1OGPA

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
388
structure length
388
Chain Sequence
b'PGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE OXIDASE
molecule tags Oxidoreductase
source organism Arabidopsis thaliana
publication title The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
pubmed doi rcsb
total genus 103
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ogpA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 1ogpA01
2A99A 4PW9A 3HBGA 4PW3A 2BPBA 2CA4A 2A9CA 2XTSA 3HC2A 2BLFA 2A9DA 1SOXA 1XDYA 2C9XA 2BIHA 2CA3A 2BIIA 3R18A 3HBQA 1OGPA 1XDQA 3R19A 3HBPA 2A9BA 2A9AA
chains in the Genus database with same CATH superfamily
1NGZA 2DYSB 5F1KC 3B83A 4B6ZA 3N41B 5SWZD 4PVNA 4Y4FA 3ES6B 1HL4A 2XY1A 5ALCH 2VXVL 3VCLB 2H0EA 3RDJA 5CZRA 5K9OB 4JFVA 4AQAA 4M7LH 1CIUA 2VO5A 1IQDB 4I4WA 1A65A 1FVCB 5F1NB 1KCVH 1VKXB 6FABH 4PV9A 3VXSE 3FN0H 2GT9A 2QMKA 1Y7VA 5F7NC 1CDCA 4TOYH 4OY9A 2E47A 4JGMA 1BXUA 3UCRA 2HFFB 4G8GB 1FG9C 3M1OA 5J89A 1KIUB 2BRRH 4Z0XB 3QJHB 4JFQA 2X4SB 4MXWH 4NZFA 3LEYH 1OAYL 5HDRA 2ZX8A 1UZ6F 4JFXB 4B9ZA 1F4HA 4GW1A 1LO0H 3M46A 3LNHA 1MN4A 1O6VA 2W07B 3N1PC 5DI8A 3W9EB 5L9DH 1V7NH 5HYIA 1MREH 4Y2OB 3ESVF 1RPUA 4WJKB 5ETUB 4XP4L 2ID5A 3DYPA 1OE1A 2IFFL 3WAKA 1JERA 1F3DJ 3G5ZA 4KNSA 4PJ8D 1GC1H 2FSEA 1DEEA 2XN9A 2J71A 4FNPA 4NPKA 3V52L 4P8QA 4B9KC 1U58B 2GSGB 4WFFE 2BOCA 1UZ8B 4A2HA 4XNYH 3HHSB 4X6DF 2WXOA 4I3RH 5BCAA 3QE5A 4GOSA 1NCAL 4N8VB 3CFEA 3GF8A 1HINL 4DZ8A 1CO1A 1YC7A 1XCWA 1KWKA 2TRYA 5KUMA 3S8FB 1RZQA 3MRKA 4J8QA 3L3GA 4TQIA 3UZEC 4U6TA 5FLVA 4FABH 2VL4A 1JHKH 2ORBH 4YAQB 4XNMA 5CILL 1IE4A 1MRFH 1MHPL 2HMIC 4ZOAA 4FFWD 3OXRB 4AYDC 1U33A 1BQRA 4P46B 2F74A 3NZHL 2UZXA 1IEAB 2XQYA 4HC1H 1ZJAA 5I6LA 1QEWB 2JQZA 4LPYA 4PP1D 1PCXA 2EZ0C 2ZX7A 3QA3B 5C7ZA 4JGNA 2WUBL 4QY8A 5CJBA 1OXYA 1I8KB 3WMPA 2XA3A 4AVJA 2A77L 4J23A 1HZKA 2R1XB 1T1WB 3QFJE 3SCMA 4MNGE 2VKXA 3DSFL 4O51A 4Z0BH 1DBMH 2XN9E 3TEXA 3L3JA 5C6WH 1NSNH 4XNDA 2V7NA 5HI4C 3SE8H 1VFMA 5T33H 5IBLD 4WUUD 4HDIB 1TTUA 5TH2B 5I6KA 5EO9A 4KXBA 2H32H 5DQ9B 4P23A 2IPUG 1D7DA 2LLGA 2X7LA 1Z5YD 3FO1A 2X4NB 4BKSC 1IKOP 2GK2A 3G08B 1PZUB 2WLKA 1DSWA 4E9SA 5JIQA 3LH2H 1F41A 5I66A 3KYAA 4YPJA 1R17A 2EDHA 2OYMA 1J5OL 2R0ZL 4AM0B 1V27A 4E41D 2EXYD 1S7UB 2DYPA 3OGCB 3D2UD 4JRXA 1D3CA 4W6WB 5CILH 5TF1L 1NMBL 3GLEA 4EZLA 4PJCF 5F7YC 3GBLA 3PWPD 3L08A 2GJ6E 4HPOH 4HHAB 5DJ2B 4Q9RH 5HY9B 4TNVK 4G6FD 4NIYE 3L3OA 3FBQA 5MENB 3Q6FB 3ECUA 1D6EA 1HL9A 2PNDA 3GBML 5GSVB 3GDCA 3VXME 3M7OA 1NIBA 3VG0L 3BP6A 2ARJA 5C6PB 5IMMB 3VXUD 4YUEH 3QNZA 1CFMA 1F4WH 1MJ7H 3ISWA 5I5JA 1PD0A 4HWBL 4PGCB 4ZO7A 2ETWA 4LEEA 4P2OB 2BZ7A 1UH2A 3QDAA 5F0LB 4WI4A 1OSEA 2BIIA 1QBBA 3GMQA 2TSBA 2K70A 3CSPA 1W72A 2FWOB 4HD5A 4OCSL 1AKJD 3D2TA 4KY1L 2ZUSA 1M1XA 3GMPB 4NQSA 1BQUA 4Z7IA 4JFEA 2QPFA 4BE5A 4D9RD 3PCYA 1HIML 5TQ0H 1CK0L 2IANB 1JYXA 1R3KA 3RWHA 3FUEA 3NJHA 4TSBL 2DEWX 5LXGL 4FHJA 2P5WB 3T8XB 5AVUB 4XNQA 3DRTA 1NDTA 2BS8A 3IS0X 3RIFK 5IB1B 2E56A 2GG1A 4L4TB 2XBDA 2AEQL 1EK3A 1T1XA 4DP5X 1UM4H 1BG1A 1R19A 4P99A 1FL3B 4R7LA 2B9AA 2WXMA 5FB8A 5C9KA 2Y1AA 1XB3A 1ZV5A 5F70A 4JCWA 1XCXA 4OAWA 1JRHI 5IBLC 3ABKB 4B41A 1AI1L 4OGYH 5DQJB 1KY7A 3PL6C 5F9JA 4FNSA 5HDBB 1YN6A 2WXQA 3QI9B 5DD5H 3WJJA 1S7VB 1U3NA 1EZUA 3IS1X 3L3IB 3TO4B 5ANHA 3QXDB 1CGTA 2E76C 5IMKA 2HH0H 1DYZA 2E0PA 3SDXF 2KQNA 4JG0L 4BKLB 2BSED 4F1ZA 3MCG1 3K46A 2OMZA 3QUHA 4JZJB 2V5YA 3AMLA 5EWIH 3ATFA 5DEZA 3STZA 2BVOB 1D7CA 