 4KQ3L 4DKTA 4DUXA 1E4WH 2BLFA 5FYJL 5H4ZA 2GUOB 4GSRA 2VDKL 4GO9A 4R4ND 3FQRB 1Q9WB 3L4XA 1WRFA 4HT1H 4P2OC 4IIQC 5C0GA 3WUWA 1QFUL 2V2WB 2WWKO 3HS0B 1CQYA 3E8UL 3WGVB 2X40A 2XQBL 3HPLA 4ODTL 3EJSA 1GXEA 5E6IB 1U8JA 5IJDC 5HYSA 3GBEA 1G6RL 2VDNL 2Q5BA 5IMLA 5IREA 4J39A 5KYWB 4NO0D 4HUXA 1RURH 1KUMA 1E4XL 1OSZB 2Y4SA 4F7PB 3D34A 1R19A 4KU1A 1ZLSH 4JBSA 3QG7L 4LGSB 2A1WH 2J4WH 1CICC 2LU4A 3G3LA 3OLDA 4JFPA 1LM8V 2CLZA 4F2MB 4PRHD 2AJVL 4X9IA 3EXJA 3QISA 1JFQH 1UFGA 2NSQA 3QIWA 4YAQB 1NMBH 3BESR 5KSBB 3TO4C 2VRQA 4ZUTA 4XP1L 3HLAB 4YDKH 5HGBA 4DK5A 2P8LB 4N8UA 1QRKA 4CC1A 3P54A 1X4ZA 1RK1A 1T1XA 4QYAA 2OJZL 1B0IA 4WI4A 1TETL 3RL1B 3EOYG 1KV3A 1KELL 2N7BA 1CE6B 2P9RA 1OT2A 3TN0C 5T3XL 2BX5A 3GKWH 1BAFL 1WSST 3MA7B 1L6PA 5BS0A 1DJHA 1X6LA 3QARA 2OZNA 4PJBB 4X4YB 2XJKA 5BO0D 3C2SA 1TSHA 4KHXH 1P7QD 3UTPE 1HI6A 1MCBA 4N8PA 1BIHA 1D2OA 2GJZA 3GMLA 4K71B 3UDWA 3T2OA 3BH9B 4PJXA 4X98B 1CCZA 5FX3A 1P4IL 4HJJL 2Z0UA 3LKRA 1NEZB 2IDCA 3VFOA 4ZMXA 5CEZE 4NC2B 1AGFB 1BQHA 5AZ2H 1IO4C 1YVLA 3V0GA 1A7QL 2EINB 5DWUH 3UTTD 1AI1H 3MRNA 4X4ME 3KW7A 4QT5A 1PFOA 4ANKA 1MCSA 2ORBL 1DVYA 3C5JB 5E9DB 4NDMA 4EI0A 3ULUC 4NCC1 1S7SA 1UD2A 5EUKB 2UY6B 1AXSB 1IKFH 1SHXA 2AJUH 3VD2A 3FFCE 1J18A 2IDSA 5GISH 4FQJL 1WGOA 3PQYB 1OP5K 1VRSA 1S7VB 1LLAA 1CXEA 1T7VA 4LCWB 3FO0H 1OOWA 3S34L 4HJGB 1SOQA 3OQ3B 3DYOA 1G7IA 1DFBH 2X1WL 2OMTA 4WVRA 1SZNA 4WV1B 2GHZA 1SDYA 1T7WA 2HWZH 1GR7A 2YD0A 4L1LA 2ZUTA 3JWNC 4FQLL 1P6AB 3ESMA 5IB2A 2J20A 4GG6A 1O7VA 1UG9A 4XX1E 1ZOXA 2BSTB 2ZXGA 3RA7H 4UTCA 3N91A 1F90H 4KOBA 2DQCL 2BVOB 3R7RA 4HWZA 3VVWA 3H4FA 5D2NC 1UXLA 1FH5L 2Z93B 3ZDYB 5BMFL 4FL4C 3QR2A 1MAKA 4IKLA 4KQ0A 1H3VA 4NPJA 4U4BA 2N4IA 1OE3A 1OB1A 2ENYA 5I15L 3Q8FA 3I6LD 4KI5D 4N4YB 1OF2B 4B3EA 4AEHL 5LHDA 4LEEA 4H20H 3DPBA 2F53B 1M2OA 1BDYA 3L8QA 2A5UA 2Y22A 3NCMA 2NXZB 1OTSC 3T0EB 2DJSA 3OL2A 2WCPA 3MNWB 2QV4A 5TE7L 4X6CE 1D6VL 5D6CA 4DZBA 3BWAB 3UAJA 1N7MH 5AZEH 1F56A 3DMMD 5DK2B 4FFYL 1ZK9A 3CHPA 3A21A 3ZN6A 1E8WA 4JGNA 5FA4A 1J8RA 4TNWF 3SPVA 3ZKSD 1BLNA 5JIPA 3DGDA 5FR3A 3FTUA 4NIKB 2FBJL 2W0FA 1HCYA 2ZUVA 3VD3A 2GT9B 5IB4A 5LXVA 5DD1H 5FKPB 2WLLB 2X0UA 4FQCH 5C3IA 3OKEA 4N25A 5D7LD 1NGZA 4H13C 4JFEA 3TBWA 5KS9A 1IC7H 1FZMA 1L0XA 3CFBB 3MUJA 2V5YA 3CSYA 2VN5A 2OKMA 4WJKB 3UAEA 3L4YA 4UTBA 2GSIA 3E6HA 3UG5A 1J9CT 3RKDD 2WZ0A 1KIRB 2F1EA 3DIDA 5JOPD 1RVFH 5ISZB 1SXAA 3AY2A 3PPSA 5C2UB 4KX7A 3BVTA 4L2YA 3VU2A 2BRQA 5EPMA 4FNTA 4R7DB 3P3TA 2J8UB 5D5MF 2CQVA 3SZ6A 3VRLF 2F08A 1AYOA 4B9JA 3C60A 3IBOA 4UNVA 2X89D 4UM9A 3BCDA 1U8PB 3SGJA 5ICYA 1N0LB 4N0UE 3AG1B 4W4OA 4BXVA 4WEUD 4ODSH 2J5LC 4H8UA 1DSYA 2QHRH 4JREC 5C0BA 4OZHB 3V52H 4JMXA 4KTEL 1X7SA 3AQZA 3OJVC 3PL6D 5F1KC 3HI6L 2C4FT 3GS7A 4RGNC 1JAEA 3TIEA 1FZJB 4JS7A 2NCEA 3VDAA 2A77L 1AGBB 5KSUA 3UZEA 4AMXA 4ERSL 5IW1A 3BZ4A 3ULSA 5L8LB 3FN0L 3UCQA 3OSVA 2I25N 1T1ZA 3N6YA 4GOSA 3X11B 5CLTA 3BQUA 4UQIM 2Z64C 3D2UA 3D05A 5C0RL 2YEZA 5D7JB 1KTDA 5IQNA 3ME0A 1X5XA 4QIRA 4U1JB 4TQ8A 4R26H 5LKNA 3SDXB 4AG4L 2NR6D 4P2RE 1L6XA 4O58H 3V5KA 1VKXA 4DVRL 1Q1JH 4XCFL 5J1SC 4G6AC 3WJJA 1G4RA 4WO0A 1SY6H 2EDKA 3MREA 7PAZA 2W38A 3O9WB 3PXLA 1IGCH 3CVIL 3DX6A 4JO8A 2HG5B 2A6DA 3S88H 1BFTA 3L9RA 3MV8B 5ILTH 3KS0H 5CIPA 4AGOA 2MCPL 1U3HA 1JK9A 1AHWB 3L3JA 1DVFA 2BRRH 4MJ6B 4Y1AE 2E74C 4HSAC 4WHYH 3PAUA 1YUKB 1BZEA 4YOKA 3IETA 1BEYH 4PJ5B 3STBA 4JPIB 1UJ3C 4X8GA 3WS3A 1TPXB 2HTLC 5CIPH 3ARDC 1U8IB 5CUSH 1SOSA 2QVTA 2BWDA 4I18B 3RE0A 5E1AA 3LEVL 4U7MA 4YDIL 1S7XB 4OH2A 1AIFA 1E5YA 2WP3O 4MDIB 5I16A 4I3SL 3EDKA 3EG9A 3B9KB 4PJIF 4NYLA 5GGRY 4ZUUB 2WZPD 4O51B 3P1VA 5FFOA 2OMZA 1IGML 3D25B 1YNTF 3PE9A 5CJQL 4NGHL 4TTDC 2IQ9H 4XNUH 1GOFA 4UWQB 1DBAL 5IMMB 4KJPD 2Z7YA 4RMWA 5F1NB 1UACL 1MJUL 1I1FB 4P2YA 5MI0B 4NO2B 4CVXA 2PXYA 5EO1B 5T5NG 4F33A 4GRLB 3OX8A 3UYPB 2VRAA 1SJHA 3MPCA 4U6HA 1TOXA 3P9MA 4Q9QL 2OMXB 4APQA 4KXDA 4QXGL 4A2DA 3Q05A 2E3VA 1SLVA 4OGQC 4QCIA 4DGUA 1MCOL 1UXMA 3Q6GL 4I3RH 1C16B 2XT1B 1VFMA 1WCBB 1EJ6A 1R3HA 1VESA 4N2EA 4WENB 1EEUA 3NPSC 3V6OA 4Z5RB 3FNKA 3TBSA 2IANA 2ZP0T 1B6UA 2WZAA 5CEXB 2ITCA 4XZUB 3K0WA 1G7QB 3QT2A 2H32B 4AJWA 4BH8B 3DV6A 2ZICA 2ZOLB 3NJXA 1W8OA 4XWGL 5DUPH 1Z0NA 1FPTH 3GHPA 2Z8RA 4NPKA 4F15C 4NM8H 4ZQKB 4IDJL 4JM2F 3QPXH 2QJDA 1I1AB 1KG0A 3KR3H 3OLEA 1YN7B 4PSPA 3GMPB 3WKNA 4QTIH 5I24A 1ETA1 4MJ5B 5DVOA 3K2UL 2J5WA 1JRHL 2CR3A 3JTSA 4CMHB 4DFHA 3EF7A 2MPAH 4OCXH 3VSTA 3B3IA 5KUMA 4W4NA 4M7ZC 3HE7C 1O6SA 4OM0L 3VH8A 2I60H 1EXHA 