1OGPA

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
388
structure length
388
Chain Sequence
PGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SULFITE OXIDASE
publication title The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 103
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ogpA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 1ogpA01
3HC2A 2A9AA 3HBGA 2A9DA 2BPBA 4PW9A 2BIHA 2XTSA 1OGPA 1XDYA 2BIIA 2CA3A 3R19A 2A9CA 2CA4A 3HBQA 3R18A 2BLFA 1XDQA 1SOXA 2C9XA 4PW3A 3HBPA 2A9BA 2A99A
chains in the Genus database with same CATH superfamily
1EAOA 5FUCC 3V0IA 3BP4A 4MBRA 4FXTA 4Z7UA 5I17A 4AIXA 3T3PF 3EJZD 3NTCH 3UGEA 3KPNB 3QXUA 2HT3C 4AXWA 4BZ2H 1H6EA 3PHAA 4YSAA 1A1NA 4O2EB 4XI5D 4XMPH 1NGZB 3W9DA 2PYED 1Y18A 4U1SA 1JK8B 1YEIL 2VRQA 2A74B 3VVVA 3MNWA 1DQJA 1M9SA 2ICWJ 3QJHA 2WQAA 3QXAA 3OKEA 2DYPB 4Z7WB 4FCHA 4H8VA 3DJTA 4RMWA 3U6XS 3RHWF 3IS0X 3OL2A 3S8GB 4R4NC 4J3TA 3LZFL 5I30H 5KVGL 3SBPA 1CR9L 2HX8A 5FYLH 4LOEA 4I2XE 4K7FB 3RVXD 3IDNA 3ETTA 3QFDA 4DUXA 2EUXA 4G5ZL 5D8JL 1IZKA 2PUQT 1TTGA 5ALBH 1ERNA 1QVOA 1SJVA 2YEZB 1L3WA 1OO2A 1WZAA 3BFQG 4LNRB 2FQFA 2XN9D 3G6JF 3T6XA 3DETC 3OVUB 2VM9A 2YRPA 1EO8H 5EU3A 5AVYB 2CM5A 5A6MA 2CALA 4NKIL 4LL9A 3N6YA 5DJXA 1IV8A 4GS7B 5FKPB 1C12A 1X7TA 5F21B 1T22B 1XF1A 4QJ5B 2J8UE 1SOSA 2DW5A 4HU2A 2ICEA 4OZ4A 4OZHE 1JTOA 2Z64C 2YMXH 2KERA 3C8KA 4FQXC 5B38B 3TCTA 3V7MA 4CVUA 2VWEE 1WAAF 4V2CB 3PU7A 4YWGH 4XO8A 1BOGA 4GI9A 1LWJA 3C6LD 2QQQA 1A9EA 3IFLL 2DQFA 5DA4A 4O5LH 1ECYA 4IRZL 2BY2A 5IJKA 4ODWA 2AXGA 4KI5D 5MI0C 43C9A 2YD0A 3DVGA 5H35B 3GMNB 4HZAA 4X7SL 2GSIB 5KJRH 1NM9A 3NFPB 3F7VA 4KWUA 2FLMA 2X4PB 2QT6A 3VD1A 3MXVL 5MERA 1GS6X 5BQ7A 5TE7H 2EIKB 2LHAA 4K3JL 4ONFL 2L8AA 4XVSL 5CGYC 1QSEA 3GLEA 5AKTA 4NN6B 3TCLA 4ELKA 1G87A 4JRLA 1L6XA 1CDYA 2VUKA 4O2FB 3ARRA 4GG6B 3B8SA 2DEWX 3O2DH 5F9OH 1ZGLA 2RTTA 1HU8A 1SY6H 4CSZA 3FKUS 1E9PB 2EDNA 3HHRB 3F05A 4HGMA 5DJCA 1BFVH 1KFAH 4TUUA 2BP8B 1KBGH 1VKXB 4YNYB 4ODVL 4NZTH 5L2JA 1CGTA 1MJ7H 1MREL 2ZT9C 3VU2A 3OKNA 4YQXH 1N10A 3Q1SH 1JZEA 1YEFL 5F7KC 3B1UA 3FQWA 2OMZB 2PO6B 1S7RB 2BCKB 5C0GA 4EIGB 1CZ8L 3MRBA 2DQTH 5DHMC 1OCWH 1UG9A 3DUSB 4E9WA 2ID5A 4WEEA 2C7FA 2WBKA 4NXKA 3RKDD 2QR0A 3DIFB 1FGNL 1T5XB 3D25B 1MHHB 2AJYL 3OKDB 4LEEA 3HI1B 2X4NA 3F7LA 5DYFA 4AQEB 4MBOA 3O3AA 3SDAA 1CL7L 5C0AD 1DN0A 3KWXA 3AXLA 1QW9A 4NKMB 1QFPA 4FKHA 1R3HA 3K6DA 1J8KA 1YEIH 4P2AA 4Q6IB 4HBQA 5L88H 4QRPA 4M8QA 4WW2F 5AYQA 4D8PA 4OGAC 1CFQB 4PY8I 2JKTM 4FQ1H 1XAUA 1SJMA 3ZYIA 1LM8V 1XTMA 4Y4KD 1FZKA 3P9MA 3VXRD 4PJCE 4E9VA 1JI1A 1MCCA 4JREC 3RIKA 3LZFH 3PUUA 4RGND 4LMQE 2WXPA 3LKQA 2QMJA 5IV2B 3QUKA 1HHGA 2GJ6E 1MFUA 2ADGA 4OGXH 4XNZC 5AG9A 1ET7A 3QAZB 1P84J 2XWCA 5C1MB 2DDQL 2EDLA 4F92B 4GBXD 5D1ZI 3QEUB 4IJTA 4OFDA 5M7QA 3CBJB 2EUWA 3NESA 2FX9H 2FIKB 5IW1A 3V6ZB 1EJFA 4Y5VA 4OLZH 5BRZA 2UZXB 5IM7B 2NQCA 1CLOL 3QIUD 1HCYA 3ARGA 5L2KD 1XR9A 1FH5H 4NC0B 4AV5A 1QR4A 5INCA 1BFSA 3DDFA 1TZIA 4KKAD 3L5JA 2MNUA 1CGSH 3G6DL 3T6ZA 1BF8A 1XDYA 3IMUA 3NA9H 1GYWA 5C0FA 2NW3B 4YIQB 4BQBA 3IFLH 1TJGH 2DQHL 3NCJH 4WFFE 4PYGA 2VKXA 5I6MA 3ZE1B 3JV0A 3JZ7A 3WO4B 1BJ8A 1VGKB 4L3CB 1I85A 4W81A 1CDUA 4UDUB 1JZ6A 1XGUA 2GHZA 3EH1A 3PDGA 3QQXA 4RGMC 4JB9H 4ZUSB 3B2XA 3MGAA 3FONA 4BH8B 4CVZB 1S7VA 4XNDA 5A1AA 1BVOA 4X7TB 5JHBA 1Z5YD 1PGRB 1JUFB 3BIKA 3MXVH 4MRCA 4X8JA 4XNYH 3ULUL 2VLJD 4MJJA 2DLFH 1U9KA 4ZJ9A 3TJHC 1YEWA 4OT1L 4QMEA 4FFZH 1SMOA 4YLBA 1OSZB 4NB7A 3L3IB 3TVMC 3WU1A 1YG9A 3H9SA 4XPTH 2DBLH 4RDQG 2CJSA 5C2BH 1C8QA 2AXHA 3KBHE 1IM3B 4X8CA 4K3EL 5D1QB 2DQIH 5CBAB 1G7MB 5GS2D 3WIAA 2FLBT 1MREH 1ZLDA 3QUMH 4NFBA 5KUKA 2QMKA 2NR6D 3QCTL 4H20H 4KTYA 1UUSA 4C58B 4NQSB 4L4TE 1PKQE 1J5DA 4F20A 5D1ZB 1G84A 1RK7A 2AFNA 3AROA 5SWQB 2JQAA 2KMWA 4GAJL 2BNUB 3P02A 2D7PA 3H9ZA 1KXTB 4HUVA 3HB3B 2BJML 4PB0H 1IBHA 3CH1A 3CPLB 4L37B 1TEFA 5IJBC 2BSSB 5JDSB 1MI5B 2IV8A 2J55A 4J3BA 1CPUA 3KYKL 2DMHA 3AWEA 3IGLA 4LCWD 5HYJB 2F58H 3QEQB 1KN4L 2D31B 4HFWB 4QXVA 4PRHD 1GOHA 4Y8AA 2NRDA 5DHYA 2N56A 2GJJA 1BD2E 3D0AA 4BD4A 1FDLL 2VC2L 3AM8C 4FJ6A 3CG8A 4K0OA 1B4JL 3H3PH 2BVTA 5DHEA 2P5ED 2VR6A 1AYOA 3RVUC 4UTBA 1OAJA 4IGBB 4PIBA 5B1AB 1CBVH 3V52H 2ZOOA 4UV7L 3AT9A 2X41A 3H7BB 4WO4A 2DIEA 3MA7B 5E56A 5GGSA 5JPMB 4WK4B 2CLVA 1N3NA 4YEFA 1F4YL 4PJ9B 2QELA 3KPLB 1K5WA 2DDQH 3B8YA 3Q8AA 2WOBA 2CDGB 3M07A 4KK8C 4EUPB 3HKZA 1WD8A 5F7MC 3FTYA 4I0PA 5EU4A 5HHNA 2OP4L 3ZDZB 4B3EA 1UUNA 1T5KA 3QWOA 3DX9A 2BP0B 2X42A 3GJFK 1S78C 3CZNA 3MOBL 5ITBL 5IVZB 2Q76A 3D18A 3QUZB 1CLOH 3ULVE 4A04A 1DVFA 4TPRL 5E4EB 5CJQL 3ME0B 4ELME 1QTSA 4JJOA 2VDML 1PZ2A 4OBSA 3AY2A 5KBMA 1W72A 3P73B 4HJ0D 1Z9OA 2V2WA 1CUOA 5TH2B 4DWHA 1U3HA 2XZAL 1G9ML 4DP8X 1ETA1 1MHPL 2WXHA 2DIJA 1KB9K 1H19A 4C54A 2FO8A 5HD8C 3W9EA 4Y2DD 3QYCA 4DUVA 2XPGB 3AC0A 1IQWL 5D5ME 1HEZA 2KZBA 4EIBA 2MCPH 5KBPA 3D39B 2Z31A 1UQSB 1H5BC 3L48A 3QUYA 4JKKA 4X5RA 1ITBB 2ZSWA 1M6OB 1QSFA 1XIWD 5G4MA 4B41A 4FLQA 3DVNA 1ROCA 2ODHA 4JRXA 1QG3A 4TNVF 3TBWA 4UNUA 3MRHA 4N9OB 3K46A 3BVVA 1P5UB 2LTQB 5GGRA 1C08B 3ZMNA 