1JVLA 1G1YA 4XPTH 2P7TA 4KHTL 2Q8AL 1VHPA 1NCWH 3PL6A 1JZ8A 4GQPH 2XACC 4MD4B 4LLUB 4BUQA 4TSBH 2ODIA 4G5AA 2AANA 4XHQA 3OKOB 2VR3A 3PHOA 5ECGA 3R8QA 2Z8WC 3GYRA 3AQXA 2D03L 4FQXB 4IKJA 1M2VB 3ZVVA 4JJ5B 2N4IA 1P5VA 1JE6A 3ULUF 4HUXA 1F56A 1N4XL 2BMKB 1SHMA 3NZHH 1T22A 2WLNA 5BXFB 1QAWA 5DMKA 3M6DA 4QTIH 4UTAA 5B7MA 1URLA 4CL7A 5TDNB 2DBLL 3BW9B 4CUCA 2ORBL 3B9EA 3T0ED 2FEDC 3BUTA 5EIIB 4GINA 6FABL 1MWAB 2ITEA 5GGTA 2HCZX 2Y36L 4OD2A 5BS0E 3ESMA 4ZFGH 5JUEH 1I7UA 5FXCH 1VGKA 4YQXH 4K94H 3LZOA 1QD0A 5DD0L 5ID1B 5HP5A 3EFFA 5ISZA 3U4KA 4K7FB 1XVSA 4PYHA 1TIUA 3GS0A 2Y07H 2DQCH 2HTLD 5DD1H 4PCKA 2J7LA 5CP3H 3U9UA 2A9BA 1MI5B 4K5MA 1F3RB 2B15A 1G7IA 3S3PA 4OVVA 1YYML 4DWHA 2DM4A 1NMBH 4XP4H 3TESA 2RQEA 3FOMB 3CZGA 4N8VA 3CSFA 2YN3A 4GQQA 2F54B 2HMID 4KJWC 3BT0A 3UTOA 3JWDC 3HRZB 4OGAD 1HYRC 1DQLH 1JWSA 3MACL 3EBIA 5FO9B 1X5ZA 1W72L 2BZDA 3SDXA 3DOSA 1J9QA 4MXWL 2YRZA 5F1NA 3D3VE 4WSGA 4WUUB 1UA6L 2BOLA 5JQ6L 1M7UA 4M6ML 3T2QA 1UD4A 1GZPB 1MJJB 5JW5B 1P2CB 3K1DA 3S8GB 2DW5A 1PLAA 1WZ1H 3KBEA 2Y2YA 2NY4C 1DQIA 1AGFB 3H9YA 1JCKA 5T1KD 1JGUH 2IDCA 4KGLA 4NJ9H 4QY8B 5D5MF 1RVFL 2HZHA 3QHTC 3W9EA 4P2QA 3S3BB 2O72A 1ZHNB 3AXLB 5T3XD 5JXAL 1ROWA 2BVQA 2HUEA 4AY0A 1UD8A 3B2DC 3PWVB 1LK2A 1HOCB 3SJVD 5JHMA 5AW2B 4PSRA 4PD4J 2D7OA 2A6KB 2OMTA 5D55A 5TDPA 3QQDB 4WW1B 4PRHD 2YPLB 1NUNB 3I9AA 4K94L 4IRSA 4XP5L 3HNTL 4PRNA 4NJAH 4GAYB 3NRQA 4WY7L 4NUJA 1EDQA 3U4BL 4HIEB 1XR9A 1NTDA 4HF5L 3K71A 4FQCL 3VH8B 2D8KA 1UVQB 4FABL 2CKBH 4LQFL 5JTWA 1PJ9A 4OZFB 3QUZB 4JFYA 3VVVA 1N2RB 2JQAA 3N04A 3TPUA 4AM0A 4XAKE 1I1AD 1XGQB 1DQVA 1HSAA 1H3VA 3A6CH 3O3DA 4M7KH 5I74C 4PV8B 2R4RL 2ICES 3H7BB 4X7SL 3UBXI 5CGMA 5D71L 4JANA 1GJIA 2D7TL 2IDQA 3L8QA 3QRGL 2ADFL 1JTOA 3EZ8A 4KO6A 4BGLA 2P9RA 1JSYA 3MLWH 3ZZQA 1UD3A 2OMWB 4KVNL 4LESA 5J1AA 2IFGA 5F8RC 3AABA 3H9ZA 3ZY7A 3F7VB 1MREL 2ARJB 1J0KA 1QR4A 4GW4B 4R4FL 3F05A 4KX8A 4EQ3A 2VDPH 4QRRA 2P5WD 4PJ7B 2BCKA 4EEEA 3CFJB 5FGCB 3KMDA 1DO6A 2ZYSA 1SNRA 5GISH 3DX9A 3L3JB 5HDBF 1HILB 5AAMC 5DJXA 3TU6A 3TNNA 2AITA 4DGVL 4KO7A 4X5WA 2XWBB 3ZDYF 1KCVL 2QGDA 5AAMA 4ODVH 4IBWA 4BUGA 5IT2H 1DJHA 4KJPD 3L9RB 1KLGB 2E8ZA 4NQSB 5TE6H 3VFMB 4LLAA 4QRTA 2ZZUT 5FM8A 4GI9A 1DJSA 2XWJA 4XXWC 2Z0BA 3G6JF 4XP9H 3CK0L 1Q9KA 1NOLA 5HGDB 3MREA 3Q2LA 4PLOB 1AKJA 3PXLA 4XCNA 5BZWA 3KPSA 4JZNA 1AXIB 4EI5C 4KKZA 4NKMB 3I6GB 5AVVB 4N68A 2VABA 3MRBB 3UH8A 2AEPH 3BAWA 4ODVL 1FG2A 1Z5LB 4NPYB 4YXLH 4B96A 5MHSE 3BDYH 4MA8H 4R7NA 4KNQA 1B9KA 4TPRH 2NY7L 3RAJL 2X2HA 3I3DA 3MV8D 1USQA 1XIWA 1FAIH 1D5IH 2E6JA 4MD5A 5KSAC 1TQBC 2NUTB 4AYID 3KW8A 3VNZA 3L9EA 3FU5A 1DVSA 4P06A 2PR4H 3QI9A 4R4FH 2YKLH 4N0RA 4N1EA 4XBEL 2E9BA 2XV0A 4R96A 5LGJA 1A4KB 4HT1L 5IMKB 5ICXA 3TJHC 1NAKH 3GJFB 3HZKA 5EU3B 1GA2A 3BEWB 1J0YA 4D0BB 4OCWL 4JVUA 5CLZA 1S78C 4DTGH 4YNYA 1EHAA 3TBVB 4D8PA 3C5SB 5D1XC 1M57B 1S4IA 2EDNA 2ADIB 2X4UB 3I84A 1JV2A 1LP9A 1QFUL 3IJ9A 5F88B 3TF4A 1ZS8B 1ZWIB 3EJUA 3CZNA 1ZIAA 3FB8A 4X6DE 1HZHL 5G4OA 4F7EA 1FO0B 4OD3H 1W0WA 4OIFA 1L6XA 4S1DD 4XWOD 1BQHB 1HHHA 2K45A 3QJVB 4UIMA 5IB1A 5AG9A 3PFQA 2WP3T 3QXAB 4YE4H 3X17A 5DC0A 1FE8L 4HBCH 4XMPH 4UMGA 5EZJA 4YLBA 1T22B 3HNTH 1E4KC 3ZE0B 4JFPB 3MGTA 3BFQG 1ETJA 5E4OA 5C86A 1HE8A 3Q8CA 4OAWB 4E41E 3WTVA 2VM9A 2W88A 1UZ6E 5DJDA 1BG9A 4J3TA 5I18L 2BIOA 5I2IA 2AI0L 1X5HA 3C60C 4JREC 1H8NA 4ZTOL 1PLGH 4GXVH 1TQCB 2PR9A 4WI0A 4XB7A 4IW4C 4TULH 4I85A 1T0OA 2PTTB 4Z5RA 1MPAH 5EOQL 1MKFA 2WIIA 3MNZA 4QO1B 3TP4A 5LCVH 3GMOA 