4AEIL 3FUFA 4KTGA 4HXAL 4ADGA 1JRHI 2Y36H 3S5LB 1BJ1J 1P69B 4L0YA 1P84K 4P2OB 3MLVL 3EGDB 4HIJA 5J11B 4XC1H 3A6CH 3ABZA 2XFXB 1TQCC 5B1CA 1MWAB 1YEFH 1BZOA 3EUDA 1QI5A 4KHTH 1XGRB 1CZ8L 4PJ7A 4GQRA 1HILA 3OKLB 4OKVB 4XP9L 4JCLA 3FFCB 4Z7OF 2R2HB 1G9MH 2VO8A 4DKEL 2BVUA 1KFGA 3QJFB 4UT7L 5F0LB 2YGVA 1EHNA 4XMKL 4GS7B 4K3EL 4KITB 2K4WA 2BK8A 4DZ8B 3MFGB 4JPKH 5CU9A 1U42A 4JPWL 4O02H 3WKML 3T2NH 1GGBH 2L4OA 3HZYA 5ALBH 1XDTT 4N8VA 2R27A 4V2CB 5GRWA 3Q8AA 1KXQE 2YRPA 3GTNA 4I77H 5SWQB 4PW4A 3BLBA 1C8QA 2F54E 3PGFH 4DUWA 3NA9H 4X9YA 2EXWD 3I9AA 3FO2B 5E4IA 3TTYA 2H26A 4TKWA 1QWHA 2NTFB 1XB8A 3KYOA 3VA2C 5JIHA 2WSPA 3GIVA 2ZUWA 1IGFL 3ALWA 2B16A 1E28B 1LO2H 4NN5B 1TNNA 2KPWA 2XTSA 4U3XA 3M1BA 5AKVA 4ENEC 1N6QH 3BAEL 5ES4B 3S8FB 1HDMB 2ERJC 2ZAGA 1MFEH 3VTTA 5AWNL 5EEYA 1WWWX 4NCC2 4PY7B 3BO8A 5I74C 3T6ZA 1D6EA 2VR6A 3IJ7A 5KAQG 5I75B 2GHWB 2NY1D 1FAIH 4HFUH 3SQBA 4P48A 4OCYH 2ALWA 3FCUB 3EW3B 2YOAA 3T0AA 2L7QA 5AG8A 5L4IA 2C3GA 3RDJA 5FV2A 3GI8L 3VG0H 5HYFA 3FB7B 2AABL 2NZ9D 2K9FB 1IVTA 2KDYA 1PU0A 3LEXA 4PD4J 4AGQA 5LAXA 1LO4L 1QVOA 1XIWD 1JDDA 4TULH 1BFOB 4K3GA 4OV6F 1VGKA 1JI2A 4JG1L 5JHDD 2LV4A 2VDOH 5KBLA 1G9NC 2G30A 1FNGA 3L3DB 2R1YB 4MCNA 5E4EC 5KYXA 5F7EH 4KXCA 1UURA 1E9OB 2QKIA 2CO7A 1HH6A 1HSBA 4L1DA 1EO7A 1IAKA 2GUOA 1CGXA 2WYZA 2N59A 3L3HB 2DL2A 2EDTA 4YXHH 3HS0A 4OD2A 2ZT9C 1FDLH 1YSOA 3HI5H 1L5GB 4P3CL 4C4UA 3GINA 2D03H 2ZX6A 5E6IA 3SOBH 4M4PA 1UATA 1LD9A 4Z7UF 1MRCL 2FYVA 4N0UB 1OM3L 1AGCB 1ZJAA 3MLRH 4PJEB 1HYSD 2ICWJ 4FG4A 1A6TB 4G80A 5C6PB 5DMGC 1GYWA 4NAMA 3VB9A 4FFTA 4F7PA 2FQGA 5F9OL 1RZQA 3CK0L 1QFWI 4ONGL 4XN8A 2LLLA 2OYLA 3ETBF 3FUKA 4QJ4B 2VSCA 3V8CA 4LSQL 4WSGA 2UX6A 2R9HD 3QQDB 1JMZA 5LO7A 5KSBA 3MACL 3D0LA 3HLAA 2P8LA 3MLSH 3HG1E 4FQPA 4XP6L 3ARQA 3G5VB 4DESA 1OARL 1HXKA 5A2LH 4L5FH 2CE6A 3WE6A 1KPVB 4H2CA 1AJ7H 1CE6A 4P2RB 1BLIA 5JQ6H 3OLGA 2HKFL 1JYNA 1WD8A 3MA7A 2QFPA 1N2RA 3VFPA 4HKZB 3T5WA 1CXFA 1Z9PA 4X4YA 2EUXA 5EO9B 4LSPH 1BZ8A 1CLZH 3A6OA 4I48A 5B38B 5IV2B 4X6EB 5LN8A 3N0PB 3VX1A 4X98A 1X5IA 5DHDA 3GSWB 4RZCA 2N56A 4MCYB 5FYKU 1Q0YH 5AVTB 4PY8I 3FCTB 2AANA 2DBJA 1AGFA 1G7MA 2RMNA 4J3OC 4RMSA 4Y1AB 3BT2L 3ZL2A 2P26A 1OT1A 3C9NA 3TVMA 3D3VE 3GXFA 4HISA 4GO6B 1L9RA 4CSPA 3OM3B 5E9DA 5F93C 4Q2ZB 3MGTB 1EAQA 4MMYB 3MRPA 1AXSA 1XCQA 3G9AB 5AVWB 5C07E 3PQYA 2XVLA 1S7VA 1IARB 3S2AA 4LBEB 1RZGB 2K7QA 3O8XC 4HJGA 1J1OH 5ANMA 1ZRUA 2CDFB 3OWEA 4DP0X 4S1QL 1Q72H 4P2QE 4QEGA 2A74C 4WV1A 4GW4A 4HS6B 1BM7A 3I3DA 4FZEH 4JO3L 5I8KH 1MFUA 3ATBA 3LNEA 4XPFH 2VERA 3QWQB 4YJZL 3JYCA 1AMXA 1WAAF 4H0HB 4PJDF 2MOGA 5FGCE 4JAMB 3WN5B 5D1QD 4XOBA 1VZGA 2VMFA 4MD4B 3KJ6L 2IF7A 2EC8A 2BVOA 3IXTB 2X4TB 3NT0A 3A67L 4FKHA 2X3CA 1IGYB 3ILPA 3WFDH 3U7WH 4XB8A 1F86A 4UOQA 3O2DA 1UTDA 3O3BB 3X2QB 4KVNL 3I84A 2ZOUA 1JVOA 1KPUB 4U1GC 4Z3GA 2J73A 1WD9A 4KDTC 3NIDE 2AJXL 3WJLC 3ZZ1A 2DB8A 2O26U 5IB5B 3UXFA 3WFBL 2F53A 2CO2A 3RPBA 3O2DH 1I9EA 2XNAB 1MLCA 5HGDB 3ILDA 4FNRA 3V5HA 3SY0B 1Z6JT 1LWHA 3C5ZC 3DX1A 1L9SA 3C09C 3MV9D 3N44B 5I18L 1SEBA 2V9TA 4L3EA 2GTZA 5D7IE 2E6QA 5DK2A 4U7KA 3HI1A 2V2XB 1SN5A 3GJEB 1YEKH 2VKXA 5EN2B 2RTTA 3E9TA 5DFVD 7FABH 3QFJA 1N5YL 2CHDA 3OKKB 2E9GA 2H4EA 2H6UA 2IH3A 5AW6B 5EF0A 4K0OA 1DQIA 2HRPL 3GC3A 4HUUA 4S11A 5CFAA 2B0SH 3A23A 4CDGC 5FKPA 4JQXA 2WLLA 4CU6A 1DBBL 4NHUB 4R4NC 1RK0B 4I89A 4NUPA 5CD5D 4A67A 1J0ZA 4K3JH 2WLZA 4KJQD 4G8GD 3SDDA 4H5SA 4ZMQA 3SZKC 1AY1L 2HTKD 5EZIL 5IJVA 1ZANL 5LB1A 4L8SB 1J8HB 2BW5A 1T20B 3IDYC 4JM0A 4PWIA 4TS6A 1YY8A 3CZFB 5GRVL 1R34A 4ZAKD 1A6VH 1T04A 2R4RL 1FCGA 4JY6B 3NPSB 5DWPA 3LN9A 5I8EB 1H9DA 4B7IA 2NNAB 4MAYA 3DBXB 4YH6A 4I8DA 4TLSA 1OGAA 4MJIE 5JA9A 2VN7A 2F54B 2UXGA 4L0PB 4IS6B 2EH8L 1MFVA 4OZHA 3EYUL 1K3ZA 1NCIA 3OB0H 4KKAD 4X4ZA 1PCXA 4X6FB 1FZJA 1Q4NX 3VSQA 2LAGB 1ULVA 1RUAH 4E9VA 5F44A 4EI5D 3OB8A 3QZWG 4WFED 1ERNA 1INEH 2EP6A 2VDRB 4B96A 1CDGA 2BVPB 2IIJA 3X11A 1H0DB 3BRGC 3TEZA 5FGBC 4OF0A 1F42A 3H9HB 5K39B 5D7JA 5K93A 3BYYA 1UM5H 1BVLB 1C12B 1YYML 2HFTA 4PBWD 4J2QA 3U0WL 3SDXA 1IIIA 4DEUA 1RIUL 5D1XE 2QGBA 4CMMB 5EOCJ 1FHNA 3HHSB 4LLDB 3JWOH 3VXRD 2C7FA 3AROA 1QI4A 3UPRA 4XXCC 4NQDA 5GS1B 5J13B 3O9WA 4YSCA 1N26A 4YGVB 2VZTA 2HG5A 5E9AA 5FV1L 2JVUA 3MV8A 3TJPA 4PJFE 4L9LB 4JKPL 4AYFB 4DGYL 4BKLB 4Y9CA 1TSRA 3FUIA 3VFUA 3ATEA 4YBHA 1G87A 4BFJA 1I9RL 1ZT4B 4KROB 1JGDB 3ZSTA 5IEHB 4W9DC 3QIBC 3QDMB 3LQZB 4Z9KB 1CBJA 4EUPB 5JDSB 3BPCB 3HS8A 1JDAA 5GGVH 3T2LA 3PHQB 4FABH 2VLKD 1C8PA 