3NFSH 2VSKB 8FABA 1P7KA 2ESVA 3IMVA 1LP9B 2VLKB 3TV8A 2X6MA 1VFBA 4NZJA 5DJYA 4PRIE 2KH2B 3VWKB 5D7HA 1OOWA 3TBYA 1HI6B 4C4KT 1AZUA 2YQGA 5FM5O 1ZPLA 2NNFA 5F7AA 3NGBB 3NCWA 4P4RB 2JB6B 3QQ4A 4MYPA 3SHSA 2IO5A 3TZVB 4E2OA 5HDQL 3OGOE 1U42A 3MX0A 2CXGA 2YSSB 1R3KB 5DDHA 3TWYA 5KSBE 3P0YH 4DKFH 2LU4A 3UOAB 3WJLC 5C08E 4R8WH 3QZWA 5DGQA 3HCVA 3NZUA 4KJYB 3R8BB 4P57A 1ASQA 3VFOB 3ROOA 2BDNH 2CIIA 4Q6KA 2CO3A 1JWMB 3ZHKA 4FMVA 5EU6E 1PJWA 3TN0B 3CHPA 1OXYA 4YDZA 5KBNC 3A23A 3NJLA 5JHLA 4JGNA 4UAHA 4JFQA 1B4JH 1KXHA 2IPKB 2Q7AA 2DWDB 4IBVA 3BWUF 2EDFA 1WBYB 4TQIA 1KPVB 5I8EA 2YZ8A 3IDMB 1JHTB 4IBSA 4XNUH 2XWBB 2LLNA 1JHLL 4LL4A 5C0EA 1XCXA 1EQWA 1LNUB 1AD0A 3CSFA 5IBTH 2Q7YA 1F3RB 5CJ5A 4D8OA 1R46A 4WKZB 25C8H 1CFSB 1ACCA 1AG0A 3RVWC 2ZCLH 5FO9A 4WEBL 5HDRA 1XMEB 2IDTA 2VXTL 3AWGA 4ZAKB 5F7NC 4JDVB 1RUQH 1KCUL 4BZ1H 4QRSA 3RWHA 3H3KA 1G1OA 1J88A 1W0VA 4UV4H 5FO2A 3IKCB 5ITBH 5DQ9B 3IS1X 3AWFA 1USZA 1MCKA 1VFAA 2OW6A 1MW1A 1AH1A 3O41B 3LD8C 3FF8A 4A7TA 2EXYD 1URIA 5CJQH 3UC0L 4OW6A 2NY0C 2VDMH 3NCFB 4OLWL 2OR9L 1KCWA 4TUJA 1S7QA 3CMOH 4FE9A 2XU9A 1RJYA 4H40A 4PJ5A 1OTUD 4NT6A 4HJGB 1JCVA 3PL6D 5EFIB 4OZFA 2WXRA 1P4IL 1RUAL 4WNQA 3T3ME 1HAWA 1IQWH 2YD4A 2CAKA 3U2SA 3UO8B 3ZYJA 1C5DB 4WUUE 3I75A 2NZ9C 4MXWL 1L9RA 4PRPB 4HYTB 5ACLA 2MRYA 2YN3A 4PP1C 2NYYC 4K9EL 1ZS2A 4R7VA 1NC4D 5HJDA 5D7JD 3I6LE 5JIKA 5DUBA 1AHKA 4M5ZL 4GW5B 4ZRGA 2X1PA 5AW5B 2L7QA 4KJQC 1BZDA 2R15A 2IAND 3OX8A 2K1MA 2Y1YA 4QOKE 4HKJA 5I0YA 5EV7A 1NPNA 3CHQA 3ZZLA 1MRDH 1E4WH 3L95A 2EP6A 3D5OF 4DEPC 2GIMA 2VO8A 2CIKB 5GPRA 2HRGA 5F89A 2E4FA 4Y4KA 3MV9B 4DOHB 1A66A 1CLZL 5JHDE 3E0GA 1NOLA 4U3XA 2WLLB 1M1XB 2KUTA 4M7JH 3CXFA 4G6AC 5H4ZA 4MNQA 1FNLA 4MVBD 1W15A 4M1GL 1JD7A 4XBPB 4ETQB 1NCDH 1X5KA 5JLZB 1A64A 5IEHA 4JZJA 5FO8B 2AV7A 3UC2A 4HUNB 5FYKD 2O6PA 2KYIA 3LNEA 2NNXA 1QQDB 2XACC 4LLAA 4LKCB 1WWAX 4M6NL 1ZTMA 2GPZA 1A4KB 3ZE0E 3P4OB 2B4CL 4L05A 3IF1A 3VXMD 3ISWA 3EGDA 2E56A 4Z7VB 3WHXA 2AQ1A 2FK9A 3E2HC 2CNZA 2KLRA 5C0CB 3CC5A 3KYMB 4NZUH 2JMRA 4NAJA 4KBPA 4P2QE 5BV7H 1J1OH 2VC2B 1F02I 3D52A 3JV4A 3VACA 4HS8L 4E5XB 4YSPA 1INQA 4KPHH 4Q2ZA 2A74C 3DX2A 3GD1C 1TJHL 1SQMA 1FG2A 4PJIA 2XG5B 3BWAA 5IQ9A 1YY8A 1S9WA 4MJIA 3UZEA 2VJ8A 1DDHA 2NTFB 1U36A 1HYRC 2V3EA 5EF1A 4XN8A 5I24A 2W9DH 4QHKI 4BRJA 2VXTH 1RKRA 5JQ6H 1U8NB 4GRLC 3BMVA 1IM9D 3SE3A 4DN4L 3IFOA 3VYPA 4ZW3A 8CGTA 4AE0A 3W37A 4D3CL 1IFRA 3TNMB 5DEZA 2OYMA 3QORD 5C0BB 4GKSB 4Z0XB 1U30A 4OZGF 4NLHA 4V1DA 3CSYA 5AB0A 4J3WA 4LDCA 3NRFA 1SXCA 3OKKA 2XV6B 1BJ1J 3V5HB 3RFZA 4MX7B 4NWTH 2Q3AA 4ZUVB 3ZTEA 3C60C 4TL5A 1NJ9B 3DJ9A 1SVZA 4D0DB 2AEPL 3MSPA 5F93C 4GS7C 4TTDC 1FZOB 4JZOA 1RZJH 3CX5K 2VDMB 2L3BA 3EUUA 2ZXWB 4FFVD 1Q38A 1YHPA 3DO4A 4MAZA 2OL3A 3AGWA 4HX1A 1WZMA 4LCYA 4S0SD 4N0FB 5IVOA 1I8KB 4L3ED 1G7PB 1U8HA 1MVFA 5DQJB 1HHHB 1TZAA 5DRWB 4BBWA 1O6TA 3EO1A 3I50H 4MXWH 3FH8A 2QEJA 3FSWA 2NLJB 3QQ9C 5FOJA 3EBIA 2HTKD 2VLRE 3CLEH 5T5FH 4JPKH 4LLQB 2OMNA 4PGEB 4NQCE 1S5HB 2R59A 4NQTA 4JO8A 4ZSOA 1FNEA 4DZBA 1VPOL 4G8GB 2L04A 1N68A 2TSAA 1HINL 3VNYA 3ES6B 1GGYA 4GFXA 4TLKA 5E5MA 1UHVA 3GXDA 1DQLL 3L5HA 4GNKB 5GS1C 2UVEA 4Z3IA 5BZXA 3DX8A 4QRTA 4IRSD 1L9QA 2QQKH 3IWVA 1TFPA 3STLA 2PCFA 1AZRA 1XSJA 4NN6C 3WXVL 2WXJA 5AVUB 5D96C 2VR9A 3AMKA 3OJDA 4OJAA 3WEXB 2IXQB 3HZKB 3OHXA 3X2QB 4ALAL 2J6EL 4GMTL 1A3LL 2XWEA 1KLGA 1INEH 4OFQA 4EDXB 1LEIB 3Q43A 2Y6SD 2R1XB 3QI9B 1OE3A 1I9JH 1NC2A 2F68X 2X4OA 3DOHA 4M1GH 3HG1E 4XRCA 3MRKA 1GMIA 2EC8A 3FPYA 4KXDA 4NFDA 1MCIA 3T1FB 3NN8B 4F9PA 4KOCA 5I1KL 3U0WL 4FEMA 2HUEA 3U7WL 1PZ3A 2A4EA 2PO6C 3CDCA 3Q01A 4YMPA 3GNML 3QT2A 3HE6D 5EOTB 4TVPL 4CUCA 1MKFA 1TNNA 4WI7A 5INDA 4PLKD 4YHML 1F41A 1IEBA 3MV7D 5DRXA 5EB9A 4HJTA 5I1DA 3WLWC 5FW7A 2AEWA 4E36A 2BSEA 4J3VA 4GKOA 1UWYA 2X4TB 4NM8L 3PGDB 2NY1D 2KQMA 4YFLF 3BIBX 2YSTA 1PIGA 4NO5B 3RIAF 5KYYB 4EJ1C 2G9HA 4KNTA 4FFWD 4B7LA 4OB5L 1BFOB 2O26U 2Y2WA 3ZJAA 4YH6A 5C09E 3DXAE 2A3TA 1N6VA 2O93L 3US1A 3PWPE 4IDJL 4PJ8D 3ARBA 4UZUA 4Y2DA 5FLVA 4GI8A 5DU7A 2DV6A 1BMZA 2C1OB 5C71A 4OJCA 1NGYB 3BSZL 3ML9A 2F6AA 2WW8A 1I4FA 1KG0B 2D3NA 1K5NA 4JFHE 4Y4FD 1OT2A 5FYKU 3ABGA 4D3CH 1RIVH 2BZ7A 3P3RA 4PJFE 1R24A 3QAZC 2EZ0D 3NJJA 3SGKA 2ZYRA 3CH8A 2K3TA 2LLGA 4PG2A 3AG3B 3DV4A 3JVGA 3MLSH 4QYOA 3UTPE 4XPHH 4WFHD 5D2NC 2FX8H 1SOKA 3ZDYF 4QHPA 5DVNA 4XP9H 4GSUA 2NUPA 5DD5H 2AEPH 3IM1A 5E1IA 3MKGA 3SOTA 5IB2A 5IW6A 1EO7A 1ADQL 4I9WD 4PD4K 3K6OA 4N0CC 4GIPD 2XQYA 3RGBA 1RL1A 3EJYD 4CC1A 3DK0A 1NAKL 2FL5B 2YFNA 4AMKH 1CGWA 4P49A 3WMQA 3ZE2F 3CZGA 1G7IA 5MEOB 1JS4A 2JTDA 3BH9A 3DHUA 2H6OA 1RULH 3MBXH 5EZIL 3ZHNA 2OMWA 2FLRT 3T4YA 2Y07L 2ZUYA 2ZWZA 3WO4C 4ZQTA 4N8PA 3HAEG 4HJSA 1VPOH 4GXUN 2B5IB 5J4MA 2RIKA 4M93C 3LZQA 1I3GH 4UQ2A 1DQLH 3UO1L 4AGNA 4JL1A 1DVTA 2XOTA 4TM9A 5SWZA 3HE7D 1KN2L 1QKZL 4ENEC 1T20A 3LYRA 5GGTH 3UZVB 1QASA 4HCGA 4NHCH 1MRCH 3FO1A 1ZT1B 2KC0A 1QTPA 2FZ3A 2J1ZA 4G7VL 4DPCX 5JIIA 5DUPH 3CFTA 2F54E 2HT3D 3FQ4A 1R4XA 1UD4A 4XVTL 2X7LB 4N90D 4OUOA 5DT1L 4U7SA 3L3OB 5CWSA 4NQEE 5AOLA 3ECUA 3UBXI 4OZFG 4MB4A 5JPNA 4HG4J 