1DZBA 2K9FB 2CU9A 3HBGA 1S9YA 3H2WA 4P0DA 3EH2A 1AFVL 4G82A 1IQWL 3GMMA 4G7VL 4ZMNA 5BRZA 1MJ8H 4OGAC 4CNIB 4F2FA 1NGXA 2K7QA 4L0ZA 3VH8G 2N7BA 3S37H 1WYJA 5MP6H 4X6BA 4XRCA 2N1TE 1OKEA 4R97C 2Y5QA 4AQEA 1BWMA 3QIBD 1BJ1H 3BUIA 3V7AG 4PJHF 4F93B 4NO0A 1SYSA 3U79A 3GUTA 4IBTA 2H8PA 5SV3A 4NN7C 2EKJA 2FD6L 1MHPH 5IOPA 5CD5D 3VI4E 4BCYA 2JIXB 1J8SA 3TONA 4N0CD 2J8HA 4KXCA 3IU3B 1NLDL 3LD8C 3C60D 2PPFA 1F4WL 1MJ7L 1OO2A 1N19A 1PJWA 5IQLA 4HJ0C 2JLPA 4OUUB 3GXUB 3FUMA 2IPKA 2AKRA 3GIVA 4FCAA 3TO2A 4W9HC 3WDHA 4XN1A 2HJLA 3QJFA 4LLQB 2DTSA 4PRIE 1FNLA 3EOYG 4Y4KB 1KTRL 4HPOL 4G42A 4Q9RL 4M61B 4LLVB 3DMMA 4PP1C 2NCEA 1MCOL 5DEFB 5TDPB 2J8OA 4EI0A 4R8WL 4NQEB 5FUZL 1FYTD 3SDDB 3U2SB 4JO3H 5L4MA 3EHBB 5KBDA 3K71B 3GZKA 3IGUA 5D7LA 2G5RA 3B3IA 1NCHA 4ISVB 2JKNA 4HJGB 35C8H 4LSVH 5F0MB 3VU2A 1CGWA 1Q94B 4G6JL 5DMGC 5ICZB 4LBEA 2Z1PA 4QT5B 4A67A 5IEKB 5DVKA 1KV7A 2Q7AA 4ZXBC 4NQCA 5A2BA 3A6BL 4OV6F 4IOFD 4M7LL 4Y5YA 2D7MA 4EIGB 2VDOH 2BFVH 4M1DL 4AIEA 1QI3A 1AGFA 2JXMA 3GI8L 4OGQC 1UWGH 3BEVB 4ALAC 3D0VB 3AU1A 3UYRH 1NICA 4K8RH 2NNFA 5INDA 1J1XH 3H42H 1QLRB 4F5CA 3LRHA 5LBGA 2CR0A 3HZ3A 5FYLD 2NQDA 2XX1A 5AYQA 1NH6A 1MFEL 2NR6D 3CLEL 3HOGA 2OMTB 2VZ3A 1MCOH 4QYOB 4WGKA 3H9HB 5D4QA 1HQ4B 4PRNB 5MEQA 3TURA 1ZCRA 2EXTA 1BVKB 1NKGA 3ENEA 5A2KH 2G3ZA 4PGDB 2YAHA 1YG9A 2WZPD 4HXBH 4FN0A 3AS1A 4ONHA 1ZVHA 3FB6B 1NL0L 4PG9A 3JZYA 2A9NH 3VWKD 3ISRA 4IKLA 3RVVD 1KXTA 4PJGF 3S4SA 3QIUB 1OM3L 3HRPA 4LDCA 4BDVA 5TFSH 4ONGH 4QWWD 3EGDA 3KCPB 5DSCA 5LXGH 2EXWD 4EZMA 4K71B 2V9QA 3U1QA 1AJ7L 2CE6A 2CBTA 5JW4N 4FP8H 1BQHG 3EBAA 4UYQA 3ESOA 1K4CB 1XCQB 1OE2A 1OPOA 5LAXA 1EJFA 5HVWA 1MY7A 5L9DL 4OLVL 1X7TA 4L5FL 3D1MC 2BP5M 2ERJC 3DXAE 1Z5LA 4HLEA 5J1AB 3MR9A 3E6HB 1E30A 4XAWH 4MCYA 2IALB 3QUYD 4R7NB 2IEPA 2YAMA 4GW4A 4CDHA 1OB1A 3T2NH 1NANI 4HIJA 1IO4C 3WTTA 4LL4A 1K72A 5I1LB 2QSCH 2YJQA 2QADB 3QI9C 1KYFA 4JQIA 4I77H 3ZKXC 1PS3A 4I0CC 3HC3H 2JJUA 1MFBL 3CXFA 1T21A 4MAYA 4IK6A 1WJ3A 4IK7A 1NC2D 2C9AA 3KS0H 3MRMA 4RISL 5E9DD 2HP4A 3VFMA 3A6OA 4YC2B 4NQDE 1MAMH 2P8MA 3AC0A 3MBXL 1RZFL 4N0YL 2V3EA 2VMFA 4JHAH 1CE6A 1QBLH 1TLKA 1J5OH 2UY7B 4PTTB 3F7PC 2ZSWB 3LYRA 2AJZB 3TVMD 1AHMA 3DXAA 3GM0A 2KHAA 2TSAA 3UTTE 2CGYA 4XXDB 3TASA 4DEUA 1ZT4A 3OJDB 1LE5B 3BI9X 4BQ6A 5C09B 4N2KA 1VESA 1PYWB 2ZF8A 2GAZB 4JFPA 3FT3B 1XIWB 3AY4A 2MCMA 3NA9L 5T5NG 3LHPL 2Z31C 3IK2A 2E9GA 3QIUC 1F00I 4NENA 5E95B 3U30B 3VX1A 3EXJA 4GO6B 5FKAB 5E51A 2OKMA 3BZEA 2BWIA 4L48A 1IGTA 4K3EH 3WFZA 4NC2B 5BS0A 3W3BA 1WCQA 3F00A 2XKNB 2VLJE 4AC4A 4J3UA 1W2KT 3E9TA 1UJ3C 2YGVA 4RMQA 3V6FA 1IKFL 2OMVA 4KRLB 4DVRH 2DYRB 2L0DA 4L9LB 2DOCA 4UI2A 4BFJA 5B38A 3B37A 1DUZA 1J48A 1JN6B 4H8HA 4P2CG 4PJFA 1YEJL 4PJ9C 4FQ2L 3AY2A 1JHKL 2YXWA 3WLBB 3CUPA 1I7ZA 1JDAA 3EF4A 3HMXL 4AL8L 4DPCX 2E4FA 5CWSB 2BC4B 1EHLH 2OMBA 5DRWA 3C5XA 3IGFA 4NO0B 5C07B 5D7KD 1MXDA 4BFOA 3AM8A 3QCVH 3UGUA 4ZNCD 4BZ1L 2HPOA 5CZVH 2HLFD 5IHUH 1JK9B 3QIBA 1QASA 3UTZB 1X9QA 3FSWA 4BIKA 2XRAL 2KERA 4NQDA 4FZ8H 4O58L 3U6RB 4M7ZC 3ARWA 3QUKA 4E41A 2EDWA 4Y5VB 2VZUA 1MH5B 2DQGH 3K0YA 4ZTPL 3ZMRA 2BY1A 5DVOA 3AG4B 1CE1H 1E4WL 4Z7UF 3C60A 4EOWH 1GYWA 3QEQB 1QYGL 4Y2OA 1NCDH 3HB3C 5EC2B 3O4OB 1KIRB 1ZLWH 1HCZA 3DPBA 5E6IC 1P7KA 3LKPA 3S88L 1PKQB 2CIKB 1FWXA 2PWDA 1A7OH 2Z65C 4JY6A 4FXGA 2CKNA 2NSQA 4ICXA 4N9GB 5TK2A 1BQKA 2BOCB 4OT1L 4F2EA 5FYKH 1MRCH 1Z1WA 3D4CA 3DSFH 4FFVD 5JW3L 3BOVA 5JPNC 1LE9B 4Q9QH 2PPDA 3CMOL 3QEUB 1P5UA 2HAZA 1Q9WA 3SZKC 1MCWM 2F08A 