3P73B 2FD6L 3QEGL 1M2VB 4LCVA 1NOAA 1U3NA 2Z8SA 43CAB 4F8TA 3BX7C 1JMXA 1U8NA 3QCVL 1N68A 4WFHD 1M7UA 3MBXL 3FO1B 3EOAB 1GZPB 5IMMA 4FF9A 4ZMPA 3W11D 4RFNC 4MDJB 5F1NA 2IDQA 3SCMB 3VYPA 4NO2A 4WGKA 5FHAH 3TURA 1UWXH 2VXQL 1N6UA 3NPZB 3R1GL 1GTNA 2FCBA 1OPGL 5IJCC 5AENA 4KI5C 5I74B 4U1IB 3WE1A 1KGCD 3TU6A 3MCYA 2CH8A 4O4YL 3GEFA 5AEAA 4FYTA 5IHBA 4C55A 1YLBB 2EO7A 4MB3A 3M6DA 1ZLUK 3CZNA 4K5NA 1NCDH 2GSMB 2L3BA 3N41F 3CFKB 3C87A 4IRJB 4RRPG 5EC1A 4QGTA 1ODAA 4IKNA 1VAHA 1RKRA 5LNEA 4Z5RA 1C5CL 3APCA 1KLUA 4O00A 4BZ2A 4MQ7B 1CGSH 4IOFD 2VDQB 3VI3F 5CEXA 2OJEB 2BSSA 3HG1B 1JZ8A 1G7QA 4H0GA 2H32A 4XX1G 3QFGA 1BZDA 2ZYHA 3QVAA 2ZOLA 3G6DL 5KVDE 1WYJA 2YMTA 5HGAB 2C3HA 5EA0H 3D0AA 1LE9B 1EHXA 1FYTD 1CGWA 1OY3B 2A7BA 2P3YA 4NQTA 2EIZB 1C7TA 3KEHA 4HH9B 2VZUA 3I74A 4Z0BH 3T65B 1OAZH 1YN7A 3V9CA 4W70A 3Q8CA 5EOQL 1CBVL 4L3CB 4M6MH 4JLRB 5JR1H 1IGIH 2YAPA 3K7UA 4IJ3C 3KYMA 3WTUA 4FZ8H 5HHXL 5FWQA 2YA0A 4WUUB 3V4LA 2FGWH 1X5LA 1CTMA 2J88H 3RKDC 5J57B 1RPKA 3BZEB 3QO1B 1KCUL 3EOTL 5T3ZH 4P2OA 3TJEH 1OZUA 5GGTH 1EZVY 2E4TA 4JHAH 2V5MA 1WQVT 1BX2A 3PFUA 4XN4A 5C0CB 3SYCA 3BUDA 5ESQB 2Y24A 5DT1H 3SGKC 2F5BL 3CFQA 1N59A 1R0AH 3OKLA 4OKVA 2X1QA 5GRJL 4R8WH 4YUEL 2R2HA 1MG3C 3KCWA 3L5XL 2NW3B 1R6VA 2ZUYA 5D55A 2FYYA 1NBQA 4PTUB 5CBEB 4AXWB 4DZ8A 1ZIAA 3Q48A 1NTDA 2Z4QB 3BKYL 3UZVB 4X9FA 2F18A 1CICA 4DEPB 2UZPA 1JGVH 1IVLA 4XNMA 1J1XL 3ARGD 3WEXB 4AQEB 2IV8A 2WKOF 1J11A 4P2QB 1M6OB 4WW2C 4YL4A 4OLUL 5HYJB 3BXNA 5SWQA 2UWEF 3N2JA 1RUMH 3GSRA 4PW9A 3TO4A 4E5XB 4KNSA 3KNBB 1B4JH 1TU2B 4GUPA 3FO2A 2OMYB 2NLJA 5FGCB 2WKLA 3ARYA 1Q38A 2HG0A 2NTFA 3EZ8A 1U91B 1L3WA 5DLML 2FTAA 2JK5A 3RVUD 1HQ4B 4MA3B 3KL5A 1JPFB 3GDCA 1BBJB 1FORH 4OCWL 3WFEL 3GK8H 3IGUA 1HHJA 2NR6C 5EIIB 5DD6A 3ZE0E 3JWDL 3FQ1A 4HPHA 5SX5H 4LRIC 1W9XA 4EI6B 5ECJE 1E4KC 4ZD3H 1ONQB 3NFPB 2R1WB 2WXKA 3AWEA 1NBVL 3KPSB 4C59B 1XGZA 4YVNA 2L7UA 2QSVA 3PAYA 2YA2A 5BCAA 3QXDB 1SXSA 2BSEA 3IMSA 5HHOE 1FG2B 2WZ6A 1J0JA 2OL3B 4KZEH 2WLNA 4MCZA 4OJFL 5HP5A 1UB5B 4JO5A 5D7IB 4NX0A 5I1CH 3J8F7 1IBDA 2ITDB 2BMKB 5IVZB 1H8SA 1RFDH 4Q6KA 2BS9A 3D52A 3C5SB 4YR6A 3K6IA 4Y19D 2BHYA 3EYVA 1UCBL 1IM9A 3TEWA 3AUWB 4A7QA 1BFOA 3MKKA 4TYUA 2AEQH 3WLBB 4F27A 3KPMA 4XGZA 4YHZH 1N12A 2W81C 2A74B 2WOBA 3L3DA 1KCSH 4L4TE 3DX8B 5J7CC 3UGXA 1E9OA 3HG5A 3OSKA 3EH2A 4KJPC 4LFHG 2EE3A 1NJ9B 1K85A 2JJVA 3VFGH 1O7SA 2JLLA 3QUKB 2PWDA 2Y7NA 4YSOA 3UC2A 3QORD 4D7BA 4LE8A 2DQ6A 4YBQD 3MLUL 5KVMC 1HL9A 1T0OA 2CCWA 3L3HA 3GQFA 4MJ4A 5D2NA 1HJCA 3RGVB 1FC1A 1NAMA 4WJ5B 4K23H 4LSVL 3AITA 1YQVH 1NAKH 1NIAA 3JWNH 4NBXB 3F6LA 5M95B 1WS7A 2CO4A 4NNXB 1CDIA 1KLFB 5JDJA 3K2KA 4PJEA 2E8ZA 1GOGA 5T33L 1KEGH 1F3JB 1NAMH 2YRLA 1T7XA 4JN1L 4M1GL 3SQOL 4X5WB 5DRNB 4AL8H 1ZA6B 1XSIA 3TBVA 1EMTL 3GMQA 5FO7B 1NFDA 4DEWA 4ZT1A 5JTWA 3OR7A 1A3QA 4ZX3A 2VDPH 2VLLB 1IC5H 3P2DA 1CE1L 4LSUH 3FUJA 3KPOB 2O5XH 2GFBB 1OSYA 1AO7D 5F1IA 2FWLB 4AK2A 5IR1A 3RWJB 4IBTA 1WJ3A 4JFDB 1KPVA 2DTML 3F2LA 4OD3L 1RIHH 2IMNA 1ASOA 1HNYA 2WJ5A 1KGXA 5D1XB 1T80A 3B3BA 4IRZA 4RQQA 2VXTL 3OPZL 4N26A 4CNIB 3NIGE 3QCUH 1SVZA 4HBCL 4JL1A 3ZE1E 4QNPE 5IV2A 1H5BC 1A3LL 5DJYB 3P69A 2Q8BH 2B9BA 3HUJE 3QW9A 1XT5A 5FGSA 2X6VA 3X12B 1HEJC 1R46A 3RU8H 3GSWA 4UQ2A 3QRGH 3RAJH 4PJFB 2VXSH 5L2KB 2OMUA 1IILE 1NDMB 1J0IA 3FCTA 5KWYC 5MP6L 5E2JA 4MRCA 1XFPA 4CJ0A 2XN9E 3DK2A 4U3HA 3BP5B 3T4AC 3T71A 2VRKA 4F3FB 4U6VH 4JN2B 4Q2ZA 3CSFA 3KZ8A 5JIIA 2FIKA 3QC5X 2OR9L 3PDGA 3GDBA 5EORL 3E3QE 3JQOB 4KDWA 3QS3A 3UIZA 3ZTJH 4LBEA 5IVXE 2NX5E 2ADGB 5TH2B 1BCIA 2EIMB 2EXWC 1HL5A 1PIFA 3U9PL 1MLBB 2E4FA 4XPBH 2FBRA 2IH8A 1J0YA 2IALA 2XXFA 1QSEE 1I1RA 2OI9B 1URLA 5DGQA 4L3FA 3WHE0 1E4HA 1BFVH 2X87A 1S7QA 2A6IB 1IM3D 1G4MA 3LEYL 3KLAA 5LCVL 5JLZB 1X4YA 1FQ9C 4PRNB 1FYHB 2DKSA 1A66A 3L17A 4JAMA 1TFPA 4MD4A 2E5EA 3E8VA 1BYOA 3RWGB 5L88L 3IXTA 4F58H 4JRYE 4K5OA 1RU9H 35C8H 3BH4A 1ZHLA 5GRUH 4IBSA 1T6BX 4Y16B 2B1HH 1S9XB 1I82A 2NY1C 3O3BA 4HPOL 2ZPKL 3IE9A 4CN6A 4B53A 4S2SA 2ALAA 1P4LB 3O45B 5KTEL 1HC1A 1WT5C 3DXAA 3L5HA 2Y6TE 3CTTA 4XAWL 1A4JB 4G6MH 5IB5A 2JQAA 1JERA 4K15A 3GXPA 1CL7L 2JJSC 4FJYA 1JYVA 2NZ9C 2UYLB 4TOYL 3SY0A 1ADQL 3ETBJ 1XIWC 1H3TA 5IQLA 1MHCA 4F93B 2VQTA 2YMXH 5EG6C 5F7NC 1UJ3A 3T08A 1T2QL 3T0XA 2WTRA 4XBPB 3D1MC 2FT6A 4YEFA 4Q9RL 2V2XA 3ARDA 3QIBB 2OCJA 3DX0A 5EEVA 5FGRA 3OKKA 3HR5B 3K74B 1DZBA 5ACLA 5LXGH 3WUWG 1CDYA 4PS4H 1N6VA 3WELA 3LKQB 3F58H 2D7QA 2E59A 1NMAL 1B2WL 3G08A 2EECA 5J4MA 4NN7B 1XGQB 4IKKA 