2A6JB 4UT6H 2EIMB 5D1ZC 4QTIL 4HGKC 1FO0A 5AL8A 2B3IA 1E40A 1EZLA 3C09B 3FQRB 3K0YA 4TVPH 4H44C 3TU6A 4CADA 3KZ8A 2E9IA 2J25A 4N8VG 4WWPA 1X5GA 1DUZB 4YHMH 4EOWL 1U8OB 5CP3A 2FQDA 4R4ND 1GSMA 2C7UB 4C8XA 4Y4HC 2VH5H 4PJHF 4WWKD 5CEZD 5K9KB 4TQHA 2GTWA 4AEFA 2EKJA 1OAUL 4WI4A 4OZGB 5EPMB 3FU0A 5BJTB 3ZUCA 3B6SA 3PGCA 1FSKB 2O5ZL 2ZTBA 1OF2B 3GWJA 2E9JA 1UWXK 2YAHA 2TAAA 2EACA 1UOKA 4OB5H 3S36X 5D7IB 2ORBL 4F33A 4H2AA 4JKMA 2W5PA 1WS7A 3CPUA 2IQ9H 3QCUL 3P4NA 3DETD 5L7XL 1OQXA 2MJWA 4LFHD 4IU3A 4DT2A 3SDDB 1GZQB 4OJEH 3MJ9L 1T7XA 5DJ2A 4WTZG 1L9NA 4IGBC 3BSZH 3F5WB 3FQTA 1L0XA 3P2BA 2O6EA 4P0DA 5JPMC 2XXGA 4PJGF 3VXOB 2FECL 3DRQA 4F9LA 3MJWA 4FQXD 3PWJB 1ZT7B 2GBTA 4MCMA 2H0EA 1TLMA 1FJ1A 1KB5L 4HKZB 2XPYA 3IPFA 1YJDL 5IIEB 1SJXA 1R33A 4RGNE 1Q9WA 2CJUH 1KJVB 3N42B 5DD0H 2BLFA 1R5VB 2M2DA 3LS4L 3MMEA 5AALA 3U0PB 5D70H 3HLAB 3MRPB 4G82A 3SYAA 3EGXA 3QRFM 5BUAA 1ADQH 4FF9A 5BQDA 1UB6B 5DRNB 5I8KH 4ZO6A 4Y9GA 3OXSA 4M7KH 5E51A 2XX0A 5I82A 5C0RL 1QHOA 1FZJA 3BN9C 3BUIA 1ZSDB 4X6CB 3RTQA 1OVZA 4J6IA 1U92B 3CFBB 1TTRA 5CGYD 4I2XA 4QF1A 5L2KE 2CNYA 4UQBA 3S5LG 4HIIB 4GP4B 2FO1A 1EV2E 3FO0L 2H2PD 3PWVA 5E99L 4PGZA 4XXCC 3HN8A 3LKSA 2JJSA 3W57A 4ODTL 5HI4C 5KBKA 3M17B 3HZYB 3OXRA 1GPOH 3OF6A 3DHMA 1IGYB 5H37G 2VJXA 2HTLC 1IARB 2MEJB 2HJLB 5J6SA 5CN1A 4JLRA 4D0CA 4I8DA 3WTWA 2N3JA 3BESR 1TQUA 1S9VA 2GBVA 4E0RA 3HVNA 1XCQA 2J8UA 3LN5B 1MW3A 2EDMA 3L3GA 5LBSL 5GQBA 4KX7A 4OZHA 3LH8A 1XGQB 1LJMA 4M4RA 1RPKA 3LIZH 4MKMA 5TQ2L 3JYCA 2VN4A 1HVXA 1B9KA 2BSRA 5D6DC 2CKBA 2VLJE 3VXPA 3VW3H 3EKCA 2CCLA 2R83A 2V7HB 5BVPL 1G1CA 1P5UC 2LTQC 4NENB 2F8IA 3B5HA 4PJXF 1YEHL 1X5XA 4F7TB 1BG9A 1GGBL 4B9FA 5DT1H 3QIWA 4GRWH 5DHVH 4KMLB 5TF0A 2NSXA 3IE9A 4U0RC 2VSDA 1RURH 3MUY1 2PW1B 1IIKA 3VWKC 5E7BA 3JTTB 3BKCL 4QTIH 4OGAD 4X50A 3NGBC 3TZVC 1QFWM 1U91B 5FDWB 5HI5C 1RXLA 3ERXA 4ZDHB 2X6AA 1P1VA 3VB8A 2W60B 1G0YR 1XEUA 2YPLA 1OGAA 2V33A 3D2TA 3P9WB 1CXEA 4ZTPH 4M9PA 4S1SH 4J27A 3Q5YA 4UOW0 1NEUA 4NPYA 1SRDA 1FNHA 4XB7A 4ATWA 4BELD 4Z7OE 4K94H 1GSKA 1W0WA 5H4YA 1SVBA 1A7OH 1VFOA 4ZOCA 1RH8A 3QQNA 4O2CA 2JIXD 2R0LH 3MNZB 1AS8A 1U8MB 5I16B 5L7XH 4HIJB 5L4FA 2WNWA 1H3TA 3K72A 3T8XB 3MJ9H 2ATAA 4JCLA 1LEGB 4QJ3B 2R1WB 1UA6L 3KLSA 3J27A 1I8IA 3J8F7 2APTA 3MACH 3OV6A 3BEWB 4QKXB 1HHKA 2OSWA 4Z7QE 4ZG1A 1J05B 4B0MB 2EDXA 5HVHB 2OA9A 3MJ7B 1V54B 1CLCA 3I2CL 2GJZB 4MZIA 4PHXA 1BQSA 2IMNA 1IKFH 5CIPH 1CTNA 2EKSB 3BDYL 1XZ0B 4G80B 4LXFA 1A7NH 5CF3A 2E7MA 4N20A 4Z3HA 4U6XB 3BAXA 3LS4H 1T1WB 1C5BL 2F2HA 4MMZA 2D0HA 3LDBB 3VSUA 3ZTCC 1A0QL 3BSGA 4NYLB 3MRLA 3E6FA 4MQSB 4PS4H 1IBGH 3ARDD 2X05A 1FYHB 2JLLA 3TIEB 4LDOB 3L3DB 5MEPA 3WJMB 4PJDE 4BM7A 1A4BA 4PJCA 5C0RH 5I28A 4DP5X 5D7LE 3H4FA 2CJ3A 3TJHD 2N59A 2F53B 3B56A 3KG5A 1NCIA 3U4BL 4PGDA 3VMOA 1XB8A 2GJ6A 3HPJA 4QXGL 4BINA 2X9YA 2FJHA 2PW2B 3FO0H 2DMCA 4OKVA 2E5EA 2O1AA 4GKZA 1MXGA 5EO1B 4UMSA 1J5HA 2EDBA 3U2IA 1TO5A 3CFJA 1A25A 3NACL 4NQDE 3EOAA 4EXPX 3WI9A 5F9AC 3MRNB 2C4FT 5IG7B 5C0NC 3OKLA 2QV2A 1FNFA 1AO7D 4N22A 2FBJH 3IJ8A 4RVBA 3RUGB 5I71B 4FI7A 3KW8A 5DMIL 1NBCA 2CZNA 5E4AA 4OF5A 5K9JL 4EI5A 2FHFA 1T7VA 2GAZB 5LNEA 2WN2A 2ZUTA 4GAGL 3OQRA 5TQ2H 4G42A 5HJ3A 3U6XA 4HZLA 5JO5A 5KYUB 5BVPH 2PPAA 3MODL 4PJBF 5A2AA 1YEHH 1KULA 4UUJA 3ILPB 4P99A 1RJLB 5ADPL 5JW4N 3HNTH 4LBAA 2ENSA 4XMWA 3DMMA 1TVBB 5E2UL 1E2ZA 4LQ1A 4F57L 4KO9A 4OM1L 3L4YA 4GRWB 3UACA 4OF0A 3O9WB 1BAGA 3BDBA 3L7FB 3BFOA 4MMXA 4G8FA 5DHVB 3BISA 3II3A 5FA3B 5D9SB 4HIQA 5EG6C 4MQ7A 1HXMA 3IDGA 1OP5K 1D6EB 2YUZA 4R0LC 4BFJA 5F3BB 4PGCB 5IQMA 1HXYA 2ZNWA 3RVUD 3AS0A 3ULVF 3BZFB 1QEWA 4DQOL 4PRBA 1F58H 5FXCH 4DKDC 2Q86A 5C07D 1UASA 2YQ2A 4IIZA 4ELMF 1XQ4A 2WVVB 3KYOB 5DA0B 4OGQC 4GSQA 3QO1A 4OD2A 5IQ7H 4CC4A 4HETA 2L7EA 3BH8B 2AGJH 4MB3A 3FT3A 4KK8D 1SLWA 1YMME 3FRUA 3ZMEA 1ZLEA 1YNKH 2ZX6A 2Q6WA 2XG4B 3GXMA 2QSVA 1G4MA 1OTSC 3D85B 3V4PL 5FB8B 3BD5A 5IVXB 4L4TA 5D5MF 2E7CA 1PKQA 3CU1A 3KR3L 3FO2A 1S78D 2CRZA 3O3UN 4Q4EA 2Y7QB 3GINA 4HFUL 1JV5A 3RZCB 3HR5B 2NUTB 4XCCL 3RWEB 1YUHA 4LHUG 3PAZA 3GXIA 5DURD 4ES9A 2FEJA 2PPEA 5HYSG 2AEIT 3IMBA 4A66A 2FEDC 2HFEA 5HDBB 1BXVA 3KPPA 4LCCB 1W8OA 4A7SA 4K71B 3GRWA 2QSTA 3C2SA 3MOAH 1MOEA 3EYUL 4WK0B 1KB5B 1GIGH 5CIPB 2CK0H 2NPLX 1C5BH 2XBZA 4HWBH 5HD8D 1TPXB 5F1IB 3Q7JA 1B3IA 3R19A 3PNRB 4M8UA 3VGFA 1Q72L 3OC8A 1Q9LA 1EDQA 5ISZB 4ZW8A 4ZS6C 3GSNA 2X4RB 1HH6B 3N85L 4G1EB 1NMAH 4NFCA 1AD9A 2DL2A 5E2WL 4F7CB 4AVHA 2XVBA 2K7PA 4JFDE 4FQ2H 3U4BH 1SXAA 3LXCA 4XP5H 5JOPD 2IPUK 2VB5A 4QHUA 5HHME 4AITA 3OPZH 4HOZA 2C9QA 4NCC1 2UWEB 2QADB 1V3JA 1BDYA 1E6JL 3NACH 1OM3H 3L16A 1PSKH 2F5BL 1OD7A 2W07A 3FU6A 1HCZA 1TENA 3R7RA 4G7YL 4YPGA 1I31A 4IOIA 5DMIH 4NRYB 2WLYA 4PRDB 1TU2A 5I1GL 2NY4B 2GW5A 3RGVA 5D71H 2LR4A 4PP2B 4GAFB 4TLSA 5D7KE 1L6PA 2B77A 3FUKA 4NP9A 5HDLA 5CD3A 1KC5H 4ADIA 5A3IC 1I1AA 5CHNB 1LO2H 2P8MA 3QDJD 3ULAB 5BZDB 2E7BA 1AGFB 2MCAA 4JPIA 1VSCA 4MDIA 1BBDL 5FHBH 2VXVH 3ZT5A 5C7XH 4O00A 4AEHH 5IFAH 3GBDA 4GIAA 2LFGA 4FYSA 4FYTA 5DFVC 1S7WB 3H9YA 3MODH 2R4RH 2Y5QA 4HBCH 4GW1B 1UXMA 5IOKA 5ADPH 