1AIFA 3VWKB 2BJML 2Q20A 3L5WB 1NCUA 2ADFH 3B1UA 4HX1A 4MZRA 1SJXA 4ABWA 4P9ML 2JCCA 3U4EB 4KTGA 5HDOA 3LRSA 4JPQA 2DLGA 1CLZL 1VSCA 3L4XA 3LPPA 3FCGA 1NAML 2YC1A 4DJMA 5J6HA 4ZQKB 1PDKB 2EINB 5BW7C 3IAPA 2DMHA 3T0XA 1OD9A 3EDFA 2MKLC 3QFJD 2X4PA 3ABGA 4P4KD 3RG1C 3MJ7A 1M3JA 5L2KE 2NNCA 2W0KA 5BUAA 2A7BA 3QO0A 4WY7H 4P4RA 4PRIA 2K4AA 2XV6B 4UM9B 2DMKA 2LU7A 4WZ9A 3WEXB 1OP5H 3WLWC 4KHXL 4HZ1A 4FFVC 5IQ9B 4WWOA 4NYLB 3BP5A 5GGQH 4HPYL 4OCNC 3UJTH 4HS3A 2CRMA 1ZA3A 2VM3A 1WBXB 4TKWA 2X4OA 4NZTH 3FK3A 5HVGB 4OQTL 4RFOL 3FB6A 1Z6JT 4RRPA 3KNBA 3ARFC 2DZEA 1GS6X 4U0QB 2NDGA 1B3IA 2G60H 1JPST 2NY6B 1X4ZA 4XVJL 4Q6IB 3VFOA 3KCPA 3MMEA 3B5GA 4OFDA 1NCCL 1NJ9A 3WNMA 4UDTB 4V2BA 3EJZC 5F7UA 2RFXA 1BZ7B 1QFHA 1K8DB 3DVGB 2EDQA 3TV8A 1CBVH 3PABA 2ZOKA 3UABA 4TOYL 3LKRB 4YXLL 4HW6A 3GHBL 3BEVA 4EUPH 4TNGA 2K78A 5GSVA 4QXVA 3UAEA 1J1OL 4L4TD 2YZ8A 3ESNA 2B2XH 1YY8A 2HFGL 2UV3A 5E2UH 1MLBB 1BYNA 3NPSB 4KQ4L 4DP8X 1K4DB 4K73A 5IVNA 3GMNB 5ALCL 4X6DA 2HKFH 5JPNB 3GRGA 1LD9B 4JW3A 4W9IC 1BXAA 2VRKA 1EXHA 1F3JB 2E9WA 3WIAA 3S3SA 3MA9H 2B1OA 1EO7A 3MCLH 5DR5H 4HBQA 5EO0B 2V2TA 3H85A 4N2NA 1FFNA 3ECQA 4WNSA 2B1AL 1DE4A 1E6OL 4F27A 4RX4D 5CEZH 1DVTA 2C9XA 3LEVL 4X5RA 4OZIA 2YKKA 5JA8B 1RK0B 2MIZA 3CFNA 2R2HA 3SE3C 4KZDL 5DWUH 4J1UA 4MLSA 4TSAH 5EO1B 3CWGA 3EFDH 3T09A 4WUKL 5DHEA 3T65B 1WFTA 2B5IC 3F04A 3HRZC 4ZMAT 3UO1L 4DQOL 4YDJA 5CM1A 1ZJBA 3EGXA 3R7RA 3LRKA 3CN1A 2HG0A 3LRLA 5I1KH 4BHUA 4UUJA 3FB7A 4YDZA 5F7BA 4G1EA 2AQ1A 4PQXA 5IR1A 4L8SA 1PIGA 4HH8A 4RDBA 4AJWA 2V2XA 3K4ZA 4KDTC 4JKPL 2L4OA 1EHNA 4FFYH 3WIIL 1IT9L 3US1A 2IV8A 3BISA 5F3BB 3PWLB 1DBAH 4IGBB 2YAPA 1WLHA 3ATEA 1RULH 5IQNA 5IFJB 2JMRA 3B7RL 1AGCA 5C9JA 1TCRB 2OTUA 2R7EB 2I7OA 5EN3A 1EPFA 1Q0XL 2FECL 1OCWH 3GJEB 4PRDB 1NGPH 3BP7B 5I0DA 3PXJA 5B39B 3I3BA 3OKDB 4X98A 4DQAA 1ECZA 4AQ8A 5FYJL 4GXFA 2GITB 3EJYD 3NIDF 5I19H 5EBMA 1B0GA 3KYKH 4D3CL 4BWTA 3DIFA 3G5XA 4BSJA 4UINL 1ZOXA 2G30A 1NPUA 3GO1L 4MLIA 4YC2C 1PY0A 2BP0A 3VFVA 3X1GA 1L9SA 3NPSC 1FA4A 1JZ7A 4LEOA 5HI4D 1WFIA 2XWXA 5KANG 2WD0A 2FX7L 3POHA 2XZCH 2BC4A 1KJ2L 1U95A 3BGAA 1A7PL 1QLEL 1L0YA 4R7DA 1BOYA 5F9OL 5C07A 5C0DA 4G8GD 4XXDA 4PWEA 3IMUA 5ESQB 3T0EE 3HG1D 4XB3A 2AVGA 4PY7B 3MJ8A 4TTDD 4YLQT 3CGTA 4HETA 3GSOA 5TQ0L 4UQAA 2WWMC 1FL6A 1CF1A 4XPAH 5EZPA 3KBPA 1HH6A 4LSUL 4PGZA 3I2CL 4M29A 3VXQA 4NN6C 2FUQA 5E8DL 1A5FH 1W72H 3OLEA 1HL8A 4EPSA 1NC4B 4A37A 3DJRA 1QW8A 3COOA 5C7XH 2P49B 5DGRA 3K6FA 2OTWA 3M1BA 4DK5A 4X6FB 3EFFB 3MRRA 5JPMB 3PDGA 1KGUA 5KSBA 3TCXA 2B14A 3ZDXB 2VW7A 3OWRA 2FCBA 4F15B 4LASL 1E6JL 2Z64C 3S2AA 2ZKHH 1ACCA 1JPGA 4QRRD 1QQDB 1A6UH 1F45A 3RBSA 3EHBC 3A24A 5A2CA 1J05A 1EZVY 5EOCH 5BV7C 3I50L 4Y1AD 1TJIH 1TQWA 1HDMA 2PPCA 3WTUA 1J5IA 4DGIL 2IC2A 2JWYA 1BZ9A 3LS5L 4FZEH 5TK4A 5DZNA 4Y0GA 4ZMLA 2VDRH 1H19A 2NDFA 4M93C 2BNQE 1CXFA 5TF0A 4PBWD 1Y1DA 5KG9A 4ZQKA 4HEME 1B4TA 5C0JB 5LQBL 1OGPA 2R4SL 5AQ0A 2AXFA 1UFUA 4PJBA 4YHNA 5FA3A 1BAWA 1LM8V 3QJRB 4R83A 4BJLA 1MJUH 4PJBF 4FNRA 4A2MA 1HCYA 2ZUYA 3OKNB 4NZJA 1T6BX 3IJSA 4IOIA 4Y19E 2QPUA 3MUY1 3IDIB 1WGVA 5B22A 5C07E 3QCUH 1CU4H 2D9QB 3N06B 1NBVH 4HCFA 3NAAH 1E8ZA 2D73A 3M17A 4UM8B 5CCGE 2WYZA 1U8QA 2H41A 1PKQA 2CIKA 2I60L 1GXEA 2EH7L 2VXSL 2ENPA 3OZ9H 5KVGL 8FABB 4FQQA 5EWIL 1OAKL 1GGIL 3INUH 4M5SA 1I8MA 2KMWA 3K81A 1NFIB 2EO1A 1XCTA 3K8MA 5L7XH 5EUKB 4U6HB 1F4XL 1P1VA 3GJFH 4UQCA 4A7SA 4CC4A 4I2XE 4P9HL 2VR6A 1VIWA 3WY2A 1LWRA 3L7FB 4A38A 2DI8A 3KLKA 4HX1B 3D85A 4LCWB 