1QNZL 4NCDA 1Y6NR 3O0LA 3WY3A 3KXFD 1RK0A 4JX0A 4U1SA 5HYSG 4N28A 3HW7A 3M7FB 1YYLH 3IU4L 4YXLH 4OB5L 3WDIA 3KPPA 2VL4A 2NY2D 3IKCB 4UV7H 2BCMA 3GMMB 3AB0C 5E99H 4DP4X 2XV3A 3IJEB 1NLDH 2B1OA 1UA6L 3EDEA 1MY5A 3NJHA 2F61A 1J8HA 5EWIH 5E2VL 3H9YA 3PUCA 1KYFA 2GVYA 2ILLA 3RWCA 3KMDA 3P3SA 1HYSC 5C92A 1NCCH 5CR1A 1TJIH 2BOBB 2DY2A 4KRMB 5DC2A 3CMGA 4BFGA 5K9QI 3P9WB 4JY6A 1Q94B 3F7QA 5GJSL 3T9WA 1BQKA 4XVJH 1JWSB 5I8EA 4HEME 2Z1KA 3QUYC 3G5ZA 3FQNB 4TRPL 1A64A 5D1ZI 1MCCA 5DVNA 1A6AB 3RI5F 3U82B 3EGSB 4P04A 2R9HC 4JMNA 3UJTL 3D85D 5HBBA 5D4HA 4IS6A 4N9OB 5E00B 4ANVA 4X5XA 4ABWA 1F4HA 1FIEA 2EDWA 1O6TA 2FJFB 4NUMA 1PG7H 4L23A 2HFEA 3NACL 3WFZA 5C1MB 3L45A 1BOGB 1ZHBB 4X6FA 2KZKA 3F65A 3G6JE 1TG8A 3V2AR 1USZA 3W0WD 1RSYA 4I9XA 3KEDA 3B37A 2R0WH 2GBAA 1IBHA 1YN6A 2D3NA 1MFDL 1MI5D 3LSOB 4RGOL 5T1KA 3EH5B 2JI1A 3VD5A 4QRUB 4CVWA 4HULB 3O4LD 3D39E 3MLYH 4LCCC 1BVLA 1C12A 1M1SA 4QRAA 3HE7A 3STZB 4GIAA 3EBIA 1D5BB 1UZ6F 1LVEA 2DMHA 4CJ1A 3WO3B 3OF6A 4TLKA 3RHWF 4E41E 4CMMA 3VGAC 4AJVA 3CDCA 2ZX7A 3HHSA 1MEXL 3ABGA 3AGWA 1A3RH 3MJ9A 3ARFC 4YLQT 1OAJA 4QHMB 3NSFA 4YGVA 3INOA 5G4NA 4PUBH 2O93L 1PLBA 5JIKA 2VMCA 2CR0A 3EFOA 1BPVA 4Y2NA 1LXMA 3MJ9H 1KWKA 4TVPD 1B9KA 5HHPA 3VYNA 3QK0A 3VXUD 1MCWM 5DA4A 3RQ3A 4Q14A 3VFTA 4HYTB 2AV7B 3IDNB 4GRWF 2AITA 3OV6A 1R4XA 5IEHA 4L4TB 3QDMA 3LQZA 3VXTB 4BXSV 4D9RE 4EUPA 5JDSA 3BPCA 1D5XA 2P80D 1E2WA 5A1AA 4IBWA 3P73A 3GBDA 2C7UB 1KB3A 5F8QC 5HDRA 4V1DD 4GQPH 4YFEA 3IGAA 5FYKH 1B0GB 3N42B 4BHUI 1INQA 5D1QC 2A9ML 4C8XA 3DUUB 4WUKH 1WWCA 4TSCH 3SYQA 5CLXA 3FO1A 2P49B 3EOAA 4IHBA 3FRUA 4XBGB 3QE5A 3ZTNH 1E43A 4U0RB 1DBKH 3HNTL 4OZGF 1A8ZA 4NQCE 4LZKA 4YDJB 3FTWA 4LESA 3GBML 3RWFB 4URTB 3NCEB 1C1EH 3R06A 4WY7H 3LKOA 4ORGA 2D0GA 2ZWNA 2IV9A 4RX4D 5GGSB 5CGTA 3UC0L 1JHTA 4U05A 2RIKA 3CXHK 5HDBB 1A6UH 1QKZL 4KKCD 1RMFL 5IQ7L 5B1JC 3RWIA 4HIEA 4IRJA 3CFKA 3S5YA 5CGYC 2XWTB 4G1MB 3JV6A 3NCYS 2R29A 1M71B 4GI6A 3FN9A 3HFML 2DJ4A 2AV1B 3VFSA 1CYXA 4L05A 2OJEA 1JZDC 1WWAX 2R56L 3HG1A 4HG4J 5IW6B 1SQ2N 5J6GB 1RSFA 2GIXA 1IB5A 3OPUA 4A7GF 3BPOC 5DFVC 1LE9A 2BWQA 1CF8H 5JZ7D 1E5AA 4I0PB 4WU5A 2EIZA 4MA1C 1XDYA 3RRQA 1T66C 4LLWB 2Q87A 1YMMD 3OQRA 3T65A 1JPGB 2DD8L 2Q7YB 3DOSB 4OIFA 3NIGB 3WY2A 3Q1SH 2X4NB 1OAYL 3KGTA 5I0VA 3NJKA 3HCVA 4L3CA 2QSCL 3L4CA 3WFCH 4OJYA 3SKNB 1J9QA 1O5PA 4ODWB 1TENA 3CIQA 2QTVA 4WUUA 4PBXA 1CTNA 3AU0A 4PJCB 2EZ0D 4NFCA 1A7RL 1XCXA 1ZVNA 2X12A 5EU5B 5I82A 1KTCA 3QO1A 3BZEA 4WW1A 4E9YA 4OZFA 1SUHA 4XAKD 4XBEL 1WBXB 4K7PY 4N2FA 2CALA 2MSPA 3ECUA 4Y4KD 5C0CA 2WSKA 1IBFA 2P8PA 3RTLA 2G4EA 5ESQA 3QULB 1JZ6A 3VD9A 4WI2A 4HC1L 4S1RL 4ZAKC 8FABB 1TF4A 1YMHA 1KB9J 3QAQA 4NQEE 2CRYA 3C08H 3PP3K 5DJAA 4PV9A 4OZFH 1G43A 2ZSWA 3CHQA 4PJ9D 4XP4H 2PYEE 5IVXB 2NX5B 5CBEA 4PLKD 3LZQA 4AXWA 2LVEA 1WZ1L 2DI9A 2Z4QA 4LHUD 2ICWB 1QLEH 4JRFA 2AZUA 1NLBL 1C7SA 1RL1A 3WEXA 4KKAC 1QSEB 4AQEA 5C86A 3MR9A 3QUHA 4P2QA 1MJ8H 4BQ9A 4PJ8C 1AKPA 4ABUA 1XSKA 2BVTA 2AQSA 3BGMA 4KXBA 2BSBA 4OVVA 4JFOB 5D5ME 1I8AA 3TIDA 3VRLE 5HYJA 1MW2A 3P9LA 4E5XA 1WH0A 4EI5C 4JFFA 4QRQA 5GHWL 1QHOA 3IPBA 1TU2A 3QDJD 2YLKA 5L6YL 2OMYA 3QUZD 4GEIA 4BE5A 4ANXA 2ZYIA 2KLTA 3WI9A 3FT3B 2E27H 3GNML 3RTQB 4HAFA 2FX9H 2A73A 2V17H 1SMDA 1ZIBA 3RUGF 3U0PB 4MA3A 1A9EB 1ZWIA 3D8MA 4JRYB 1T0PB 2AGJH 4NKIL 4WHYG 1X7QB 4H8QA 4UTAA 4WQOA 3TT1H 3VXQA 4Z7NE 2ZD0A 2QV2A 3MAWA 1AKJB 4XI5D 1ZEAL 2MNJB 3BVVA 5EIIA 1IAOA 4JFSA 1TYRA 1QO3A 4L1TA 4EI6A 4Z7WF 2XZAL 3TL5A 4XOCA 1H5BB 4NRZB 4DO4A 1ONQA 2W92A 2WQWA 4JEGB 5SWZB 3DOHA 4AENB 3KPSA 4NXKA 4XO8A 4J8RB 2ZWYA 4LL4A 1W6LA 3CC5B 1DUYB 3QXDA 1XF1A 5DMIL 3VD7A 4B27A 1XGYH 3BKJL 3CVHB 4NQVB 4UT6H 2P5EB 4Q8BA 2O5ZH 2ZAHA 1UB5A 3A4AA 5KVFH 2ITDA 2DQHL 4AUYA 4JKMA 4J3OH 4I4WB 3H9SE 3RDTB 3C5SA 3CHXA 4LOUD 4R4BB 4OJDH 3UOAB 2VABB 2OCCB 2EVJA 3OMNB 3O4OB 4FFZL 2ZKYA 3WLBA 3T0BA 4PREA 3OKNB 1GHFL 4MYPA 1XZ0B 2A74A 2DLIA 2VDLH 1UM4H 3N85H 1MHHB 4LMQE 4M3HA 4V33A 3ZDZE 4M93C 3CZLA 3ZE2B 1BM3H 5LBSH 2XVKA 1GGUA 4ONFH 5TQ0L 2MKWA 2VXUL 3WNPA 1NJ9A 4G7SB 2WLHA 1C5BL 2MMXA 3AZUA 2DWDA 3VFMB 3UTQA 3QUKA 3QUXC 4BV1A 1QRNA 3GPEA 1UKQA 3I50H 2JI3A 1R5WB 3OMAB 2D7NA 3S8WA 2X2HA 3EYFA 5DSCA 5KVEE 2J1WA 4X6DE 2DM7A 2AK4D 4DKFL 3IWVA 5HJBA 4HKJA 5ABAA 1G7PA 2E56A 3QI9D 3LJ3A 2F5AH 5D71L 1SEQH 1FRGL 3FQ4A 2R7EB 4R90H 3CZGA 4NO3B 1FZKA 1QSFA 3BIBX 4RMBA 3TBTA 5CKGA 1JGLH 3QH3B 4R7VA 3LKNB 4LPUA 5GGQH 4TNVF 4G82A 1ZA6A 5IFAH 2GCYB 5B1AB 5FO7A 1DQKA 1TVHB 2H6OA 3C5ZA 