5TQ0L 3PHQB 1BZ9B 3U7YH 5E2UH 4Y1AD 3O0LA 3OGCB 2WKOA 3JUZA 3V79C 3MCG1 3BXNA 4CU8A 4OCLC 3C9NA 2XHNA 3ASNB 2IADB 3N9GL 4DGVL 4JPSA 3O11A 1E9QB 3C2AH 1PW3A 1TTFA 2LVCA 4RFOL 4TUOA 3RBGA 3MGTA 1B0WA 1SN0A 4LASH 4N9GB 1IAOB 1RK0A 3AT0A 4HHAA 2J1XA 4JCWA 4P23B 2IMMA 1KLFB 2BFVL 2VZSA 2IC2A 3DDGA 4JDEA 1YMHA 3FBKA 3QWRA 4NOFA 4OZIB 3BJLA 4EQ2A 1MY5A 3WS3A 3RVWD 1A14H 1UCBL 4TV3A 3MRQB 4U1LB 5ID0A 3PLYA 5E9DA 3FUIA 4QHNA 3REWA 4AIZB 4BFIA 4MAYB 4DETA 4YDVB 1NOAA 5F7EH 1JHKL 3CFEA 3IXTB 5IFJB 4HFUH 2WQ8A 3B2UC 2MQCA 2V5SA 3LKPB 1FYTD 4C55A 3ZRSA 5BV7C 1LHZA 5B39A 4Y16B 4UILH 2KPWA 3KPOB 2NY0D 1GGIH 1P53A 2NXYB 4N6RB 1K4DA 2JH2A 3HS8A 5KSBA 1OE2A 1RZ7L 4G72B 4S11A 4PRAB 4JG5A 4F1SA 5C08A 2AXWA 3MLTB 4LLDB 3F12A 3EYUH 4H1LG 5I6OA 1KT2A 4KXCA 4EKJA 4AQ8A 3QQDA 3H0TB 1NAMA 4ATTA 5IHHA 3FN9A 4LVEA 2UX7A 4LSRH 1Q72H 5FYJH 4LIQE 3UTQA 4EE2A 4OFVA 2NZ9D 5I73B 5F9WB 2MNWA 3CQPA 4HLZG 3JQOB 4NN7B 1ZXKA 1QR1A 2NYYD 4WGWB 2R27A 3FUJA 2GB2A 1KGXA 4OGZA 3QNZB 3CDZA 2VW6A 1MWAH 4JFED 3DI3B 2AJUH 3O3EB 5J13B 1HDMB 4ZQKA 1BLNB 5E1GA 3TESA 1IL1A 3DSFL 4YN3A 3RWFA 3B3IB 1MFBL 2DICA 5DR5L 3IBEA 4N2MA 1M1SA 4XO4A 4RGOH 2B16A 4KROC 5AYTA 2BX5A 2HJFA 1NGXB 1TJXA 2R39A 2YEVB 4LCUB 4G6AD 1V8HA 2KL6A 4XCEA 2DMKA 1FAIL 3EYVA 4WW1B 3VD5A 3WKYA 1JNLL 1JNHA 5DEJA 1L7TH 3IBOA 1PQZB 1BBDH 4MCZB 3BCDA 3T0EE 4GUQA 4BKTC 1M3IA 3BP4B 4Z7UB 4YHOH 4UANA 3RWDB 4N0YL 1REIA 5IKCB 2NXZC 1X7QA 5TQ0H 2XWRA 4C47A 3PPEA 1A1NB 2EDJA 4FQQA 3IGUA 4JPWL 3W9DB 1Y18B 4MS8C 4U1SB 1XT5A 2F1EA 4WUUA 3N1FC 1URLA 3IT8D 1TYEB 1J0YA 2LU7A 3DV6A 3QUHA 3N9GH 4DGVH 1DQJB 3MFGB 3QJHB 3QXAB 4P2OA 4UTBL 3L3OC 5SV3A 1KGIA 1A7PL 1CFBA 4M6ML 4FNRA 4RFOH 3HNVH 2A9AA 5LWYH 1BYPA 4OF8A 3WDHA 5HTSA 4EIUA 3NZHL 1IE5A 2DYPD 2EXWC 3IDNB 3QFDB 4QRUA 4XN7A 2ADIA 3FTZA 3LSOA 1E4KC 3CVIL 4QOKA 2EIZA 3RX5A 1FIEA 4FX5A 3QHFL 5HHPA 4XCNB 5C9KA 2HRPL 1QVOB 1CMOA 3L4ZA 4GRLD 2WQRA 1A5FL 3GHBL 2FUTA 3ISYA 2B4CC 3ZMRA 3V0WL 4AZ8A 1YAIA 1UXWA 5EU3B 5JHDA 3TEWA 1GYAA 3ILDA 1KTCA 3N1PC 4PIRF 5DJXB 2R2EB 5FF6B 1A3RH 5IB5A 1FCGA 4R7XA 3TVMA 3DRTA 2VLLA 4K73A 4AM0Q 3TA3A 1DL7H 2NY6B 3FQ2A 5BMFL 4OZ4B 3C8KB 5TDOA 2JCCF 4G6ML 4PBDA 4W9JC 4TTDD 2JQMA 3B34A 1BOGB 5PAZA 3SQOL 2VDRL 3CN2A 3E38A 5I15L 1Z66A 2E9BA 4WV1C 2PXYA 3FZUC 3CQFA 5I23A 4X5LA 2AXGB 3SYQA 2LVEA 43C9B 4JCMA 4CRPA 4FNTA 4A7GF 2ENJA 3F7VB 4P2QA 3QQ9D 3L9RA 3V55A 4MASA 4Y19E 4LT7A 4WK2B 5MERB 1BEYH 2NX5E 3EJPA 1KXQE 4ZXBC 5JIPA 2X6BA 2ZPKL 1NCUA 3HUJF 3I9IA 3TCLB 1QSEB 3SO3B 4GXUM 1FN4B 3BP7A 4FEIA 3AJ7A 3HI6L 1RZ8A 5DJCB 2O5XL 1ZVNA 2D7TL 3UBHA 4GXVL 1DJXA 2EE3A 1OQOA 2WCPA 1TQVA 3AM8A 3FHAA 5A16A 3HG4A 3ILQD 3PWNA 3OKNB 4PM1A 5E8OA 3R1GH 2A38A 1YC7A 5AAPA 1QYGH 2E7DA 2A9NH 4U1MA 1FAIH 4FYRA 5IROD 3MRBB 1JNLH 4P4KB 4P5MA 3UGUA 5CAYB 5BNXD 4LESA 1X5MA 5FS5A 2M26A 1F6LL 1QPPA 4M02A 4A2FA 1QWUA 2BW5A 2PO6D 2X4NB 1TQCB 1YPZE 2MKLC 3OMAB 4G9FE 3O3AB 2VDOH 3RY5A 2WYIA 4HJIA 3SDAB 4ZNEE 1B2WL 1WPCA 1Y6NR 1DN0B 5IMOA 4Z3TA 3AXLB 2PPCA 2XV0A 4HCIA 3TBTA 2AJXL 4JPWH 3SDXA 4B9ZA 1EMTH 2E7LA 1GL4B 4R96A 3G5WA 5JHLL 1QWHA 4JM4L 2WZAA 4QRPB 4M8QB 2EVJA 4D8PB 3VI3E 3JXAA 4JDTL 4UTBH 2VLRA 4OCSH 4EI6A 4AMWA 1N0XL 4NQCA 5HI3C 2DJ4A 1FZKB 2P9RA 1YQVH 1FFOB 3P9MB 1TVHB 3T2NL 3H56A 4A37A 1MAMH 4KUCD 1BPLB 3A4DA 3FT0A 2IALA 2RHEA 2GITA 2WQSA 4MZ2A 5DS8A 5E03A 2ADJA 3QUKB 1E4XL 2DQCH 3WUWA 4D9LH 3KGUA 2ADGB 4KO6A 3CVIH 5B3NA 3SKJL 3QHFH 4GUPA 3RB7A 5I1JL 4TSAL 1AZVA 5DC0A 2OQJA 3GHBH 3VFMB 3C5JA 3GMOB 4A7GA 1KWGA 1BXUA 5IW1B 2VSMB 5FYLD 3V0EA 2IDQA 2BVEA 4D0BA 4NNXA 3BGFB 1QD0A 2IWFA 2VRAA 4Y5VB 4AEIL 1FNGA 5BRZB 2XN1A 5BXFA 4Y5XA 3CCHA 3ARGB 1XR9B 1PU0A 3EYSH 2V9UA 1W72H 4G6KH 4KQ4H 1U2CA 2C1PA 5INCB 1MCWW 1OCZB 1E3FA 1TZIB 3BUDA 3M8OL 4G6MH 4Y8DC 5H8DA 4FQJH 4UU9A 2EXTA 5TTRA 3WAJA 1AR1B 12E8L 1BQLL 4LNVA 5C0FB 2BOCA 4JRFA 5HVHC 4J8RB 4KI5F 3EGSA 1HEHC 3DPBB 6CGTA 1YECH 4S1QL 5KSAA 3QCVL 1S9KC 1QX1A 3DROA 1LWRA 1XGUB 2P48B 4RZKA 3FONB 1NFAA 2WVTA 1S7VB 3RX8A 1Y6MR 5AAWC 1P84K 4X8JB 3BIKB 3V4VA 3OSVA 3EHBC 3LDBC 4UIKH 4CVXB 3KLHC 2IAMC 1G6RA 5JW5B 2OXHA 4ODXA 1YZZA 4BWUA 2C5DC 3N44B 5C09A 3DXAA 3KL3A 1VERA 3PWPA 3H9SB 5IOPA 3GS0A 1B6UA 3PFUA 3QH3A 5IWLA 3HI6H 2X10A 1GHFL 2VDPL 2XT1B 5GS0L 2D7TH 4G6FD 3RNQA 2YAQA 1ANUA 3PWLA 3PWUA 4FJZA 3VFGH 4ENED 5F7DA 3CFCH 4RMSA 2BNQE 5J0BA 2Z35A 4GIOA 2ZXGA 3FB8B 4PJFA 5B39G 5JR1H 1E3XA 2F1AA 3QZBA 1UM4H 2HPTA 1IM3D 5FO7A 2Q7NA 1HT6A 4IKLA 3MA9L 2QSCH 5DXWA 3H4HA 5E94A 1TEYA 2PCPB 4UYPA 1XF3A 3AREA 5I71C 1GJWA 4PN6A 3KCWA 4J3OD 4ZPVA 1XR8B 2L7JA 5T1KB 3SQRA 4HUVB 3CH1B 4PLJC 3CSTA 5D1ZD 2GEEA 5FFGA 3D33A 1YQ2A 5ESAB 1VA9A 5IB1A 1QBLL 2A4ZA 1OAQH 2DWXA 2UUDK 4RX4A 3HB3D 2Z3FA 1JYXA 4Y4HD 3P3UA 4TRPL 3EH4B 5JHLH 3HI5H 1FV1A 4A1RA 1MI5D 1VJSA 4YHIA 4K55A 4ZUWA 5DHYB 3SKNB 5LBGA 3V4LA 5HYJD 4D7BA 3RWIA 1EFXD 2NT1A 4M5YL 3K5RA 4N2CA 4D9QE 2FATL 3CFNA 1WS8A 4P07A 5MENA 4L29B 3BAKA 2BMKA 3IRCA 4H8WL 3BPCA 3KE0A 3ZVVA 1T04A 4BDVA 3U1QA 5GGSB 1YEGL 1OHZA 2IWGA 3EH5B 3HAEH 3LAFA 5E2TL 2CLVB 1N3NB 4JE4B 4AKQA 2Y1VA 3BKML 3QZPA 