4CSPA 4PAZA 5CFAA 1RU9H 4F20A 1OT2A 1IBZA 1YEFL 3U7YL 4F58H 2FR4A 5BJTB 1FNFA 1XEUA 4RGNC 3WGUB 4JG1H 1BJ8A 2VR5A 2VB5A 1RZIB 5HHQB 2QHLA 2YMXL 1DDHA 4IMLB 4NO5B 2ZXQA 5IREA 2HYMA 3TT1H 1BZ8A 3L3KB 3SKUD 4BINA 4XMZA 4H20L 4FTVB 1QEXA 3ULUE 2OMNA 3OKEB 4UT6A 2DWYA 3ZTCC 3MJ7B 1HHJB 4LPTA 2CPUA 3DX8A 3VXOB 3ARDB 4ZRGA 3IXAB 4PRIB 2F58L 3NJJA 5AW9B 4QF1B 5AKSA 2PTUA 3S36X 4PJ7A 1U3HC 1P7QA 4TVPD 4GIPD 4PS4L 3RZCB 5HYJB 1NUFA 4ELKA 3SBQA 2BY0A 4F57L 4EMZA 2IH8A 3BGFB 1DVYA 4LCIL 1ZEAL 1A7NL 3D3VB 1MW3A 3MYZA 4XC1L 4ODWB 2F53B 4QGTA 1TUPA 1I8AA 2F1AA 3EUDA 4OUOA 5DJXB 1FFNB 4FLOA 5DRXB 4G9DB 4X5WB 2NX5A 2XWBA 1DO5A 3VYOA 3H53A 3OKYA 3SDXE 1EFXA 4Q0XL 5C3LD 1IC7H 3B9VA 4AIZB 4GP8B 5MEPA 2H2SC 1A22B 1M53A 5BO1L 2J5LB 2ZWYA 4L3CA 4IIQB 5AOLA 1IBGL 3O3AB 1BV8A 4EBQL 1F6AA 5HI5C 4Z7OF 2RFXB 1MZYA 1CLVA 3DUUA 3F6JA 4YUEL 4JZNB 1PY9A 2G9HB 4UV4H 2CK2A 2QPEB 2VZOA 4ERSH 2ZOKB 4FEIA 4U4BA 4JQIH 3ZMNA 3QNFA 3N85L 1RZJH 3AG1B 1G6RL 3L1OH 3BT2L 3TZVA 4PB9H 3SDDC 3RPIA 4JO2H 5KS9B 1UJ3B 3MUUA 4NCC2 3DX7B 4A39A 4E9XA 3IBEA 3LQZB 3S34L 1E4HA 2UZYA 2AEIT 1OF2A 1DQMH 3RJQB 2IGFL 3V0AC 2PYED 4I9WD 3SGJA 4AV0A 3GXTA 4ALAH 1S9XA 5IROA 3VGAB 5AD0A 1JIBA 3SPJA 3TBSA 2NW2B 1KIPA 4M7LT 4BHUI 1RMFH 2W1NA 4XODA 3HHMA 4LSPH 4XO3A 2W5PA 4FNQA 3HG0A 1S7WA 3D06A 1JRHL 5DRNB 3NVQA 1GS8A 3W2DH 4J3OH 2OX5A 4M5YH 1PG7X 4M9OA 5I8KH 3DTDA 2WW8A 4ESKA 2X4UA 5CINH 1XGPA 5INCA 1QO3A 4Z3JA 1NM4A 3QS2A 4R0LC 4HUUB 4XZUB 3M8OH 3CDFA 1T89C 3ZTJG 2FNWA 5D72H 1H3GA 3K6NA 1CXIA 4I13B 2A77H 4RGND 4WU5A 2VLRB 1N8ZB 4A7TA 1U8HB 3MRJA 3D08A 3FUFA 4LZKA 4R7DB 3TV3L 1J9SA 5LNDA 5I6XB 3FU3A 1ZLDA 5SWQB 4G1EB 3TYGH 1CFQA 5J9PA 3MLVL 5ILTH 5HGHB 5GRWA 4LSTL 5EZJB 1K8IB 2GCYA 5A1AA 1ZHKB 7TAAA 5CR1A 3D69B 4BFGA 1N0XH 5HHVL 4FMVA 3VU1A 1GJWA 3TJHD 3PHAA 4JHZA 1HHGA 4EXKA 5KTEL 1IC1A 1LHZA 2HT2C 3IWVA 2LTQC 1MW0A 1XF5A 5KVDL 2FL5B 1UH4A 2ATAA 1FFTB 1BAGA 2DD8H 3V0FA 4B60A 8CGTA 3GXMA 2O5YL 2RALA 4L8DB 3NA4A 5EUOB 2IADB 1UEYA 1QRNB 4CSSA 3SO3C 1RK1A 1SJHB 1BBDH 4XMWA 3RNKA 4CVWA 5IHLB 3CFDB 3HFFA 4JN2B 4YHOL 4A68A 4BYHA 2GIXA 5JZ7C 4V2CB 3WN5B 3UC0L 1QQDA 2ESVE 2IANE 1ANUA 3ASNB 5SX5H 3SBPA 4NQXB 3QWRA 1CICC 1CGYA 1E3ZA 1OCOB 1RUQH 2WNKA 4AGQA 4XPBL 4QHKI 2ZP0T 5ID0A 5BQ7A 1MIEL 1RJLB 4ENED 1AGDB 1FRGL 4N2LA 1OP3K 4PJHA 1XF1A 3MRNB 4AITA 1BSIA 4GMTH 5C0RL 1T5XB 3I75A 3VACA 2KT6A 4OZHA 1JNNH 3HAEH 5JXEC 4M6AA 5A16B 3VXUA 2GK0A 5DS8A 1E50A 1I1FA 2BSCA 3HBPA 4JG1L 3GSOB 4NKOB 4X4ZA 2HFEB 3WD5H 3W5NA 4MA7H 3ZKMD 4X4XA 2NY2D 5GGTH 3B5TA 3Q2VA 3S96B 2X4SA 3MRCA 4BFIA 4I3SH 1NC4A 2W81C 1GMIA 2IQ9L 4ODSH 3OG4B 4JAMA 4XBPA 3IJSB 4IOIB 5C0CE 2MCPH 1FFOB 5B8CA 2YUXA 4K5PA 3QCTL 4L8BB 1EUUA 2IDUA 2ITDB 5KYXB 5HYQA 3OMZA 4N5UA 5FHBH 1OPGL 3VDBA 4G7SB 4OTXL 1I8LA 3DVFA 4JM2C 5GRXG 3MU3A 4TUOB 2WVTA 4J2XA 3MGOA 1QSFA 5ICYB 4M8RA 3VI3E 2Y5TB 3VXNB 1JZ3A 3HHSA 4JFEE 1CTMA 2LU5A 3QCUL 4IHBA 1G5AA 2NXZB 2XTSA 4ZBJA 1QTYT 3ZTEA 5HPMA 4QRPA 1UXSA 4WW2B 1FIGH 5JIHA 1JFHA 5FO7A 1DJYA 1KPUB 1TDQA 2WCGA 2FIKB 3NJLA 2H1XA 4E68A 4ZS7H 4YFEA 1PG7H 3FMGH 1NCJA 3KLAA 4FRWA 4HWEL 2XUWA 4YAQA 4Z3FA 5I24A 1SOQA 5LQBH 2KS0A 3QARA 2PMZA 4M5ZH 4N4YB 2K6ZA 1OL0A 2YBRA 3C87A 4NLHA 2BNQA 2JB6B 3IGLA 4N2GA 1XH1A 2C4FT 2AABH 1OT4A 1SEQL 4G5ZH 1E4XI 3TC9A 5IJKC 2O6EA 3NYKA 3FSZA 5AZ2L 1R3LB 1YDPB 3X11A 1VA9A 1D2OA 2ZXWB 2VLJB 2R69H 3ETBJ 5KSVB 4I4WB 2C34A 2OR8A 3RVXC 2DIEA 1ZLEA 4IBSA 1QLRA 5E56A 2LW3A 1YN7B 2R0LH 1DQTA 3APFA 1MCLA 4G1MA 5H4YA 2IO5A 