5JUEL 3IWUA 1GGTA 1PZCA 4ZTOH 3PRZA 1DVQA 2ISDA 2ENSA 4FRWA 1PVHA 4H8WC 1JXGA 4NZJA 5EU6E 3VH8G 4JFHD 1NINA 4YDMA 2B2XH 3ML8A 3SPHA 3OR6B 3OAUH 3D39B 5KYYA 3P30H 4F24A 2J1ZA 4M7KH 1W8NA 4JFDA 5I26A 2FWOB 3Q3GB 3VMOA 2ZCLL 4JJOA 1KIPA 3CMOH 5ERWB 4F8NA 5E51A 3UMNA 4JQIA 2LOEA 3C8KA 4MJJA 3CX5K 4UV4L 3U0TB 2Z31D 3CXDH 5DJYA 2B3RA 1EXUA 1QD0A 1RK7A 3LDBB 1PDKB 3Q44A 4X80H 1YEIH 2Z35B 5F7BA 5L2KA 2FJSA 1HZHH 2NPLX 2ZWZA 4OCSL 4UUJB 2VDMH 4N8VG 5CEZL 3DJ9A 4X50A 2ZSVB 5F3HA 4FTVD 3QIUB 1RP8A 4QKTA 2XZQH 3BP5A 3QFDB 1RUQH 2NXYB 3NJIA 4FLSA 4YPGA 5KSAD 4XNAA 4Y4FD 5C0ND 1GJWA 4JN2A 5FUOL 2VSDA 1BF5A 3MXVL 2W9DL 3ARGC 1XGTA 3QUYB 4A6YB 4RESB 5HDQL 4PWJA 2ID5A 5HI3D 5D7KE 2I32A 1IEAB 5T1JA 2DLFH 2O6DA 3A22A 4X8JB 2R2EB 5TH2A 3BSZA 1AR1D 4AM0A 1PBYA 1HVXA 3OLIA 1VFUA 4NUGH 2JJTC 5A3ID 2PCFB 1U8QB 1U3YA 2J2ZB 3L2LA 5AW2B 3RNKA 1U36A 1U95B 2HJLB 4QXUL 4QHKI 3O3EA 2OSYA 5E2TH 3LMJH 3N9GL 1T3FA 2XQYA 3CHOA 2A6IA 2B8OT 3FJTA 1TZHB 3BSZH 3FPXA 3GIZL 3I9PA 4NQCB 2DV6A 2OV0A 4BE6A 3QJXA 2J6EL 2CD0A 4TSAL 3FTGA 3MNDA 5ID0A 3QB7C 4M03A 3RWGA 3TYFB 2C26A 1AE6L 2X53A 4F9PA 4Y16A 1S9XA 3HG2A 4UCFA 1I9IL 4LDLB 1CF1A 4OAWB 3HNVH 1P4LA 5I5MA 3ARFB 3IJYA 3UTTA 1Z9OA 3P2TA 4XXCA 5HTSA 3ZKXB 3BPLB 4P4KB 3HFFA 3P02A 4J3BA 1XV8A 3VI4A 3MC0A 3QEQE 2WVTA 4K3DL 4MNHB 4BWWA 1KJ2L 1NGPH 4G7VL 3AM8A 5CJ5A 2OMVA 2XPGB 3LIZH 3UBXB 3FSAA 3QDAA 4PRPE 2ODIA 1M9WA 5FO9B 1MFBH 1G7HA 3HAEB 2G5UA 5LBGA 3CHRA 2I69A 4XBPA 3W39B 1M05B 5K9JH 1TQUA 3QIBA 3G04A 3V0WL 2E47A 1DEEB 4LKXB 1UWFA 4FQ1H 3LS4L 4GXVH 4GW1B 4NRYA 1T1WB 2FQDA 4R97B 4W9LC 5D9SB 1SNRA 1E9PB 3HR5A 4QHLB 5DZVA 1YY9D 2F19H 3VXMB 1TVBB 1JOIA 2ZOKB 1ILSA 1JG9A 3WEOA 2I5YL 3FS9A 2X3AA 4GG8B 4I7ZC 1XGQA 5KAQF 3QORC 3SJVE 1U8OB 4YBQC 3O3DB 1PNCA 1UGNA 2X6BA 3MCLL 3ZDWA 1ASPA 2DWYA 2H3NA 3FXIC 3PIQA 4KO9A 3RIFF 4UB0H 3UTSE 3CPLB 2ZG1A 3V7AE 4OGXH 2V6HA 2OTWA 3GMMA 4BRJA 4KPHL 1SHSA 1OB0A 5BV7L 5DRZB 4Y2OB 5EEXA 1V3LA 1HK6A 3QAZC 1MCNA 1V54B 2YAMA 1NDGA 2EYRA 3T8VA 3QUMA 4HOMA 1A25A 1PG7X 3MQIA 3NBNA 3EHBC 4Z77B 4GMSL 3T0WA 1CJYA 4M4RB 3DOIA 3ULVD 4YSQA 3WYRA 3MNMA 2F1BA 2VR7A 2YSTA 2XOTA 4OBRA 4IGBD 2P24B 5T3XE 5EOTB 5D5MB 1PPIA 3DYPA 4LCYB 4U3SB 3FYIB 4HDIB 1PL3A 5DEGB 1TQWA 1GAFL 1MHPH 3AG3B 3GKZA 3QUMH 4GPVA 5TE4L 2Y5EA 5HYQB 5JORA 4EN2A 5IBUG 4UT9A 4Z7UE 2FO4A 1FO0A 5IK3A 1N70A 5BO1H 1NANH 4CKVX 1ROCA 1RJYA 1MUJB 2FJFA 3FAWA 1GJIA 2WKGA 5EH1A 5HYIA 1BOGA 4MA1B 4N3UA 5H8DA 5HHVH 4MA7H 4Y5XC 1Z9SA 1I7RB 2E86A 1YJDL 3OKOA 1B2YA 3SYAA 4MNGE 3CLWA 2Z8VC 2EXYD 2PWFA 4UT9H 4X6BB 1FO0H 5D7LA 3MRBA 5JYLA 5JIQA 5KVGH 4RVBA 5DHEA 5EFIB 3KH4A 4XN2A 4QRUA 3U2IA 3HRZB 3UGUA 4PJAA 3D4ZA 3S37H 3STZA 2J8HA 4MLSA 2YD3A 5K1JA 1INDH 1W0VA 4F8PA 2WO2B 4LLQB 4RMVA 2ZCHL 4KFMA 9PCYA 1EJOH 1KJVB 3VD1A 1IBGH 5B21A 4JO1H 4JY5H 3UAJD 3SGKA 1LE5A 4YK4C 5CMAB 4YSRA 3MRFB 4FEMA 5I1EL 4GP8B 1W72L 3BLPX 3QJHA 3TNNA 3PJSB 5DURB 4ZUWA 1MSPA 4OD1L 5KW9L 1CGYA 4B9ZA 3DO7B 4WNQA 4L8CB 1KFAL 2YA1A 3THMH 2N01B 3H3KA 3H9SB 1P4BL 5FYLE 5E95B 4GQ9L 1LEGA 1MCPL 1R3IL 1BWMA 1XZWA 2IBGA 4ZG1A 3CBJB 2VR4A 3FU9A 1BQLL 2AV7A 1FP5A 3IDNA 3LNHA 4JFED 3OKMB 2F58L 4WW2A 5F9JA 4KOCA 5F0JB 2BVEA 2D8KA 1KJMA 4AM0Q 3TCLA 2OTUB 2YEVB 1QHPA 3NCJL 2C7UA 4UQBA 1DVTA 1VCAA 3GGWB 2F2HA 2VTFA 2VC2H 3MLTB 5F88B 5LWYH 3RYMA 1SBSH 3CWGA 1ZE3C 2YPKB 3U79A 3CDYA 4PJIB 4BK8A 3NZ8B 2GC4C 2XWJA 1YNTB 2V0AA 3V0AC 4XBGA 1M9SA 1U8KA 1AD9A 4XPAH 4LRIA 1E4KA 5L4MA 2VZSA 1HINH 4PCYA 3RWFA 3QCTL 1PAZA 2BNRB 4HK3J 4PBVC 3V4VB 2YAQA 4WI6A 1WAAE 5ACZA 5C0BD 5ICZA 2XLLA 2YD7A 4PJDE 4N2DA 2NY5L 4KMTH 4DERA 2WUBL 4FQQA 3FOMB 2VH5H 1SYVB 4OQTH 2XWTA 4AH2B 2XA8L 4G1MA 1FIGH 3ZYOA 4M62H 1CFSB 5EU6B 5SWSE 1AQMA 4R2GD 1U8MB 5F7LB 5IFJA 1BMZA 2AV1A 2R39A 5ETUB 5IW6A 3ZKMD 2JELL 3D2UD 4AMWA 2YJQA 5F71A 4KUZH 3B56A 1DN2A 4U1MB 3AADB 1PY0A 2FGZA 4EZLA 2RA1A 1WPCA 3M88A 1RZFH 1D5IH 1DQLH 1QLFB 4RFOH 3L4TA 3OAYK 1UEMA 3VXNA 3I75A 3D9AL 1UHVA 5DFWH 3P11H 1Y1DA 3CE1A 3O6ML 3DOSA 3QYCA 4P5TC 2WZPA 2X4NA 3DGCR 1CFVH 4JM2B 3VNZA 3CLEL 4CC4A 3V79C 2JCCF 2OSWA 1ZVHA 3KM1A 5ALCL 3TPUA 3VDCA 4G9FD 4M93B 5DD5H 1PZAA 4PG2C 3MJGX 3SKNA 3LVEA 4NUQA 1G9HA 2FX7L 2NY2C 2DQIH 2Y72A 3FAXA 3K4DA 3CUPB 4PJCA 2YPVL 2CK0L 1KIUA 4X9GA 1IC4L 4M43H 1U3HD 4M7LT 1I8MB 3BKML 5JIMA 1DVFD 3EKCA 4HK3N 4C56E 2BHUA 1O9WA 4HSQA 4PGDB 1WBXA 3MUHL 3X14A 1KNOB 1OAUL 3WV0A 2XY1A 2WANA 4OFDA 2WQXA 4GFTB 4KKPA 4M7LH 4QY8B 4WI5A 5DJXA 5KJ4A 3QS2A 2I85A 5I8OL 4ZNEE 2MRYA 