2XWTA 4G59C 4IGBD 3S35L 1LD9B 2XN0A 4FYQA 3SODB 5GS3A 2E86A 1XVSA 2H6UA 3K71A 4NJAL 1HL4A 2EH8L 5EU4B 5AW6B 5HHNB 4PV8A 3QAQA 1G4RA 4DK3A 1K85A 3QWOB 4FLOA 2NYZA 3DX9B 5B8CC 1K72A 2F54A 5EUKA 4K94C 3BPNB 3UJIH 3WNNA 2OZ4A 1JGVH 2Q76B 1NEZB 1ZS8A 3D18B 4QTHA 3VXUE 2PP8A 4K5NA 3BPLB 4NQEA 1KACB 1GY2A 1U2HA 1DVFB 3LVTA 3ZRFC 3BQVA 4Q9RH 4K7PH 4X7CC 4TNWK 1JPST 3BVWA 1L9OA 5F96L 5LUMA 4NO0D 2FVNA 2WHVA 4L8DA 4ODUA 2V2WB 1BQLH 2YPVH 3CFKA 2OL3L 3RZCC 3OKOA 1U3HB 2AJSH 3TXAA 2DQUL 3FCTA 3LEXB 4OZFH 1G0DA 2H8PB 4BA8A 2PP9A 1NFDB 2EIBA 4B9KC 5EEZA 3BN9D 4LCCC 5AWNL 3W9EB 4K71C 2VDRB 1WCBA 2F5AH 4OUUA 4HHWA 4QT5A 1HEZB 2ZCHL 1T21A 3QCVH 4AV0A 5GJSL 1GGTA 5I1EH 4W9ZA 2OCJA 1SYSB 2J72A 3WY2A 1YJDC 2P8LA 2GC4C 3I3DA 4PJAE 3OHMB 5D4QA 2Z31B 3PABB 3KWUA 1MELA 2Z92A 3QUYB 5EORH 4B0MM 2C9SA 4KJPC 5HI4D 3VA6A 1WA0X 2DJSA 2ZSWB 3BC9A 3VI4F 1Y1UA 5KZCD 3VFPA 4XH2A 5KVMC 3FUEA 3DVNB 4MCYA 4JRXB 4AGOA 3BZEA 3TBWB 3GBNH 3MRHB 4JRYD 5GS0H 4LAQL 4URTB 1J9TA 2CGRH 3RIAK 2Y36L 2D03H 3KD4A 3LZNA 5I0ZA 1GS7A 5GGRB 1RFDH 3SKMA 3WN5B 4P3WA 4NUQA 8FABB 1P7KB 2ESVB 2LAGB 2BZDA 3OAWA 2QADC 1VFBB 3F01A 4LSQH 5E8DL 5CFHA 1AQHA 5DJYB 2PMZA 3L3HA 3TBYB 1NMBL 3I9GL 1A9VA 1T6BX 1NPUA 3QQ4B 4Q56A 3BUYA 3TH3T 5JW4M 1IIIA 3BO8A 3TJEH 3MX0B 4HCRA 5KS9B 3BD4A 3ZN6A 1KYUA 3VWKD 1OB1B 1HL5A 1CFVL 1UH4A 4GRLA 1ULVA 1WV7T 4ODHL 1LK3H 4I89A 3V4UH 5L8LB 3TZVD 3QZWB 3KPSD 3HCVB 1THAA 4U1HA 1V3MA 3BPOB 4OTXL 5I74B 1QTYT 4P57B 1AHMA 1CWVA 3GKWL 4Z7QF 1HESA 2I27N 5HI5D 1EHLH 3WS6A 3SCMC 1MJ8H 3MGOA 4JHWL 2TSBA 3P77A 1ZT4A 2PF6A 3QE5A 3S88H 1CGVA 5GZOA 3C60A 2PETA 2W88A 5KSVA 4M5YH 1WO2A 4RMTA 2FATH 2K9FB 3NJHA 4J3XA 4XMVA 4R84A 5FKAA 5AZ2L 4E41A 4F58H 3HTLX 5I8EB 2UX6A 2WNGA 3VH8G 5C0EB 4MWFB 3C6LB 4Z1PA 2JKLA 2AVGA 1I8LA 5E2TH 4G70B 2Q7YB 3E3QE 5H37H 4FKEA 5JIHA 4GKLA 5EEVA 5DSCA 3BKMH 1EX0A 2HVKB 4R9HA 4CW1B 1QRKA 2K8MA 1ORSA 4TUKL 5FO9B 2VLMD 3NCYP 3NUKA 4F8QA 2WXKA 4J7RA 4P23C 1FF5A 5L4IA 3TASA 3N91A 4EBQL 3AS1A 1ROWA 3RWHB 3EO0A 5ERWB 3THML 1X5HA 4AMXA 1YEEL 3AAZA 2OI9B 4N1EA 4WIQA 2DPKA 4ZAKD 2B14A 4YDJB 3E1F1 1VFAB 5C07E 4FG2A 5T3XH 3U36B 3EFOA 3WE6B 5F96H 3X1FA 1SJEA 1ZSHA 1IJ9A 5CFAA 1V5JA 1J1XL 1E5ZA 1AKJA 4TUJB 4L8CA 1S7QB 2IOOA 4WGVB 3RWCA 3PQYD 1NCWH 3C5ZA 5IK3B 1DEEA 4WCYH 3O6FC 5AWNH 4WNQB 4HIEA 3QJOA 3NIGE 1TYJA 3FQYA 2W0KA 3SQBB 3VAEA 1X4YA 4LZKA 3QBTB 1JZHA 5EN2A 2WN3A 3UDWC 4QUOA 5T3ZL 4AYID 5JOFA 2JK5A 5JXEC 5F72S 3CZKA 5DUBB 3HFML 5C0ND 5C0AB 3TFKC 4BSVB 5F9WC 2QGDA 2I9TB 4NN7C 4Q89A 4A2MA 3UPRA 1A3ZA 3UIYA 1KFGA 3BEVB 5DMKA 2O5YL 4PGBA 4HKJB 2VDPB 3CFIC 3NJGA 1EO5A 3L95B 3HJEA 4OF7A 4U4BA 3U0TA 1WFOA 4Y4KB 2IGFH 4MQXC 5I5RA 4N28A 2GI0A 3RRQA 4KHTH 3KLDA 4MNQB 3TBVB 1LVEA 2JFCA 5CINH 2H9GB 3MV9D 4O9HL 4JKNA 1MQKH 1SHMA 2K3HA 3DNKA 3VXTA 1HKLL 3MRDA 5EZJA 4D2NA 4M48L 1KBVA 5IEHB 4JZJB 4GBXB 3MBWB 1IO4C 2AV7B 2UXFA 2B3RA 4PJDA 3RVVC 1KEML 4OTXH 1B4TA 2JSFA 4X4ZA 5D7SH 1E5UI 3ARXA 3OJVC 2DF3A 1SLVA 4NERA 4OGYH 2MOVA 2QFPA 3MCLH 4L8BA 1ZHKA 4XODA 2E74C 4MXQC 4ZMWA 1U58B 2K70A 4LVHB 3WHXB 5T5NF 4AL8H 3CC5B 3CU7A 5IW3A 1YLBB 2VUYA 5GGRY 4NQDA 5A2JH 4BEIA 2C9UA 4LRNH 5AZ2H 3FHEA 3IJHB 5EOQL 1HJCA 2GK0A 3G3LA 3JV4B 5K33A 4YFDB 5GGQL 3S8FB 4XOEA 5AOZA 4Q2ZB 4AV4A 2ENYA 1OTSD 2SEBB 4LVOB 3PDDA 3WIIL 1FG2B 1TQBB 2BP3A 4PJIB 5IQ9B 2M8XA 1YY8B 1S9WB 2ITEA 4I87A 4Y1AE 1OHQA 4YC2B 4OVUA 1T1XA 1DDHB 2JJVA 3NP4A 3PV6A 1ZLVK 5CZVL 2I24N 2CDEA 4JN1L 3GHEL 3BE1L 1IGTA 1FWXA 2OK0L 3VM7A 3D08A 4OCMC 1X9QA 4Q52A 3HPLA 2FEDD 4EBQH 4K4KA 1O6SA 3RQ3A 1OT1A 1D6VH 4KVCH 3Q6GL 5HGAB 3HA0A 4YSRA 2WXGA 1WZLA 3D3VE 4V1DB 3CSYB 3IJEA 5L8JB 1OLLA 1WK0A 3OKKB 4ENZA 3BAJA 4QHLA 4X6DE 2J6WA 4P9HL 3BP5A 3RFZB 1U95A 4GP8B 3X1BA 1W0YT 4EZKA 5DZPA 5C0BD 3T8VA 1JK9A 3QHZH 1DJWA 3GSRA 5CN2A 2UY6A 4JZOB 1TIUA 1BM3L 2W0FA 3QP3A 1KCVH 2ICEC 2FYYA 2OL3B 1ZXQA 2VMJA 2GIYA 3OJMB 4HX1B 2F15A 1JGEA 3VXQA 1AXSA 3O2DA 1EJ6A 1RAMA 1SY6A 1U8HB 2J21A 1YAZA 1P1ZA 1CYGA 1P4LA 1DFBL 2G3XA 2LABA 1E6OL 3WELA 4N8CH 4U2YA 3EO1B 3GS7A 4WU5A 5KVFE 4DGWC 4D7PA 5IJKC 2QGEA 4PWEA 1PVHA 3LRSA 4EO5A 5FYKL 5GGVL 3BZ4B 3VO0A 5T3ZH 4XGZA 1YMMA 2P7TB 5G55A 4ZSOB 4MNGE 2ZXBA 3HFMH 4BZ2A 4DZBB 4JO1H 4JFVA 2AQTA 1ACZA 1XCTA 4LCWB 3PREA 3VGBA 3TS8A 4HC1L 1K8IA 1ZHNA 2B8OT 5E1AA 1U8IA 1UD3A 4BUQA 1SMAA 5A3ID 5CCHE 1O7SA 3SPIA 1E5CA 2F0CA 4G8GD 2PCFB 2X0VA 1H3UA 3STLB 3S37X 4DTGH 3SO3C 1FNSH 4K7PY 2CKBL 4AG4H 3OHXB 2IDSA 1ZTXL 5DFVD 1BX2A 5E5LA 7PAZA 1KLGB 3KLLA 2R0ZL 3T6QC 2V5MA 2KLSA 3RY6A 1NCCL 1DHKA 1OCCB 1NC2B 2XZCL 2WUCH 3PUCA 4HWEL 5EIVA 3AUVA 3QYNA 3MRKB 1LE9A 4O9HH 2K4AA 1KJ3L 1R6VA 2VZOA 3KPQA 3OR6A 2YRBA 4JFEE 4NJ9H 4YZWA 3U9UA 1FO0H 4Z7NE 4ZZKA 4FQCH 4F93B 2D4FA 4PSRA 3WFEL 3QISA 5C6WH 1UT1A 1C1EH 3O6LL 1KEMH 4GT0A 2XFXB 4B9YA 5CP3H 3RU8H 2NZ1A 1ET5A 5INDB 4HJUA 1FORL 1GRWA 4AKPA 5DRXB 3W0WD 4JFDA 5DK0A 3TFBA 4YSTA 5J6HA 3D87B 4HSCX 3Q13A 3SDAC 4EIZC 1JPSH 3MRJA 1OAKL 3BWSA 4PV1C 3Q3GA 3NIDE 1ZJAA 1YNLH 3V0FA 5ITFA 2G9HB 2ZKYA 4G6JH 4TQEH 3S37H 2CUHA 5E6IC 2ODIA 4JFSA 3CZUB 3U46A 4ZZFA 2FB4L 4RRPM 4XT1C 