4LSRH 1G0YR 4HUKB 5GGRA 3WE1A 1ZMYA 4OZHF 2JKIS 4WK0B 1JXGA 1X9UA 4MA3A 5GZND 3FYEB 1NBYA 3S6CA 1FJ1B 3UZVA 5CKAA 3P2TA 4TN9A 5DLML 2WLJA 1AZRA 1CR9L 1PZ5A 4M3JA 4LSQL 2WAHA 4PGDA 5E1QA 1PFCA 1QRND 3U7YH 4EVNB 5I8OL 3ME0B 2ZUXA 1HHIA 4XE5B 1A8ZA 2X4NA 2B4CH 3QQ9C 2G4EA 3K6DA 1L7IH 4XP6H 4J4PD 3CHPA 5B1AB 5ITFA 4MXQC 4S11A 1NGQL 2XTJD 3WNLA 3ZQWA 4FA6A 1ZA6B 4RFEB 3ZYIA 1HEZA 2EVIA 1WEJL 2VITB 4IIQA 2F7RA 4U1IA 1JGLH 4M00A 3TV3H 4CN1A 2PXYC 4MB4A 2ZUUA 4JO8A 1SVZA 4YSQA 5HHQA 2QPSA 5DJ2A 3DURA 4POYA 1LDSA 2OPCA 3FT9A 1RSFA 5E8EB 3G9AB 2CDGB 1F5WA 2X53A 4N85A 4WWPA 3BVTA 4Q58C 3ZTJH 5BVJB 5DD6B 2GEQA 3QFDA 3FB5B 5BOZG 1GIGH 4CSTA 1BAFH 2C26A 4WFHD 4PJAE 4UOZA 2FX7H 5IP4A 4O2FB 1TYRA 4ZUTB 3UOAB 1MCDA 4MNQA 4PJIF 4PUBH 1S7QA 1PSKL 1NDGA 2OMUA 2F74B 1C5DB 4GIOA 3BUYA 3C6LA 5CLTA 4CN4A 3QEGH 1O9VA 4XVSL 1IARB 4DP9X 1MVUB 4U31A 5D7HA 1HNFA 3BWUF 3MJ9A 3TCTA 7PAZA 2GJJA 4R4NC 4X7TA 3PY9A 4QR7A 3TIDA 4KK6D 2AAAA 4HKJA 3HE6B 3MVSA 4HIQA 2EVFA 3LKOB 3OR7B 3ULVD 3LS5H 1AE6H 1GW0A 1T5WB 3L6FA 3HAEB 2E27H 4D2NA 3CXDL 4KY2A 4L3CB 3ARUA 3BZDA 4FG4A 4XX1E 4ERSL 4MB5A 3MRJB 3DRTB 1OOAA 4MJHA 2WXJA 4B9CA 3DXAB 2VLKB 4YSCA 1ZLSL 2P8PA 3LKQB 4L29A 4HKBB 5DK0A 1ZT4B 3ARGC 1NEPA 3BQUB 2Y7QA 3HUJB 4NRYA 1RIUL 1OT1A 1PYWA 2V4LA 1G9NH 5G4NA 2UZYB 5CCJA 2XZZA 1Q38A 1EGJA 4XCCH 3BPOB 5KVFH 2NNXA 3LKNA 3QPXL 4GRLC 2SEBB 1A25A 5DMIL 4PMEA 1TTFA 3GIZH 5F9AC 1L5GB 1ZVSB 4CBPA 2UXGA 3LV3A 1UT1A 3ZHDA 3HI6L 4HKXB 3C5JA 2F58H 5C09D 5J57B 5FECA 1BFVH 1KELH 5F9OH 2W94A 2X09A 3IRZA 3MLUH 3WKNA 2PXYD 4P05A 3QDJE 4P9HC 4JE4B 1ZT1B 4XN4A 3WFDH 4D0CA 3KCWA 2CM5A 4ZFFB 2XCMC 2ESVB 4NPJA 3KVQA 3KXFA 1SOKA 3GMQB 5E2JA 4KK5D 1QSEB 4WU5B 4M62H 3KYKL 4GQ9H 2H2PD 4BQCA 4YXHL 4KK9D 2WCSA 3QUMB 3HR6A 2G5BB 5FPIA 1T0NB 2EDXA 4RBPK 1A1MB 3IDNB 3EYOB 1PPIA 1TNNA 1BJ1J 3MUGA 3HC0B 1DLFH 3KD4A 3VD3A 4AQAB 1LO4H 4IRZA 4OLZL 3KL3A 2V9UA 4R2GD 2P5WA 1D5ZB 3N43F 4ENZA 5TQ2L 1FVCA 4YHML 4V1DB 1N6UA 1RZKC 4IBQA 4Y5VA 1YLBB 3NCCB 4OJDH 3O11A 4U1NA 5ANMB 2IAMB 4UZSA 5DVLA 1T2QH 2F5AH 1NBVL 4IS6A 4GKNA 3GIZL 3EOAA 1AR1B 3UFIA 4F7CA 1O9WA 4X0KA 4L4VD 5AG8A 3BGMB 3NTCH 2Q8BL 2GFBB 1PX4A 1UT9A 2Y23A 3DJTA 4ZNEA 1N6QL 2R4SH 4LMQE 2N0MA 5DFVD 4IRJC 5CJOH 4Z18A 2Q7NA 3UYOD 1YNTB 4QRPB 2J21A 1KBVA 5ID0B 1S5HB 2R29A 4N6RA 2KPWA 1AIFB 4GKSB 4LARL 5LN4A 4BFKA 2N01B 5FDWB 4WWID 5KSAA 1NQBA 4K3GA 1U8MA 1GS7A 3MV8A 3CC1A 1SY6L 1FVEA 4LE8A 1TEYA 4X6CA 5AOIA 1BBJA 1JGLL 1GCYA 3GSUA 3LNDA 4FQXA 5KSVA 1RJZB 3DJSA 3H1ZA 4U1GC 2NY5C 1LO4L 4OLZH 2DRUA 4P46A 5AUMA 4ZPTA 2XN0A 4LCWE 4XZ4A 1FFOA 5B8CB 3MFGB 3WKMH 3NJIA 4FE9A 2PYFA 4LLMA 3DO7A 3Q1EA 4HS6B 4QDGA 2WWOA 4RFNB 3RY6C 2AV7A 1JVKA 3ETSA 3T3PB 3QR1A 5DVNA 2P52A 5ALBL 3RVUD 1QSFE 5E2WH 5T1JA 1H6EA 4WFGD 4UTAH 2Y22A 5GJTL 3V4PL 4GKOA 4EVNA 3BN3B 3C8KB 1UOWA 1WFOA 3HAEG 2HN7A 1CE1L 5F1OB 3NSJA 5GZNA 1P4LA 5I1AA 3DTUB 5LUMA 4OI9A 4ZTPH 1OAXL 4Y19B 3V5KA 4Y16C 5IGXH 3RJOA 4EDXA 4G6AD 3TPUB 3NSFA 4PJ7F 2WOBA 4EXPX 1JZJA 1AZZC 2E5EA 2QEJA 3QPXH 3H2PA 3U0PB 1JWUA 1OK8A 2WTRB 3TBWA 5KVFL 5CZVL 4TNWK 5FYKU 1BEYL 1BBDL 5GS0H 1XV8A 1JHLL 3MC0A 4JRXB 3W37A 2E7MA 3KAAA 1HXKA 2P24A 3CQPA 3PWUB 4O4YL 1PG7L 3FMGL 5TPWH 1RIUH 1I9RH 1QHQA 3AJ7A 4WI3A 4QAMB 4IBLT 5KVDH 4LSQH 1Y6NR 2NY5L 3WDIA 1KC5H 5FGRA 1OCWL 3ULVL 1S7QB 2OMUB 1DEDA 2H3NB 1BVZA 4R90L 1N3NB 2XVBA 3APCA 4ADGA 5DUPL 3GBNH 3NFSH 5K5YA 2OM5A 3TNNB 3MJWA 3ZKNC 1A47A 2DQJL 2CLVB 5J13C 1E2ZA 4APXB 4PP2A 2I24N 2VDLL 3OF6A 3MNMA 