3ZZLA 2AK1H 1P5UB 3WEMA 3DX2A 3DO4A 2X4QB 4K9EH 1U92B 5GZND 2X1PA 4Z7OB 2JKLA 3O2VH 1GW6A 1M3IA 2IJ0C 1NCOA 3MUUA 5E8PB 2ZF9A 3V4UL 4FHKA 3GSNA 4TUKH 4ZMOA 3BVNA 5IMKA 3WU1A 4FA8A 1J9TA 1ZSDA 2WYTA 4KNTA 4QTHA 3ZGIA 1NGXB 1KYUA 2HFGL 1UWEH 3PP4L 2FZ3B 2XPZA 3FT3A 4C4KT 4G70B 5KYUA 1DQML 3GSNH 2RB8A 5F7UA 3U0PA 1JHKL 4K07A 4APQD 4D0DB 4JRYA 1E4WL 1JV2B 1U6AH 2CIKB 1RZPA 1X7QA 4Z18A 4YXKH 4HT1L 1HKLH 1QTPA 3GSUA 2XU9A 3WTTA 3JV0A 5BW7C 1H5BA 1L7TH 4MMZC 5SWZA 4GBXD 4AENA 2OPCA 1H8NA 4J8RA 3GHBH 4L37B 2YPLE 3P3YA 2BM3A 3U30B 3UYRL 3BAKA 2DMGA 1RURL 3SDYL 5TDOB 1F45A 5EMYA 2RALA 4PRPB 1TJGL 4WEMB 1XAKA 4NQVA 2P5EA 2J4WL 3J2PA 3FT4A 3K0YA 2B77A 5CZVL 1TTFA 1MJJB 2W60B 3QPKA 5DS8B 2IAMB 5K59E 2EXTA 2W07A 4FDWA 1U3JA 1NMBL 1Z3GH 5FK9A 4I4WA 1R3JB 4YDKL 3RDTA 1P9MC 3QA3B 1A02N 1IQWH 1COBA 2XWEA 4WWOA 5FS5A 1GZHC 1G6RB 4LT7A 4Q0XH 1WS8A 3ET9F 3QDGA 3PFQA 3C8HA 4HHAA 1K5NB 5FKAB 3VWKB 3CSGA 2YAEA 1XZ0A 5I17B 3GKWL 2VW7A 4OLVH 1MHHA 1XBDA 4N1CA 4NBZB 4DP5X 4FQXB 3UTSB 3OWRA 2JKNA 1RJLB 2XSKA 1WZAA 2DIJA 4L1SA 4QRBA 3GZPA 4AUUA 4U31A 3BEVB 5TE6H 1LNUB 3QNZA 4G5AA 4JKNA 5MEQA 1KDJA 3CG8A 2WINA 5F1SA 3T09A 3U1QA 3NH7L 4YLBA 5I73B 5MHSD 4OCMC 4F5CE 1BQUA 2P5WE 4OGYH 1ZK5A 1FL3B 3FFDB 2ADFH 5AZ2L 5KSVA 1RQ5A 5CCGE 2Z9TA 2XG5B 1AI1L 2QPDB 2J1XA 3N1GC 3STLA 4KKCC 4JVUA 2DRUA 4FMVA 2FRGP 2R7EA 3O6FB 2EUZA 1WT5A 2UZXB 4NO3A 1QSZA 1IKFL 2AJUL 2QFRA 4Z7UB 4Z1PA 5GISL 4ZO7A 1LO3H 3CNKA 3QH3A 2JJSA 3LKNA 5HHNB 3SPJA 1JNHB 5CEYA 3FO0L 1UT1A 1JV5B 3WMQA 3WNNA 3SKOB 2GCYA 2BOCA 1MPAH 2FO8A 1JF5A 4PP2B 1XIWA 5E08H 3QHZH 3RZCB 2JTYA 3JXAA 4MNGB 3IDXH 5IM7A 2Y3NA 5JHDA 2HWZL 1CFNB 2VDQL 2EILB 2HAZA 3FTZA 4KMQA 4WI7A 4LLMA 4NOBA 4KTYA 4E0RB 3GXIA 5I66B 3NABH 4BCZA 3FRPB 3RA7L 5FUZH 2Z7WA 1DQJB 3Q3GA 1F90L 4HXBH 3LXAA 3ZRFC 1SFDA 3GT6A 2V5RA 2R8SH 4MZIA 2KS0A 5I1KH 2VZVA 2XIDA 2DQJH 3GSQA 5DJ0B 4JB9H 3L4WA 1J05A 5DJ8A 4J27A 3SDCB 2X4SB 3BZFA 4Z8FL 3FCSB 5CWSA 4H20L 3TV3H 2VQ1A 3PUUA 5HPOA 4W6XB 4AI7A 2ZSVA 5JHBA 3QIUA 1ET8A 1XTMA 4PLKC 1V55B 3EHBB 8CGTA 4WEBH 1A4KB 1ETZA 2X4RB 1BGXH 2J21A 3HNSH 3TEUA 4A2GA 3ERXA 2FBOJ 5FECB 5AZEL 1MNUH 3T1FB 3QUYA 3CGTA 4A6YA 4AV4A 4AYMC 1WFNA 1AR2A 2K0RA 5CS7A 2J3SA 2I07B 4F8OA 2XETA 3NCXA 3OMZA 3VQ1C 1S5IH 2OM5A 1NEUA 2DQEH 1XSOA 5DEZA 2R2EA 5BNXD 3QUZC 5ABDE 2RQ8A 3U4EB 4K2UH 1T83C 5DD1L 1DLFH 1BZ7B 4FQCL 3JV4A 4X6CF 2AHIA 1PCSA 4KBPA 2CDGA 4KRPB 5T1DH 1NUGA 2KZ1B 3FL7A 4XI5C 1ZA3A 1TZHA 5AB9A 5E6ID 1GOHA 5HDWA 1MW0A 1ODUA 3KCPA 4BSWA 4KTDL 1ORSB 1DBJH 2UWEE 4MBRA 4LCCA 1AZZC 3WNKA 1BBDH 3V0HA 2QSQA 1BMGA 1RVFL 2C9QA 3FCGA 4PJDB 4WWNA 4LP4A 4EDWH 4GUCA 1TZ8A 2VLRE 3CN1A 4PBDA 3D18B 2DJMA 1U8HA 4MMXB 3ARFA 4CN1A 3LB6D 3RBGA 4HCRA 4BFBD 2EIEA 1UT9A 5SWSB 3I6LE 3NCFB 4P4KA 2AQ3A 1E3FA 1ACYH 3FK3A 4HBQA 5HI5C 3TA3B 2V7HB 2G9KA 2ROYA 3R19A 2QHRL 4R5VA 3V52L 1QW9A 1XGPB 4LOUC 1JTPA 2ATPB 1P6WA 3KLKA 1KIQB 2XV0A 5F7AA 4OZIF 4EN3B 4HCRH 2HJKB 4GAAA 5FO9A 2OL3L 3JWNG 3HAEA 4XCCL 1GRWA 4Q6YA 2WBJB 4HF5H 1YRKA 2WOYA 1Q8MA 4KKNA 5GGVY 4YE0A 1M05A 5KVGE 5E56A 5MERB 4LKXA 1DEEA 1IAIM 1XHHA 5D9SA 3VQ2C 4BFIB 4GW1A 2EIKB 1A1MB 1T1WA 4JHUA 3RPIB 1BYPA 1E9PA 3RFZC 4YN3A 5I9QB 5E1QA 4QHLA 3O0RH 3VXMA 1TVBA 4P99A 2IQAB 2ZOKA 1TJHH 2AKRA 1UXSB 2D4DA 4KKQA 5D1QA 3T3ME 4L4JA 1U8OA 2YGOA 5AKTA 3MXWH 3DO3A 2G9HB 4UF7C 3ZQXA 4UAOC 2X2YA 5IESH 3BN3B 4LQFH 4N5EC 3QHFH 4J7RA 3CPLA 1B88A 5E9DD 1SY6L 5E9NA 1JSYA 2BIOA 3QI9C 3U46B 5DRZA 2J1YA 1LQBC 1EPFA 5DHVB 3CFNA 1UA3A 4AIOA 3S88L 3PQYD 4U1KB 1AACA 2HUEA 4PVNA 3P40A 4BK5C 5HVFB 3IN0A 4XC3H 3KWXA 4LCWD 4PV8B 5TFSL 2JKSA 2VSMB 7TAAA 4K5PA 1UVQB 2BRRL 2Q10A 1SLXA 3SY6A 2ARWA 3NTCH 5B1JA 4HIPA 4BZYA 4C4BA 5J89A 3AY4C 4P5KB 5E8NA 1BEYL 2L7JA 2P24A 4XMXA 4NM4H 4U3SA 1S2EA 4HDIA 1CXHA 2NY4B 2PCPA 3MJ8B 5CUSL 3H3BC 3KLHD 3MRLA 4AQ1B 5KZCB 3S37X 1ZLEA 1Y6KR 2ZXWB 3AREB 3HC0B 1MUJA 1UH3A 3ARZA 2VYRE 2UZIH 3IFPB 4LXFA 1I7RA 1I1CA 1S4IA 2R0KH 2IQ9L 4XNUL 4F9LC 4KK9D 3QEHB 4BFKA 1LO5B 2HUHA 1E40A 3QNXA 4W9CC 3WJMB 1XF2B 5TF1H 5FO8B 4OSUH 3HRZA 3GBLA 3CIAA 1BVKB 2A99A 1EAPA 3ZTJG 2FR4B 4ZOEA 2F53D 2PO6B 4RAHA 1ZTXH 2NXZD 4YNYB 1EFQA 3SEPA 3GUFA 2WNKA 3ROOB 2BZ7A 4NI6A 4XR8C 3T77A 1KJVA 3LRGA 4ZFOA 4I3RL 4RISH 4HHGA 5EF2A 5EU7C 2AZAA 4R4FH 5C0NC 1DBMH 4XXWA 4AQAA 4Y4FC 4ZAKA 5KSAC 1AS8A 2EYSB 2CGRH 3PJSA 2PW1B 3D0VB 3VXOB 4CBPA 3DO7A 4E68A 2JXMA 4E9TA 4CADA 4PR5B 5DJZB 4IMLA 1JPSL 5HI3C 3LZFL 5E4OA 1BIIB 1FPTL 2BHFA 4XMUA 1AR1C 3GSXB 