5DLMH 2VZTA 3ARBB 4Y2DB 3B2UD 1VZHA 3EJCA 4YX2L 3GHEH 2H7WA 3BE1H 3QPXL 5EIIA 1XF4A 4OFYD 2JJWA 5GRVL 1I4FB 3OR7A 5D2LA 4OVVA 3K7UA 2OK0H 1K5NB 2JKWA 3MAWA 5LXVA 4IJ3C 2CRIA 4Q0XH 3ZSTA 3RPKA 4LSUH 3QG6A 5JQHC 1K8DA 4L0ZA 1R24B 3NEXA 5J1AA 3MLVL 3EYFA 3PE9A 1TJIL 1XIWB 1PY4A 1IEAA 3QFJD 4GPVA 2BVPA 4QYOB 1NL0L 2ZD0A 1O9VA 4Z7WE 2I60L 4UM8B 2V5RA 2NUPB 2X6CA 1GZPA 1AP2A 4UT7H 4P2YA 5DMGC 2QQLL 5KN5B 3HZMA 3IYLW 5AQ0A 4FZ8L 1Q1JH 4Y5VC 5IB2B 5IW6B 4HUUB 4QLRA 5CJ8A 4CMMB 3ARGC 4MMYA 4X5WA 5MP6L 1HAUA 5HDWA 1RERA 5AB1A 1XFPA 2E7HA 5D6DA 1UJ3A 1CVSC 2BY1A 3NDYE 2AQPA 1T7ZA 4KU1A 3UTSA 5F6IB 3QDGD 1E6OH 4YDNA 5GRUH 1S4IA 2HFFA 4XWGH 1ACYL 1G7IB 4N25A 4UQ3B 1U8JA 2XRAL 3BH9B 4MHHG 1FFTB 2J5WA 4JPVL 1MFNA 1BQHA 4DP0X 5CZXC 2Q3ZA 5CJOL 3QUMA 2OMWB 5J11C 4QAMB 3IXAB 1FFQA 3OAZH 3SGJA 2YLKA 1I85C 1M7UA 2B0SH 4XCYB 3SJVE 1NUNB 4EPSA 1UKQA 4JY5L 3OZ9H 1W6WA 3W81A 2AI0H 3ABMB 4KV5E 5KOMC 1PPIA 5A7EA 5FFOA 4HIHA 1NGPL 5HYQA 3VUAA 1OGSA 2B59A 2BW4A 3BW9B 2KZKA 3FQUA 3LHPL 4G1MB 3FO1B 1MXDA 2JKSA 2IOMA 2FZ3B 2FT7A 2P1YA 4QAWA 1QO3B 2GFBA 1UWGH 4AGMA 4YE4L 2NXZD 3C12A 4JE0A 4LRIC 1CE6A 3QXDA 1MQ8A 1GMEA 2EYSB 3KGRA 1UA3A 3N3EA 3PGFH 4MS8D 4NRZA 2J4WL 2RJMA 5JPNB 3O6LH 4ZBJA 3DHPA 4CADB 1MHCA 2X2YA 3GJEA 5L0QC 1A65A 4X5PA 1ZHBA 2VO5A 1JPGB 2DM7A 3D0VA 3LQZA 4U6VL 4XE5B 2IFGA 3ZIYA 1R3JA 4E9YA 4HLZH 2JI1A 1NDMB 2EICA 2GTWB 4HISA 4GLRH 3MOQA 3H3BC 4U7KA 2BOLA 4F2FA 2EXWD 3B6SB 1LQSR 3PGCB 1OEZW 3L9EA 3MLYL 4XPBH 4PREA 1T03H 1QPKA 3N40P 1IJNA 2HRLA 1XBDA 2Y24A 4O4YL 4YHPA 4OCNC 4F33B 4GKNA 3JWOL 3HC0A 4KX9A 4RISL 5A6IA 1BWMA 2FB4H 1DLFH 3P4NB 3CZFA 1CFMA 3PF2A 1JTPA 4IU3B 4TL4A 4XMXA 3L1OL 4PWGA 5DJ2B 2W94A 4EMZA 1DVZA 4YX2H 3NJMA 5GHWL 1MCNA 3K6FA 2DQEL 3FQTB 4YVUA 3ZDXF 4ZOAA 2FQGA 4WO4C 2XTJE 4FL4B 4E9TA 3T0EA 3GRWL 3DRQB 3SDDD 3FSVA 5SX5H 3GIZL 2FJUB 3VRIB 3MLVH 3EF4A 1TJIH 2ARJQ 4RETB 3VNZA 1ZEAL 2Z8VC 1BECA 2M83A 4ZUUB 1QFHA 4IKJA 4KY1L 1SBBA 4XZUA 2EAEA 2R2HA 3FZUD 4L8SB 2EVHA 4I0PC 5DJ8B 3L4TA 3MMEB 1CGYA 3KM2A 5EUOF 4Y89A 1HHJB 2IANB 1SHSA 3EGXB 2N01B 3LPGA 4GAYA 1EEQA 3GSNL 4BFNA 1Z9NA 5HHVL 2ZX7A 2ATPA 4LU5H 3VXSA 3L81A 3SE8H 4AYBA 3BPLC 3U79A 1WUZA 4FCAA 3OXSB 1DVFC 4GLRI 3II2A 1P4BL 1FZJB 1H6FA 5LXGL 4ZXBD 4R4BA 5K9OA 2N7SA 4V33A 3SYCA 2RB8A 2BRQA 2AQ3A 3RTQB 2OZNA 1EXUB 2R69A 3SKOB 4I2XB 4DGYL 2RACA 4LQFL 3W56A 1ACYH 4QF1B 1M05A 4AM0A 2XRAH 4AOFA 5C6TH 1WHPA 5F7UA 3PWVB 4LBEA 2WQXA 3VG0L 5F7FA 5CJOH 3LKSB 4W68A 3LH2L 2G2RA 4G11A 3GB7A 3F7PC 3X13A 3OXRB 1UJTA 4ZX3A 4M61A 1JBJA 1G7JA 4UAOB 3VX0A 5FGCB 4PCSA 1UH3A 4JLRB 5CP7B 4D0CB 2WXLA 1IZJA 4PSPA 2Z31C 3GRBA 1S9VB 4E0RB 1NGPH 3FYIB 1W80A 2J8UB 2R1YA 5ANHA 3IJ9A 5FW8A 4APXA 5F9JB 3L3GB 1T2XA 3NDZE 4OZHB 3B9AA 4MNHA 4CSTA 5LAPA 2XYBA 3CLFL 2QPEB 4TULL 1CD9B 1AHWA 3VX1A 3FUHA 3MLWL 3PG2A 4ZOEA 3BSHA 2CKBB 3NFNB 2G60L 4YE4H 4QEGA 4W6XB 2NY2C 2MKWA 2L7UA 2P24A 1Z1WA 3QIWB 4HV8A 5E2VL 2XV3A 1GR7A 1MF2L 1D9KA 3SOBL 4LMQI 2UYLA 1EEYA 1EHKB 3SD2A 1A2YB 3T3PE 5DZVA 1CXLA 1PG7X 1ZMYA 1IM9B 5CSZB 5SX4H 4Y19A 2XBDA 2ZXCA 5HI3D 1X44A 2NX5A 1NIBA 2V17L 1BBJA 1AR2A 4FLSA 4UIMA 4OFKA 4OLUL 1CF1A 2GABA 2WBJA 3WL9A 2YPLB 1I7ZA 1OGAB 5D1QE 4YHNA 4IIQB 5KEZA 2EECA 3OB0H 3BPOC 3HHSA 4Z3GA 2WTRA 3FT1A 4FTVE 4Z6AT 1W0WB 4TVPD 1CLYH 1BA9A 2X89D 2FNBA 5GSVA 2VL5A 3JWOH 4RISH 1KSRA 4B3VA 4HH9A 1V27A 5G4OA 4GP5B 5GGUA 3IVKA 2OSXA 3EJTA 2NY3C 4FZEH 4JFPA 1WZ1H 3K72B 5T5NG 4L3EB 3WUZA 3U4KA 4A7QA 4ZFOL 3SEPA 4XAKE 1D5BA 4UMGA 4OD3L 2DY2A 1I8IB 5CS7A 2WJ5A 2EVFA 4BHUI 1YEDA 1HHKB 4ADGA 4YHLL 2CHNA 5I8OH 4BXSV 2EIJB 1ZPUA 3GRWH 3Q06A 3H8NA 2NW2A 5HYJE 1JE6A 2FSDA 1TR7A 3G6JE 3Q8BA 3QEHA 3GIZH 3ZGHA 4ZMLA 2VXUH 3QEQE 1YPZA 4BCZA 2NY7H 3EZ8A 4G9FA 4LCIL 1PG7H 1I3RB 1AGBA 1PZCA 4FG0A 4KY1H 1NAML 5L8KB 1TCRB 4QRBA 5SX4I 3QHTC 2DS4A 4MMZB 3DARA 4NZRL 1KIPA 2OI9C 4J8QA 3E6FB 4RQQB 1SJHA 3GSNH 3QC6X 4WTWA 4Z76B 5HHVH 3VI3A 1J8HE 1CD8A 1WAAE 35C8L 3NSJA 1BV8A 5MEPB 2V8LA 5KVGE 4E9XA 1P4BH 3CZLA 3WFBL 3EHBD 3KLHD 1HJBC 3TBSA 2IAMD 3JWDH 1QA9A 4CL7A 4HCFA 1CXHA 4LVNB 4BKSC 4LQFH 4PGDB 2GJ6B 3HPJB 1RSYA 1RUML 3QS2A 4HIPA 4ETYA 3ZDZE 2FJHB 5ENWA 5HVGB 4OKVB 2K4WA 1HZHH 1B9ZA 4K8RL 4E9RA 4GKZB 3VWJA 3D4YA 3NOIA 4OCWL 3UMTA 3CFJB 3LH2H 1Q0XL 1INDH 3EOAB 5TD4A 4XVJL 2Z91B 4JR9L 1JPTL 4W4OA 5KVDE 1O7DC 2Y7MA 3BHBB 3OKLB 3IWUA 3ULVH 3MRFA 3RNKA 3RI5K 1XXDC 3MV7B 4M7LL 2VXQA 5DZJA 3UG5A 1AS7A 4OCYL 3FT2A 4EZMA 2NY1B 1MZZA 3EJRA 3T09A 3O6KH 5SWSE 5J7CC 4G43B 4CA4A 4O58H 2Y2TA 3HC4L 4MJHA 5AKRA 2H3XC 3T5WA 2PNDA 3KW7A 3FUFA 4PLJD 4XBEH 4HZLB 4Z95H 5JO5B 4HQQH 1P7QA 1QLRA 3ENEA 2VDNL 4PD4J 2Y2YA 2YLHA 4CMHC 3VE0A 5IBLC 3B7YA 3GS4A 5GS0C 3IPBA 1IBDA 4N68A 3D39E 2X1QA 1TMQA 4ANWA 4PJ8B 4YHKH 4JKPL 3IJ7A 3EFDH 1GW0A 3U48A 1HOEA 4MMXB 3HC2A 1OPOA 4G8FB 1UA7A 4AE1A 2MTPA 2QVKA 3C5SA 4Y4FB 4MZRA 3FTVA 4MQ7B 3IDGB 1ZDSA 4OR1A 1W8NA 3QARA 1EHNA 2ZYSA 4JY6B 2X53A 4N2KA 3UAJA 3HZVB 3O9WD 1YNTF 3F83A 1QEWB 4JZJC 4NKQB 5IHUL 2Q86B 1VCAA 2RR3A 5TE6L 3G9VA 43CAB 5AVVB 1DQDL 2VLKE 4K15A 2PR9A 4QWWD 4PJEF 1VFMA 4Y9CA 4OD2B 