1IT9H 3TIDB 3UROR 1YECH 3GSNB 4AGNA 1IBDA 4YXKL 1IGML 1ILUA 3S5ZA 5CZXD 5C8JB 5EEZA 3QBTB 4YSRA 1GOFA 1R9FA 4HGWB 5L2KB 4APQC 1ZLUK 2VMJA 1S5IH 2WBJB 3M8OL 3EO9H 4UZUA 1SN0A 4DN4L 2AGJH 1KACB 4D7BA 3PWPA 3ZBMA 3BYTA 3IF1B 3QHZH 3NIDE 3UERA 4KUCD 1EDHA 5C1MB 3CPLB 1E4XL 3FB7B 1J0IA 4GMSH 4F7MA 4Y1AA 1OLLA 2APFA 2W0LA 3QFDB 3T8XA 3MYJB 1KJVB 4KZDH 2OP4L 2XWEA 4R7XA 3IVKB 4I2XA 1Z3GH 4FYRA 1XTMA 4OV5B 4L0YA 3KEHA 1WQVT 2LTQB 3ULSA 2D31A 1QBLL 2YUZA 2AV1B 3FT4A 5JHDA 1FLTX 2BP3A 2NRDA 2RCSL 3VFUA 1ZV9A 1NGWB 2WXKA 1PLCA 1JPSL 4JR9L 3GEFA 2FQFA 3CFCH 5ICXB 1TETL 4JKNA 3F7VA 1MEXL 4Z7UB 3DUSA 3QUYC 4BZ1H 4DOHE 1L7TL 2VJ8A 3UZQB 1KB5B 1L7IL 2XICA 3BMWA 5E2UL 3EAKA 1WT5A 5IM7B 3DETC 1P6AB 1VRSA 5D7LE 1WHPA 4CBZA 1Q0YH 3PIQA 4UQ3A 3BPNC 4Y1TA 1FNSH 2C3HA 4NT6B 2VRAA 1TKWB 3P3UA 4LIQE 3X1EA 4BM7A 1JWMA 2PCPA 3ARSA 1V8HA 2MQCA 4GI6A 1UA3A 4TV3A 5E00A 3N44B 4DKTA 4UIMB 4QXUH 3V0VA 2Q3XA 1UB5A 2VDNB 3IKCB 4MCMA 2E7LA 1GYVA 2ROXA 5T3ZH 4X5XA 1OGSA 2NLJA 3UPRA 5EZLB 3HNSH 1OGAB 5JW4R 3IDXL 3AQZA 4FP8L 2R69L 5AEAA 1AHWB 1WCBA 4RZCA 4EQ2A 3ESPA 1BOGB 2A9ML 5E4IA 1N5YL 4DW2H 1KXHA 3RFZC 3M88A 3P02A 3PREA 4XN2A 3V95A 2WTOA 2NTSP 1LP9F 4V33A 1N10A 4KXAA 1W0VB 4ONOA 2ITCA 4Z3GA 5I0XA 5MEOA 3N91A 3Q43A 4A2EA 4R3SA 4JFUA 2NCMA 3BE1L 1LK3H 1NBCA 4Q6YA 4KK8C 4YFDB 3MRQA 5GJTH 3C08L 3V4PH 5FX3A 1Z2KA 3ZSTA 4LAQH 4JM2B 4S0SD 1MUJA 3VO0A 3T4YB 3T3PF 3B9DA 1N70A 1IFHL 1KJ2B 1S7RA 3KPNB 3S36L 4BA8A 3B1TA 1BX2B 5ID1A 4XX5A 3PL6D 2V33A 2EEAA 3HVNA 1AXSB 5SWSA 1F58L 1V3MA 1FSKC 4U1LB 1J12A 3VQ1C 4U6VL 5ERWA 2WK2A 3P11L 1BVNP 3SODB 4OR1A 4R4ND 2ZCHH 1FV1A 2XIIA 4W4OC 4ABVA 5CEXB 3GUFA 1XH3B 5FDWA 3VI4F 3GKWL 3JWNC 3DI2B 4AXWB 5GQBA 1N7MH 1KGCE 3S4SG 1OAKH 3INUL 4NCC1 2GYSA 1JVOA 5DEGA 1CL7H 1RIHL 3VXSD 4J8RA 3JT2A 4LKCB 3MV01 1X3DA 3FQ4A 3H4FA 2EDLA 5GRVL 5J12B 3DV4A 3IE9A 3IRPX 1QLFB 1U92A 4O2EB 1LMKA 5L6YL 2A4EA 3GSUB 3W2DL 1M1SA 2R0KL 4U1NB 4OZ4A 1A7OL 5F7KC 2A83A 2APTA 3NDZE 5AUMB 1X5GA 3J8F7 3CE1A 1ESOA 2RHEA 1UWEH 1KTDB 2Z91A 3VM7A 1KLUA 1Q9LB 3HFML 4FC3E 3QWNA 3B9KB 2FJHB 3OKLB 4LLVA 1F90L 3G6DH 4M1CD 1DR9A 4H8VA 2NY0D 1F1DA 3G5WA 1AG0A 2MNJB 1GKEA 3FAWA 3MLSL 3VXPA 2QTVA 1R5VB 1QVOA 1P84K 2AGJL 4J2QA 3X12A 4FFZA 1L4IA 1NCNA 5GGUB 4M43L 1E2WA 3HG5A 4F57H 3IEAA 2AJVH 4B0MM 5HYSA 4PJAA 1EXUA 4ZG1A 3IDXH 2X6CA 2AEWA 4QHUB 2WZ6A 2UX6A 3GXDA 3RNQB 4X6CF 1Q94A 2P80A 3BT2H 2J56A 3LSOA 5F7HA 3OAZH 1YY9D 1LEKA 4Z23A 3U6XS 3D0LA 4Q6IC 5CUSL 4QXUL 2XQBH 4EIBA 1BM3H 3ALPA 3GBEA 1RAMA 5FGCE 2ZKHL 2GBVA 2XSKA 2QADC 3MJ9L 1SBBA 3IPEA 4H8PA 4ZAKD 1BBJB 2HT2D 5LBSA 1YEFH 4KFZC 3CPUA 5KYUB 2GJPA 2H0JA 3RWJB 2JI2A 1CLYH 1NMAH 4PJDE 3M7FB 4GQ9L 4J12A 3SJVA 3TYGL 4NAMA 4KX9A 4EO5A 3MRPB 5B3JF 3RZCA 2Z4QB 3AROA 2WKLA 5EORL 2JIXD 3HMWL 2FBJH 5AVTB 3T3PE 4H0GA 2VDOL 4GB9A 3ECBB 3LPFA 4J3WA 4NN7B 2F53E 2ZICA 4QCIA 4P5KA 4P3WA 3ZU8A 1TJGH 1MFDH 2OZ4L 4Q4EA 5FGSA 2MSPA 2VNCA 3MBWB 3PWJB 4IRSC 2J25A 5BUGA 2CO4A 3FRUA 1JRHH 1DJWA 3UTTA 4ABQA 3KPOA 4H20H 4EDXB 4JDVA 1Q72H 2YZ1A 3EYSH 5E1HB 2NY2B 2P48B 3GO1H 4NQEA 1M05B 2ZG1A 4YDMA 1YQVH 4P59L 4XN7A 4UT9A 3B9KC 43CAB 3BIBX 5HGBB 3WNPA 4E9YA 3BRDA 3WTWA 3KYMA 2FO8A 1S5IL 4YPGB 2NSXA 4YE4L 3SKNA 1RZFH 2ED8A 1KEMH 3MYJA 2M1KA 4Y2NA 4ETQA 5F72S 3RKDC 3U48A 1FGVL 2AF2A 3IJHA 3LMJH 1RZJL 1U6AH 2OXHB 2BSRB 2NR6C 3K2UH 2ZX9A 3H9SB 4NC1E 5DT1H 3V6OE 4CKVX 4X4YB 3F2LA 4CGTA 1DVFC 2BSSB 4ODTH 5C08B 1TQBB 1PF3A 4F7TB 4WUUE 4L1LA 1SMOA 3ZYJA 2D0GA 5EEVA 2F68X 