4NM8L 2H2PD 2WMPA 3HE6C 3HZVB 3QPXL 4L18A 3KR3L 4J3TA 3D87B 2YXMA 4LIQE 2WYIA 4H1LA 1MRDL 3BUYB 2FX8H 4PJ8A 3E0GA 4BFFA 1KCWA 4UAHA 4UQ3B 1CLOL 2HLAB 1FFOA 4OW6A 4IRSC 5A2FA 3O6KH 5CJOH 2OXGB 2DQFB 3U7AA 4OCXL 3GGWA 4Z78B 4WDIB 3I2CH 5ISZD 2I60L 5F88A 5F89B 2P5WB 2YPKA 3IYLW 4H1LH 3Q9PA 2Y36L 4IK7A 4PJIA 4C83A 3NZ8A 3FTYA 1E42A 1YNTA 2KMWA 3DVIA 3A6CL 4XC1L 1XWVA 1DDHA 2YUZA 5F3BB 5LAPA 2OULB 3Q2LA 5J6HB 2DDQH 4YHKH 4KHTL 4MMZB 3PABB 2BNRA 1ACXA 1G9ML 2PW2B 4S0HA 1I7UB 3B9DA 5LGJB 5FA3B 2HVJB 1UJTA 2ADYA 2ZWLT 2EDFA 4JPKL 3I6GA 4O02L 3RVTC 3SE6A 5DZJA 3FOMA 3T2NL 2DYPB 1SYVA 3IDIA 5ALBL 3T8XB 4P4RA 1M7DB 1QAWA 3PHSA 4BCYA 5AVXB 3N41B 4QI3A 1CFSA 5DS1A 1HQRA 4PJHA 2VJ8A 1H8OA 5ETUA 5ITFA 3QXTA 4I77L 1ZPLA 3L7EA 3PGFL 2ZAIA 3NA9L 4WFFD 5D7JD 2XC8A 1U93A 3VI3B 2EE0A 3AG4B 4NLHA 4QUOA 5CD3A 1GS7A 4ETYA 1BAWA 1YY9C 4RWHA 1XH0A 1KSRA 3LRSA 1Q9KB 4YE4H 1LO2L 4ODUB 4P9MH 4J4PA 3OG6B 4M61B 4P46B 3SE8H 3GXUB 3L3OB 1OP5H 4EXPX 5BUGA 1UFUA 1N6QL 2PTVA 1EEZB 2O30A 2PKDA 4HP5A 4QRTA 2W8CA 2GJ6B 1MFEL 2NY7H 3O9WD 1CFTB 2YN3A 3EF4A 4EIGB 1N4XL 1IZKA 3MV8D 1BPLB 3MKGA 3QUXA 1I8MA 1SDAB 4PPTA 5I1LB 1MJ7H 5DK0B 4PGDA 1FAIL 3OGCB 4HFUL 4IKIA 3IF1B 4OCYL 4AY0A 12E8H 1W80A 3QPQD 4PJ5D 5BOJA 2OQJA 1Y6MR 1UM6H 3LOWA 3ULVC 2YAOA 3K8MA 3FHQA 1U8CB 4IGBC 4I5BA 2OMBA 3FB5A 4N0CD 3VG0L 2JMRA 1U92A 2CKBB 5IWLC 3SO5A 4XNYH 3DX9B 3B9KD 2WXQA 1Z5YD 5E8PA 1MCLA 1FI8C 5T5FA 3DROB 1FYTA 4LLUB 5IOPB 4OF3A 3NZUA 1TMQA 4XPHH 3FSVA 4AYID 2XFGB 2VLJE 5I1JH 4YSTA 5I76B 1FA4A 1A7PH 4J6RH 5F7EL 1K8DB 3HB3B 1EJFA 3BWSA 4GRLD 2UWEB 5I2IB 4FEIA 3VW3H 5JOEA 3V6BR 4NWTH 4NS0A 4NKOA 1GIGH 1X7TA 2PR4L 3NJLA 4MS8D 1JV2A 4D0DA 1CDUA 2CIKA 4LPXA 4NC0B 2X7LB 4H8WH 4UQDA 5BUPA 3OKYA 5J1AB 2H0JA 3VSUA 1VEPA 4YXHL 1WV7T 2VLRB 5E94B 1FDLL 2C1OB 2PTTA 3AMLA 1T21A 2YXFA 3EO9H 5C08B 3UAJC 2D03L 3VG9C 4UNUA 3SOBL 1IMHC 3NSYA 4FFWC 4L37A 4GI9A 4B9KC 2XWRA 3IMVA 3QJSB 4WWID 1UT2A 2CJSA 3K6OA 1CVRA 2GYSA 4ELME 1MAJA 2XWBB 4GLRH 4ZDHA 1I1AD 4EUPG 4EE2A 1MJJA 1H3PH 2W60A 3I02A 3B7SA 4UZGA 3ARGA 3OD3A 3IDGB 3KPQB 3UTPD 2B14A 3ZSSA 1XCTB 1R3JA 1HHGA 3MLSL 2DWSA 3ARVA 4KQ3H 1PQZB 4ZZFA 1JPTH 2EEFA 2VDKH 3IBEA 3T8MA 2EDNA 1KF9B 3AXLB 3G6AA 4L5FL 4A39A 3LN5A 4F1SA 1A65A 4P2OD 4Y9EA 5FKAA 3VWKA 1AJ7L 2X05A 5JPNC 5JQ6L 5C9KA 1G7JB 2A6JA 4JRXE 2YXVA 1R75A 1IC0A 4WU7B 1P84J 1SGKA 2HKAA 1RJLA 1CLZL 4HK0B 4L29A 4LSPL 2VDNH 5I6KA 3NCWA 3FH8A 1LDSA 2WXHA 3CFEA 3FFCD 2ENJA 3SGJC 5CINH 4A2HA 2NY3B 5EBWB 2QR0B 1GJUA 2ZIDA 1Q0YL 2UY7B 4U49A 3FFDA 2M2DA 3S96B 1ZT7B 4TVUA 1GS8A 2AJVH 2GPZA 3CJJA 3PNWB 4DOHB 3L3GA 2XG5A 3MBEB 4JL2A 5I6LA 3UZEC 4XP1H 3JWDC 5IG7B 4P57B 2L0DA 2JI2A 3EXLA 2Q76A 1KENL 2GIMA 1S78C 4R2GC 2X5PA 2H2SD 1TETH 2XQYK 3QQ9D 3D33A 4HV8B 4LPTA 1KELH 1JNHA 1A0QL 5A2JH 2P45B 1XR9B 1MVYA 1VIWA 1PKQB 2CLRB 1YPZA 2IOMA 3DWTA 1EO5A 5HPMA 4M48H 1UB6A 4F37F 3K6DA 4ZSOB 5IROA 1EAOA 4XNZC 2C34A 4KMLB 5DTFB 3SO3C 3W82A 4LNVA 2VAJA 1T0MB 1OANA 3GMOB 4MX7B 1Q72L 3HMWH 3EJJX 2APVA 2V3FA 1OPOA 4P3WA 1CFNA 3X1GA 5CBAB 3VD4A 3B2VL 3K1DA 3N40F 4OZFG 2VOTA 2Q86B 3RIKA 4HJJH 1RUKH 5I66A 5FLUA 4DH2A 1ADWA 1DQJA 2WLYA 5BOPA 4H26B 1OLZA 2BSED 3ARBB 3QORA 3WFDL 2R0LL 2OMWA 5KANG 1ZXKA 2OW6A 3FQTA 5CJBA 3ZT6A 3ULUD 4AOFA 1WISA 3EFFB 3L2NA 3MRCB 2CMRH 1H15B 5AUMB 3SDCA 4QHUA 1Q9LB 3S34H 4IOIB 4KNUA 4GKZB 3O2DL 3FONB 5GZNC 1EV2E 1ID5I 1TQBB 3ML9A 3R8BB 1OWRM 5INDA 1CG9A 5FOBB 5AVUB 4EOWH 2X4RA 2ENQA 5I6NA 4DPRA 1E90A 1WIOA 3CFDB 5CM1A 4IKJA 2D7PA 4GSDH 3PDOA 1NC4B 3NDYE 4JDZB 3SYPA 4CVUA 3NIDF 3GLDA 1GC1H 5CKAA 4GQZA 2ZKHH 1PD0A 5JW5A 1OQOA 1E3ZA 4HX1A 5EIIG 1FH5H 3II2A 2B0SL 3EJZD 2DMCA 1C5DB 4APQC 4KKLD 1WUNT 4Y5XA 4UOW0 1OEZW 1TZIB 3NA4A 3SYOA 3MGOB 4X9HA 4Z7QE 4GH7B 1SXNA 2R4SH 1KDIA 4L2LA 3DVGA 5D7IF 2ICWI 4LCUB 4J3OG 3EDFA 1FVEB 1RI8A 5IUSA 3NJGA 2LLNA 2Q2LA 1UOKA 2YXWA 4FQHB 2EEDA 4GBXC 1X5ZA 3RUGE 4YO0B 3ECVA 1D6VH 5B4MC 1S5HB 4H25B 1FE8H 3IFNL 1HHKA 1I3GH 4BYHA 1OM9A 4XVTH 3L3KA 2NMSA 2BNQB 3CHSA 1IZJA 3NQKA 4PB9L 4Z7WE 2VZ3A 3MX0A 4LEOA 4RLDA 3TA3A 2V7HA 4DCQB 2FBJH 4Z0XB 2G3ZA 5FB8B 1I1YB 1SM3H 2E7BA 3AABA 4JZJC 1XGPA 4E9LA 2ATPA 1KIQA 3CVHL 4P2RD 5FM8A 4EPSA 3HE6B 5MENE 1F3DH 1FFQA 4WWKB 5AYQA 4KXAA 1N64H 1NEPA 1INEL 2MCAA 4LQ1A 1BV8A 3RPIA 1A1MA 5DZOA 3VFRB 4BFIA 2ARJB 3P77B 4IRSB 1BQRA 2FHBA 5DVKA 2BFVL 4UDTB 4NHCH 2B15A 4MB5A 1UM5L 2C4FU 5H4YA 5BZXA 3IB4A 1UXSA 3MRIB 2E76C 4Y1AD 1ZTXE 3JBG7 3EDDA 4YIQA 2GSGB 2YRBA 3ARPA 4MVBD 4QRPE 