3QO1B 1JN6A 1ZJBA 2BK8A 1BPVA 5EUOB 2HSIA 2BNQA 3FT3B 4RFNC 5E08L 2CLZB 4LVHC 2G2NA 3FRUB 2FO4A 1ES0A 4WDIA 4YDIL 4B5ZA 4NRXB 3WD5H 5CO1A 3FO2B 4XAWL 3X17A 1Q9KB 1QRNE 3MKKA 2OULB 1AJ7L 1L9TA 4K07A 4LPUA 4PJAF 3D85D 4LVOC 4H8WC 4A6YH 1TQBC 5FA4A 4G7RB 1JAEA 2VW7A 3UZEC 3KPPB 1CQYA 3RZCD 2ICCA 3MRRA 2YO3A 3NCCB 3SE3C 1NAMH 1C7TA 1GYUA 2F19H 3B9VA 2B39A 2FHCA 3I84A 3B5GA 4KUZH 4KO7A 2DWEA 4NZRH 1PY9A 1TUPA 5JIQA 4B27A 1LE5A 4PBVC 4AVKA 4PWIA 4UNIA 5EC1A 2BWQA 2P4AB 3RFZC 3GSNB 3NMEA 3WFBH 5FCUL 5EZPA 1AD9B 3US9A 3N06B 4R97B 2ZOLB 5I8CA 5E8EA 5ISZD 4L2LA 2AJVL 3BCFA 4LKXA 5AZEH 5JYMA 4QHUB 3HMWH 4K8RH 5ETUA 4NGHL 3MNVA 1Q0XH 2JELH 3RPBA 3QSKB 1DQQB 2A73B 1MWOA 2W07B 1MVUA 4YBLC 1JPTH 2ZUSA 2J12B 4YPGB 1NUFA 1NCHA 2MTAA 4IOIB 2QADD 3S5YA 3LN4A 1FC2D 1TU2B 4M7LH 5JORB 4GAAA 2D7MA 5T33H 3PJSA 3RGVB 5CD3B 3AQYA 3VXUA 5DD1L 1I1AB 3FU7A 2E3VA 3IJSA 4JPIB 4MDIB 4B9GA 2WO3B 2J1YA 1YYML 3GTVA 1TZHB 3V6FA 1UM5L 1HSAA 4X42A 3WEOA 3DTXA 4LLYA 3CZJA 1IKNC 2Z6FA 1CI5A 4PWHA 4YFEA 4PRPE 3OHXC 1IILE 5T8IA 2B2XH 1F3DH 4EDWL 1CU4L 4U6YB 3SCMD 4O02A 4AVJA 1MEXH 1KCLA 2MQ3A 3ULUE 4Z7IA 3BXNB 3K2IA 4NUGL 3C9NB 2BFGA 1G7QB 4DHLA 5DI8A 4L4VD 4PJAA 1ILUA 4G7SB 3O11B 1DBML 1M6UA 1RIHL 3UEZA 2BS71 3VFRA 4F9PC 3JYBA 2CO4A 2R0KH 4PJ7F 2IPTL 3ZPDA 2WZ0A 4TUOB 2X38A 4JW3A 2EE0A 3MGTB 5IHUH 4ZTOL 4N2NA 5TE6H 1JD9A 2WZPA 4WV1A 2X1WL 4KZ0A 1RK0B 1UWEH 4HHAB 1ZANL 5IHBA 2ZAHA 5AW8B 5MI0B 3MV9E 5TF1L 1P2CA 1YMHB 3FN0H 1ED3A 5MHSD 2PTTA 3GUTA 3WS3B 2BIQA 3E6HA 1D5IH 2Z0BA 5JIMA 5ID0B 5E9DB 3WNOA 4P23D 4JZNA 4QHNB 2EDEA 4YZFF 3J7HA 4BFIB 3HRPA 3H53A 4KNQA 3VM5A 3A6CH 4ZXBA 1OK8A 4XNMA 2EC9T 4QO1A 4PR5B 4AYDC 3WIFA 1Z9PA 3A4EA 4F15B 5CCJA 3GMPA 4ZFOB 1DVUA 4YHYB 1LDSA 5B39B 4N5EC 2W0LA 2YGQA 4N2DA 1L9MA 4OI9A 3CBKB 4U3SB 1XDTT 4ONOA 3ARBC 4WQOA 5DYOA 4XMLL 3UBXA 1EWHA 2VZVA 4CN1A 5KSBB 5M94B 1JZ4A 4H8HA 1FAKT 5C08B 1DBAL 1JERA 1S3RA 3E8VA 1Q94A 1SVCP 3F12B 2FEEL 1KT2B 4WFED 5C0CE 5HVFB 5L6YL 1NCAL 1E5YA 3LKNB 2OBGA 3QQDB 1MIEL 2NXYD 5BVJA 2IVFC 3WKML 1B90A 5BUPA 5HHXL 1UXLA 1NAMB 1ORQA 5FGBA 4F7EA 3B2DC 1KGCD 4YDKL 4ZMPA 3SGKC 2EYRA 4AGPA 2VAJA 1I7RA 3LEYH 3UTQB 1AGEA 3GBEA 4OI8A 1VCBC 4KKPA 3V4VL 3CFDA 3RDTA 1G6RL 1QR1B 3KXFA 3TIDA 3E1ZA 4L1DA 1U41A 1LDPH 4LP5A 4ZT1A 5JXED 3UMNA 3F04A 2VERN 3TFKD 5D1XE 1OAYL 2ARWA 3CDZB 4YXLL 2WLNA 4MD0B 5GGTA 2G4EA 3WHE0 3GO1H 1JSYA 4NO3A 4A38A 5JW3L 5C0BE 3FQXA 4WAFA 4ZQKB 5F6IC 3R0NA 1DQML 2WPGA 1OW0A 3A3YB 2PABA 3GMRA 4OCXL 3D07A 2GJRA 4DPRA 2HFGL 4WSKA 2HJFB 4X6EB 5HXMA 5JW4R 4GH7B 4XCEB 3B7SA 1T5WB 3BVDB 4A2GA 3EYVB 3LXUX 3JT0A 4UT6A 2OMVA 5ICZA 4JDZA 4KXZH 5ALCL 4XNZB 3RX9A 3HBZA 4DGIL 2C9XA 1DJGA 5I5JA 5F1SA 5I76B 4PJEB 4XO3A 1H3XA 3MCYA 2O30A 2BHYA 3RVVD 2D2CC 3A5VA 3M1BA 1NBVH 5LCVL 2PR4L 4EN2A 4X5XA 3MJ8A 2VDNB 3FCBA 4HU8A 3T3MB 4PY8J 4BK4A 4FQQB 1IAIM 4LPWA 2YMOA 5GRJL 2H1XA 4JG1L 2EINB 1M2VA 5LQBL 1CK0L 4NUGH 4WF7A 4G9DA 3DV6B 4NPJA 4Z5RA 3SDCA 1Y6KR 3BWZA 4X6FB 4AYFA 4FADA 4P2OB 5DVPA 1DBMH 5F0PB 1I7UA 5F3FA 1FLRL 2FSEA 1PDKA 1GAFH 2VDLL 1WLHA 5I0WA 5JPNC 3ULSB 2X3CA 5F1KC 3ZOAA 4HPHA 5E2JA 2HN7B 2ITDB 3D48R 4QRUB 1XO8A 5TF1H 3O0RH 3M7OA 4KVPA 4X7EC 3LSOB 3F84A 4QOKB 4BQ9A 2EIZB 3U1SH 2CBTA 3IDXH 4PV9A 5HHPB 1A47A 1OLZA 4HJJH 1E9OB 1AVAA 3QC5X 4JHBA 1E2VA 1W9XA 1G5GA 3G04A 4AZ8B 1KYOK 1UXWB 2QPDB 2PWFA 3MZTA 2OZ4L 4ZMZA 1FRGH 2CU9A 3IB4A 4KXZI 2NTSP 1F2QA 5IB5B 3MBEC 1RI8A 1NDGA 3TVMB 4KNUA 2FR4A 2VLLB 3AS2A 4RNRA 3UJTH 2LV4A 3Q44A 3MR9B 3EH2A 4LFHG 3BVNA 2ZG1A 4R7NA 5TDOB 4XMLH 3T65A 2BNRA 4AX3A 4LCVA 3P0VH 2OFQA 1LO4L 1DBAH 4HDIA 3SBWA 3WNKA 1YN6B 4ZODA 2VQ1A 3TNNA 1N59A 1LO3H 3VTTA 5L6YH 4FL4C 3L2LA 1MIEH 2WXMA 3HS0A 4F9LC 4ZFFB 2G30A 2YIHA 3ZE0B 3Q6FA 4UBDC 2Y7OA 5IFHH 3KPRE 3UAEA 4GSDL 3FT9A 3MLZL 1LO5A 3A6BH 3H85A 1DYZA 1W8EA 1G7LA 4UOW1 6FABL 1KV3A 3NIFF 4HUXB 4P2QB 1NIEA 2XVLA 2R51A 5PCYA 3VFVA 4DVRH 2Y3AA 3L4VA 4PG9A 3PDOA 3QZNA 2BC4B 1OAYH 1B0RB 2HYMA 2HAZA 1HSBA 4DESA 1JGLL 4OKDA 4DKEH 3BP7B 3EOYG 1UOVA 4G71B 6PAZA 3QJRB 1RZ8B 2AK4A 3F65A 3RTQC 5BCAA 1B3JA 4AW7A 3TV3L 1QSED 4KTEL 1YRKA 4UDTB 5A16B 5EA0L 1ZV9A 3PWNB 3S96A 15C8H 1BAWA 4DJMA 1ID2A 1OAXL 2Q0ZX 3D3VA 3BT0A 2JJSC 4U1MB 1HYSD 3SGEH 4X6DA 1HK6A 4MSWA 4P5MB 3TONA 4UAOC 4HF5H 3ZKXC 5ALCH 4XWOD 3KYAA 4H5SA 1RVFL 3BN3B 4OSUH 4U6TA 4ZMNA 2AQ2A 3Q9QA 1F11B 3BRFA 1Z3GL 1UFUA 2XV2A 5BRPA 3EYQC 3FXIC 1LMKA 4Z77A 3GXFA 3OKMA 3ARYA 4Q14A 2DB8A 3TBTB 1BAFL 2BM3A 3SDXB 4AZUA 2VWEC 5B8CA 4NM4L 1I9IL 4R96B 4X7FC 5EBWA 4XNQA 3SDAD 3TJPA 5EBLA 4JM2A 3EJJX 1JWSB 3AY4C 3GC3A 3QIWC 3D2UA 4IRJA 1LMIA 2VLRB 3HC3L 4EI6B 1FLRH 2YBGA 4JO3L 1JPFA 4NI6A 4KY2A 4NQCB 4PWFA 4OIFA 5FC9A 4MNGA 5JHAA 1EAJA 4KRPB 5DWUL 1P7HL 2HXAA 2GT9B 4E42A 2BY0A 2IALB 4Z7WF 5DUJA 4QYAA 4KQ3L 2GITB 5DD3H 1NWOA 3APDA 4IHOA 5LHDA 4N3TA 1GC1L 2ADJB 3RL1A 4DNLA 3WUWB 4M29A 2XPZA 1NBQA 4YJZL 3BKYL 1D5XA 2EDKA 2UXGA 1AXTH 1KLUB 2BINA 1OD9A 1X9LA 4CNIB 5IEKA 4E68A 2OQJB 1H15A 1HHIA 3W39A 3SGEI 4YS4A 2WKLA 2OZ4H 2XTLA 1KTKE 3CN4A 5EO9A 2N0KA 3LB6C 3SB3A 3WIHA 4D0BB 4NNXB 2E27L 