2FHFA 4PCKA 1CXKA 2CHNA 5C0EA 2G9HA 2E7DA 5FFGA 1XXFC 1HCVA 2AVGA 2BIHA 3JWOL 4IHOB 3RIAF 4G8GE 3U46A 6PCYA 4XZ4A 3NEEA 4GXUM 1OCRB 3PV6A 5DHVA 3WD5L 4G43A 1ZE3H 4U1KA 1E8XA 2YR3A 1WBZB 3U36A 4PV8A 2G5RA 4YC2B 2XRAL 3QNYB 2EUVA 4H4NA 1G7LB 1UVQA 3FDWA 4C54A 1DANT 1GVIA 2OBGA 1GGIH 1X9QA 4RGND 1ZKAA 1EEYB 5D96C 2P42B 3FN0H 1T6VN 2YWZA 4BD4A 1LEIB 3KGRA 4C58B 2VLJB 5BZWB 4Y2LA 3X3FL 2FEEL 4U1LB 4JRLA 5C0RH 4ELKB 1PTZA 2NQCA 2R0ZH 2IFFH 1YEEL 4FABL 1MG2C 3AREA 1THAA 3HC0A 4AX3A 1ZHNA 1JP5A 4N5UA 3H42L 4DVRH 1R24B 4XCFH 3GJFB 1CO1A 4XN5A 2EXSA 3L08A 4P5TA 2VR9A 1SYSB 3EYQD 5MEOB 3D4GA 3KXFA 1HHHA 2D73A 4FNUA 3U1SH 3WJMA 1XF2A 3VFWB 5FO8A 4W6YB 1P7KA 1BVKA 2MCPH 2FR4A 2EADA 4NPYA 4XTRD 5T1LB 3O3UN 4DO6A 1M4KA 4QR7A 2VUKA 3B83A 2WIIA 3L3IA 2D0HA 3ROOA 4D8PB 4ELMB 1LP9E 5DRWA 3BDYH 1NCDL 3VXRE 1I9JH 3IFLL 4KO5A 5JW4R 2IPTH 2CO6A 3LEVH 2PW1A 3EDJA 3J7HA 3NAAH 3BWUF 1CGSL 1NPUA 2W59A 4RDQG 3ARWA 4YDIH 5DJDB 5DJZA 4XVSH 3L6FB 1T6WA 3RY5A 2XI9A 3UL4A 4Z76B 4J3UA 1IGMH 3BUTA 3DBSA 5CJQH 1F58H 4NGHH 2XQYG 4MQXC 4U2ZA 4B9PA 3PWNB 2Q1EA 1MZYA 3HZVA 3PHOB 4BM7A 4WKZA 1XAUA 1OAZL 5D1ZC 1Y1UA 1HJBC 4JRXB 3BUYA 3ZQ9A 4BGLA 2VE6B 3FO9B 5IEKA 3W1ZA 4UQ3A 5E0FA 1NCHA 1JVKA 4M6ML 4JY4A 1ACZA 2B08A 2VLKE 2BCKA 4F7CB 2DQFA 5E6IC 2XWXA 2YD4A 3QJOA 4FZ8L 4Z78A 2C9UA 4WDIA 3R4RA 3W9EB 1J8HD 1IEBB 5CZXD 3LH2H 2J88L 4KNQA 3SBWC 5H35B 1RZIA 5T3ZL 3TJEL 1T7ZA 5GGTL 2BY3A 2X2IA 1BVNT 4JHAL 3TASA 2ZYRA 1B3IA 1PX4A 4M7JL 1QLRA 5DT1L 4KDVA 5GGRB 5BW7A 1R0AL 1T4WA 1DQDH 4MMZA 5J6SA 4R8WL 2F54D 1D7FA 3TBYB 4TUJB 4HQQH 4JCMA 5ANHA 4FNSA 5IQMA 1DQQA 2HVJA 3II3A 1KCKA 1S8DA 5GSRB 2O61B 3F7YB 1JNNH 3OJDB 4KVCH 4R83A 1WWBX 4WCYL 5FHBH 4ZMLA 2VWEE 2DIEA 4LDCA 3S3JA 1EIBA 4BFNA 1JYXA 3T8XA 1JGVL 3F5WB 3K72B 2MTAA 2HFFA 3VXUA 1J86A 3KGSA 2HVKA 4BKTC 2JCWA 4HS3A 4RAUB 3VWJC 3BPNB 1RUML 2AAVA 3HN3A 1P9MA 2NUPB 1UH2A 3AU1B 3VI3A 4NQXB 1HEZB 2P80A 1A1NB 1GPOH 1GZHA 1QEWB 4K71C 3UP6A 1ECZA 1QTSA 1S9YA 4I1RA 3IGLA 1VFAA 3OF6D 4QO1B 4QXTA 4TVPH 3LHPL 1BYNA 1FORL 1Q9KA 2O6EA 1AHKA 3MBWB 4ODUA 5BS0B 1MCKA 3GK8L 4M61A 2WUCH 1CZ8H 3BW9B 5EZLB 3MOQA 3UBXI 3H6AA 3VXPA 1TTRA 2BINA 2GJ6A 5CCHE 5AQ0A 3V0IA 1C9SA 5JMOC 1E8ZA 1IEHA 1YZZA 4K3EH 2FLMA 5JHLL 1X5YA 1EUUA 2BP8B 2QSTA 5D2LE 1YDPB 4ZPVB 1S9WA 2IOIA 3OGCA 4MNQB 3FT1A 3IF1A 4RX4A 1KXVC 3GF8A 3UJJL 1H19A 4ACTA 3ZHFA 3K71B 1OZTG 5B39A 1PSKH 4HIIB 4LL9A 5BRZE 1MFAH 4KZEL 4QRRE 2OR7A 4MSWA 3GS0A 4KROD 3ZE0F 2XKNB 2APTA 3IXAB 5ADPL 2GBVA 3QDMD 5I1CL 3HZKA 4WV1C 3S3CB 1SXZA 3I6KB 1RFDL 1ZV9A 2MHAB 1JZEA 3KLHC 3N50A 4PRIE 2V9QA 3WIFA 1HCZA 4AITA 4UILH 4FCAA 3CBKB 5I30H 4DN4H 5I8CA 2EDXA 4LLUA 4P8QA 4LLAA 5J9PB 2AEQL 1IGJB 3BAEH 3M17B 3PGDB 4A7VA 4YHZL 2H8PB 4ENED 1YMMA 3RWDA 4AYEC 5AWNH 5I76A 1KCSL 4CSSA 4KK9C 3SCMD 1K8DA 3AS0A 5C0FB 2VIRB 1KBWA 4JDTH 5I2IA 4UOJA 2X6CA 4GP5B 4U0QB 1MFMA 2WQSA 3VFGL 3HMXH 1VACA 3MRRB 2QMJA 3SPGA 2IEPA 1FVCB 1ZD6A 2KL6A 1GY2A 2CBTA 5D6DC 3RUGB 3TYGH 3E80A 2WAQA 5FM4A 1KY6A 2NXZC 2Y2TA 4IRJD 3E38A 4N9GA 3T0EC 5E94A 4K23L 3GI8H 1KGYE 1YQVL 1NAKL 4R7NB 5FM5O 2Q8AH 5C08A 4PYGA 3IVKA 1QABA 1AXIB 3P4LA 4F7KA 1R3KB 3O11B 4Z7WB 3W81A 3PYCA 3HG1D 5E5MB 3MRQA 3DX7B 1VADB 1KEGL 1NAML 2EABA 3O3AB 3PG2A 4NQSA 1AHMA 2QQQA 5IUCA 3C6LB 2NOYA 3FQWB 3BIAX 4AL8L 4FMKA 5E4AA 3GSVB 3V0FA 4LHUA 4WRLA 3BAIA 5MENB 4LVHC 2H2PC 4MFHA 1K5WA 4LSUL 4AMKH 3ZTEA 1JN6B 1SJVA 1XCTA 2NY6B 4XN7A 1MFCH 4Y19E 3HC3H 4WUUD 3PWPB 3BISA 5K9OB 3QDJA 4CW1B 3QUZA 3AXLA 3L1EA 3RL2B 1E27B 3WBDA 1T83A 2EYTA 1RIHL 2WNXA 4QRPB 4X5XB 1U2YA 1UD4A 4ZMYA 5B1BB 5C0CD 3QCUL 1GZQA 4GW5B 4HK0A 2JKTM 1MRCH 5HI4D 1OM3H 5F6IB 1QFWH 1SLWA 1FJ1A 3F7VB 4G8GB 5C8JB 2ESVE 2Q8BL 2YBRB 1UZGA 3EJUA 3MZTA 3F3HA 3H3PH 4YEEA 1MIMH 1ZV5A 4TLTA 3RU8L 3KL0A 4LMQI 3QRGL 3RAJL 2F7OA 1NFIB 1RJCA 4ONGH 1F11A 5MEPA 3HG4A 3S96A 1ZT7A 1QUPA 5KVEL 5L2JA 1B0RA 3OXRB 3B9EA 4QMEA 4CRPA 4CVZB 2X6MA 3ECBB 4ZFFB 3NEXA 4P2QD 3MV01 2HKHH 4U6VL 4BUGA 2G5BB 2PCYA 5HYJD 3ZE1F 4P57A 1KB5H 4XP6H 3D69B 3HUJF 2EH7L 3NSDA 5IBTL 3GO1H 5I5IA 1KMGA 4HIXH 2W65B 1G9EA 2EDQA 4JZJB 1XR9A 2CLRA 2VMJA 1PKQA 4BZ1H 1L9OA 1JTOA 2ZUUA 4AIZA 4ZSOA 3GMRB 4B7LA 1CD1A 4FLRA 5DTFA 2Y07H 3QUGA 4MX7A 2WY3B 5IBLD 5KBMA 4N90D 5DQDH 5BZDB 1N10A 4CGTA 4JRWA 4YVUA 1BFVL 3TNMB 1AO7E 3U1PA 3AT9A 3KPSD 3RFZA 3EGXB 3C12A 1KGIA 1QPXA 3O9WC 4MXWH 2EE6A 5LG1A 1PF3A 2CIIB 3CH1B 3BVWA 4PP1D 1ZT1A 4H26A 3WTXA 4F58L 1ND0A 1NL0L 1RU9L 3ARBA 5GRUL 1VPOH 1LP9B 1AHWC