3MJGX 4S10A 4H0HB 1FNGB 4FTDA 4TQPA 4Y5XB 5BXFB 4LDLB 1ND0A 5EZOL 1GGUA 1F1DA 1MAKA 2A99A 3VD3A 2XWJA 3WTSA 2YKLL 3TEUA 5DMGD 4CN6A 5IJDC 4FQIH 3EBGA 2XQYK 4UU9B 4XO9A 1E27B 5BRZD 1IGML 4U05A 1KWKA 4OZGE 3ARGD 2BOCB 3MLXH 4U1KB 1XEDA 2CMRL 3MO1A 5TE4H 4NHUA 2CR6A 1IBZA 2Z4QA 1DANT 2W65A 3IMSA 5KSAB 5EF3A 3WFCH 5DJ6A 3LS5H 5D7IE 2WIIA 1JF5A 4GSDH 4MAUL 1PYWA 3DROB 3QDJB 1MCOH 2WWMC 6FABH 3KDPB 4U1GC 3LTVA 5CZXD 4ZFGL 1XH2A 2XFGB 4MMZC 3KYNA 4WFGE 3RKPA 3V4VB 2PP7A 1G6RB 3LEVL 3SD5A 2OXHB 1SF3A 2BSTA 1K2DA 4P2RE 4ODXB 3EOBA 1JGLH 4B50A 4YOKA 3PWPB 3K81A 4AJWA 3QH3B 2UY7A 3KEHA 3RJQB 3RNQB 3NTCL 3GBMH 5AYUH 3PWUB 4GG6F 4LVNC 5F7DB 2IH1A 2Y5EA 4O2EA 4RZCA 5AOJA 2XBTA 5EA0H 3H9SD 5F97E 2Z35B 1WSST 4I13B 4XMPL 4PJFB 3I02A 1OAXH 2O6FA 1JK8A 1Z5LA 3EUDA 4GMSL 3DBXA 3AB0B 1AC6A 1YDPA 2D3JA 1HIMH 1V55B 2NNRA 4HCRH 5E94B 5TDNA 1XF3B 4L18A 3AREB 2ZWYA 4X2UA 3GYRA 4KC3B 1WWWX 3V6OE 4EI5C 4JFYA 3MUHL 2Q8BL 5FYLL 1AE6L 3QNYA 1A6AA 4KAQH 4AK1A 5IB1B 2CSPA 5DJDA 2E4TA 3O4OC 1WBXA 3SKUD 5FYJU 5AB2A 2WBXA 4NM4H 4MKTA 4MA3A 1LLAA 3EAKA 2ZOKB 1FYTB 3TF4A 1FV1B 4YHIB 4ZUWB 2ISDA 4F37K 3U83A 1EO8L 2BY3A 3DMMC 1X9UA 4JO3H 3RWIB 4KUCF 2DQGH 1KJ2A 3IU4H 1T22A 3CVCA 5MENB 5DWUH 1VAHA 2GCYA 2BMKB 4I3GA 4MMXC 3BPCB 2WBWB 3SJVA 1RHHA 4K3HA 4MDJA 5A2IH 3CLWA 4BDVB 3M88A 3WNJA 2VDLB 2WTOA 1QABA 1GC1H 2YMXL 3O6FA 2OXGB 4W9CC 1C9SA 3BKYH 1U6AH 5I0VA 2XWTB 2ZXEB 4MB5A 2VQ4A 4YWGL 5D4JA 5I1HL 3RP1A 3WSQL 1E28B 1DBBL 4WO4D 1MAJA 4M8VA 3K71B 4O5LL 2ZAGA 3PP3H 1E5AA 3WFDL 1HTYA 4PV8B 2X87A 5IQNA 3O4LE 1FIGL 2GSIA 2WINA 3P4MA 4HWBA 3T0WA 4CC4C 5LKNA 2E27H 3ETBF 5EUKB 3NFPA 5KJRL 1ZS8B 4QTHB 2BIPA 4I0PD 4NQEB 1EZVX 2B9AA 4H8UA 2VDKL 3KWWB 3JWOC 5AKSA 5BO0D 2XVGA 1EUTA 1V3KA 3HZ3A 5CBEA 3I6GB 4L8DB 1IGMH 4ODUB 3DPDA 1OPGH 3CFKB 3OKOB 3FCTB 3GKZA 3JSSA 1DVFD 3O2DL 4NOBA 5F9OL 1HN1A 1E9PA 1SY6L 1UKTA 2F74A 3CUPA 3REVA 1WCBB 1KFAL 4S1DC 2H3NA 2JB5H 4OUUB 3LKRB 5B3SB 4QT5B 1U3HD 3S4SG 4MAUH 1MUJA 2X3AA 1I1FB 4N3UA 3ZE1F 1T1YA 4YQXL 4AT6B 4JL2A 2DTML 3GF8A 4A39A 3OAZK 4X8XA 2Z92B 4YL9A 4BZ2L 4CDGC 1MG2C 3Q0HA 2ARJA 4PTUA 2AK1H 2DQTL 3CDFA 1OCWL 4I3RH 1CTMA 4ZMQA 3U82B 2FJGA 3ZE2E 4AYSA 1T5XA 3D25A 1MHHA 4MCYB 2Z31D 4F7KA 1UEMA 3HI1A 3BZEB 2P5WE 3QUYD 4GEJA 3KHOA 5BW7C 1WE5A 2BXZA 1QSFD 4R97C 4TVUA 3E2HB 3UCRA 3LNGA 3AS3A 1MJUH 3JWDC 3SKMB 2FDBP 4FGMA 4NKMA 2DD8H 4JRXD 1AI1L 5E4IA 5EMYA 1Z2KA 4OFPA 3ZDWA 5A43C 5CLWA 2AEOA 4GMSH 5I5MA 4FDWA 3FNKA 4Q6IA 1CGXA 2ZUQB 5L88L 2NY2D 3L3HB 5CJBA 4JANA 4FQ1L 4HPYL 2ESVD 3HR6A 2H0PA 2C4FU 5CSBA 3BUYB 1F5WA 4J3OF 4DKAA 2WQUA 3BO8B 4DPAX 1KPRA 3RGVC 1WF5A 2F53E 5IMMB 3ULVC 4GRLB 2Q8BH 5IV2A 4HEME 5GISH 1AE6H 1FVDA 1H0DA 1I1AC 1ZVSB 2X4UA 1ODUA 3B5TA 3OG4B 4OGXL 1IX2A 2AQSA 4ONHB 5IB3A 1KTBA 2FQEA 3MGOB 4YPJA 3P77B 1T0OA 3GGWA 1M2OA 2FX9L 2JXMA 3D9AL 3OAYK 3C60B 1VF5C 3RUGE 1E4HA 5KSVB 5E6RB 3TM6A 5JW4Q 1JFQL 3ARPA 4CSSA 2UZXA 5HHOE 4E41B 4OLZL 2DL9A 4PWKA 3U6RB 4PJHE 3D69A 2NY3D 3NAAH 1FH5L 1QNZH 4QHKJ 4BZYA 4IBZA 3QNXA 4QRRA 4ZOBA 4F91B 5DSCB 1CGSL 2W1NA 2XVKA 3HMXA 5GRVK 3NA9L 4JQIH 5I1HH 1WC7A 3WSQH 1ORSB 1G9NL 1DBBH 3JUYA 3JWNE 3R06B 5B1CA 2K8QA 3KCPA 1TJGL 3NCJL 4RA3A 4CILA 2QPFA 5IREA 2GC7C 5CILH 3VMPA 4L3FA 3WFDH 1MCQA 2O72A 1FIGH 4U1NA 3EO0B 1ZHLA 2IV9A 5LVEA 2Y06L 3AAZB 3JTBA 1TSHA 1VESA 1R34A 3ZDZF 4BH8A 1PJ9A 3AG2B 2HKHH 4JB9L 3DURA 1ZY9A 2UXTA 4PVLA 1JUFA 2VDKH 4PJGE 3EFOB 4XNYL 5GS1B 2DLFL 1SJEB 4F2ME 4WJ5A 2FE0A 2CR0A 5AOMA 4F15C 5C70A 2E75C 4FFZL 1AKJB 4YHYC 2YPKA 1NCJA 1R1CA 5D96B 4L8CB 2WAHA 3S0PA 4P06A 1YEJH 4XPTL 3C5ZB 1JL8A 2DBLL 1DEEB 4TSCL 1XGPA 3MUZ1 1MWAA 5E6UB 5C2BL 4HIEB 5D1QA 3IPEA 4BCYA 5CBAA 1JZJA 4JFFE 2DQIL 4PJ5D 2HVJA 4Z7OB 3N40F 4FTVA 1L3NA 4AQ8C 5FPIA 3QUML 4JQXA 1JXJA 2DTMH 4H20L 2IQAA 3KBEA 1M4KA 4PY7A 2BIIA 1U93A 2CA3A 3NK4A 3DO3A 4ACTA 2JK5B 1MH5B 3QDME 2BNUA 4HSAC 2XN2A 2K6YA 1OP3H 4OQ1A 3UPRB 2EO7A 4LEXH 2FX7L 4I18A 1PQZA 2BS8A 4PB0L 5EF2A 3SY6A 4NN5C 4A2DA 2YQ3A 4PGBB 3ARTA 1QUNA 1CICC 4Y9BA 4BV1A 1HZLA 4N87A 4N2GA 3UAFA 4HIXH 3G6JA 3UP6A 1AI1H 3U0TB 2F58L 3QEQA 3N1QC 3VFWB 1VEPA 5ID1A 1UOWA 1M57B 3VFNA 5E6IA 4K8RC 1AZZC 5GS0D 2AVFA 1LP9F 5IBLD 1QHPA 4HPYH 3O2VH 3TP4A 2WLMA 4HALA 3H3PL 4Y2OA 4LIQL 1WG3A 2BIMA 1U8PA 1KBPA 2FGWL 4Z78A 1G43A 2FJFA 2V9QA 3VXTB 3MRDB 2D0GA 1CBVL 1J8HA 1YO4A 1WAAA 1QLEL 4WHTA 3V52L 4P05A 4MNQD 1J0ZA 4GSXA 4PJXE 1Q90A 5AL0A 1C16A 4PJ9A 4FG6C 4K5LA 2GUYA 1T0NA 1NA8A 4WI6A 4XB3A 2OMXA 5D2NB 2W80C 1EANA 5K39A 3D9AH 4N0RA 4XP1L 3CC1A 2BP0A 3QJQB 1O7VA 2VZ1A 3D06A 5CD5C 1JFQH 3IDIB 4IBUA 2EUVA 1BVNT 3G5XA 3QUZA 4M62H 2PCYA 2GK0B 4JVPA 3SO5A 2OX5A 4TYUA 1C8PA 2WP3T 4FXGA 1VRSA 4JG0H 4P2OC 4TF4A 5DJ0A 3AT8A 1BIHA 4YUEH 2CDFB 5DZLA 5HYIA 3PV6B 3VSTA 3SE9L 1G9NH 2CDEB 3BX7C 1WIPA 1IGTB 5SWSA 3BGAA 1PFCA 3ATEA 1B88A 1VDGA 3HPLB 3UPCA 4MJID 2XPGA 1O6SB 4IRZA 1H8SA 1ZGLP 2DKSA 2Y06H 3ETSA 1NZRA 3IJEB 4M93B 2MCPL 3D39A 3UTZB 1S6NA 4QHLB 1X9RA 3BP5B 3WG7B 5A2CA 1JYVA 3ZTNH 1BG1A 3OAUH 1JXFA 4NWUH 4ADJA 4QXTB 1M6OA 5MHSE 4G6FB 1JK9B 1OALA 2WSDA 4L48A 3DX4A