3LN5B 3DETD 3GSXA 1WWCA 1AQHA 4HJUA 2ZKMX 2F8VA 1KDJA 3MROB 5CHNA 3P9WB 4POZD 1KGCD 1KJMA 1AQDA 1G7PB 1S7SB 4BV1A 1AGEB 2NYYD 1GYUA 4U6XB 1WITA 5EFIB 5M94B 3S3JA 2AS5M 5IBUB 3X3GL 3ESUF 5D6CB 3KPSD 5CJQL 4YHLH 3PWPE 3X1NA 1R75A 4HKZA 5DWUL 2WXHA 3DA0A 3NIFB 3OMNB 2X88A 4XC1H 4FFWC 5E99H 3RAJH 4XOBA 3LPOA 1LVEA 1CUOA 2VDQH 5C0AD 4HUNB 5D7IA 3QFJA 1KXTB 1B2WL 1Z9MA 3S4SB 4NUGL 3EH1A 2JI1A 3EGSB 4KGJA 1SZNA 4ZFOA 2Y2TA 5HYSG 1V7MH 1UQSA 2WYTA 1F13A 4QHMA 2PP8A 1W6WA 1YEGH 2EC9U 1GRWA 5CN1A 1NANH 2CO7A 1HXMB 3QULB 3Q5YA 1LNUA 3QI9D 4KDVA 1F11B 5AL0A 3GQFA 4N87A 1IGJA 3ZTNL 1AS7A 1HWWA 2R15A 2IOMA 2OI9B 2AXGB 2B4CL 1J0HA 2L7UA 3ARGA 3FQUB 1YPZA 2L3BA 4P9HH 1T04A 5AW8B 4G83A 4U3HA 3EJZD 5IMOA 1TTGA 3MNZB 4MDIB 1BGXL 4PJFB 3UTPE 5AW0B 2X0WA 2BW5A 1X5JA 2IAAC 2VO8A 1ETB1 2X38A 1YYCA 5E1AB 4PJEB 5MI0B 3WLBA 2NY6C 1QI5A 3IM1A 4LVHC 4NNYA 3WIIH 2A4ZA 1SM3L 4WFEE 4KZ0A 1CU4L 2OS7A 4XRCB 2Y9RT 5CLXA 1G4MA 1RHHA 2VC2H 2P8MB 5AZ2H 1A7PH 1R3KB 5KJRL 1WZLA 1HL5A 4BGDA 1ONQB 3OHXB 4PJXB 3FFOA 3AS2A 2H6UA 3QUMH 1UCBH 2R4RH 4PJBE 2A6JA 2F54D 3CX5K 3EJRA 3IJYA 5DXWA 3FUDA 4M48L 5CN2A 2WPGA 4JDZA 2M83A 3QR0A 5EV7A 5KBPA 5ACZA 4KAQL 3K4AA 2J43A 4JGJA 3OJDA 4MRCA 4POZC 1LE5A 1KIUA 3BSHA 4Z0XA 4MA8L 1Z9LA 1SMAA 5EC2A 1BREA 5D7JC 4L8BA 2B1HH 4BK5A 3LHAA 1E67A 3UPCA 2OYKA 4PIBA 3WO3B 5IROC 2VN6A 3V6ZA 2F5BL 1YJDL 4HOWA 2E9IA 5ESVA 5DURD 3DWTA 3O6MH 3TIEA 2A3TA 2X70B 5FGBA 3BVXA 3SKJL 4JKPH 5HGAA 4PJAB 4HCRL 2CIIA 5DU7A 1T1YA 4HMEA 4NGHH 3BESR 4Y9FA 1XIWC 2RIKA 3TX4A 4Q74A 2GBTA 3FQ1A 3SDDA 1H6FA 4F8OA 1SEBB 1AMXA 4LL9A 1B6DA 3EDEA 5C0NC 2HRGA 1WDAA 1VEOA 2DQHH 2XG4B 4I1NB 4FTVD 5ENWB 5TE7L 4U0RB 1A1NA 1JZ6A 5FYJE 2WNGA 1DUZB 3I9IA 1S9VB 1HK6A 3DO4A 3RE0A 4LCUA 4JQVA 4YDVA 1MCEA 4PHXA 3VGFA 3RGVD 5IHZA 3OB0H 2KLSA 5JQ6H 2IH1A 2QJDA 5SWZE 5J13B 1CYXA 3P0VH 4MTMA 1EO5A 2EJ1A 3F01A 4F9PC 4B5EA 1SJEB 4WGWB 2QHRL 1O7DE 1NCDL 1AFVH 3VDCA 3HI5L 3O9WD 4AT6B 3WEMA 3NDYE 4KMTH 4XVOA 2VQ4A 1KB3A 2NPLX 4U4IA 1NCBL 2HVKA 2CXGA 3RL2B 3SQBA 1G7JB 1R46A 3B9KA 3DV6B 4JB9L 4PWGA 4WO4C 3J2PA 3U6RA 4HFUL 4C4KT 3DARA 7CGTA 4ZDHA 3MLWL 4IRJD 4NP9A 2HKHH 3BW9A 5C0BE 1DJIA 3V0HA 2XRAH 1ZVNA 2ZSVA 4NAQA 3X12B 1B0IA 4YHOH 5IB4A 3SGEI 1NGQH 5FFOA 3K8LA 1CF8H 4KKPA 5CSGA 3CFUA 5BOJA 3VRJA 3NCJH 4P5MB 4QTHA 5F7MC 3O81A 1RIVL 4HIIA 4BRVA 1E5ZA 3BO8A 1LEKB 1FE8H 3V4PB 3VFWB 5JHAA 1CR9H 3U9UB 2MOGA 2XJLA 1T3FA 2PO6D 1F02I 4PWJA 7FABL 3UIYA 3QIWC 4BK8A 1NFDF 3BVNA 3O9WB 1L6PA 3AT0A 2EC8A 1EDYA 4OLEA 1OARH 5HGBA 4TMPA 4RMVA 3L3DA 4XH2B 1IM3A 2YUWA 5E6IB 2HG5A 1J7VR 3IAGC 4KBPA 2EEFA 2FBRA 3SKNB 3ROLB 2EDEA 1U8JA 4LPVA 1EZSA 4YGAB 4Z3IA 2YQBA 3IMTA 3HKZA 2J8UE 3FCBA 4X6DB 2N1KA 1I9EA 5B3NA 1GKOA 4LLWA 3W0WE 3LHPH 3R8BB 1TG8A 1D6VL 2BSSA 4GAGL 5C08A 2X4QB 3WNNA 4A63A 2VOTA 5H94B 1JAEA 1GZHC 3N40F 3GSXB 1DVZA 5FCUH 5DS1A 1P7HL 2WVSA 1OAUL 5IFAL 4IU3B 1UWXK 2BVQB 1ICTA 2I9TB 1GGCH 4YGVB 1R4XA 2JKJA 1KY6A 4UU9B 5KS9E 5EN2B 5I8EB 2R51A 1AHWC 2IQAB 3FFCA 5CEZL 1TCMA 5ESAA 5IVXF 3I6SA 1EJ6A 1DVFB 1W9XA 3SDAA 1DJXA 5A2IH 1CDGA 2XXGA 1CXLA 4N1CA 3O2DL 3WNOA 4HMCA 3B43A 1CE6B 3EGXB 2ZUQB 1G9HA 3JV0A 2F18A 4FFTA 1I3GH 1MFBH 3QUYA 4IKIA 4WGVB 2FJFB 3QRFM 3CVHB 3F65A 4HLZG 1BMWA 2B2XL 4BZ1A 3HUJF 1XF2B 4JDEA 3MLTA 5DFAA 5BPPA 2E8YA 2XXFA 1QACA 4PW9A 3RFZB 2D7QA 5KSAD 2YA1A 1PU0A 2YAFA 4ZFZA 4DCQB 4U1GB 4LVOC 4K3DH 2IWGA 1M7IA 1SXAA 2YPLE 4YBLB 1KULA 3FT3A 3U82B 2R7EA 4ZMPA 4GBXB 2F2HA 3QDJD 4MAYD 4U7SA 1MCFA 2HLFC 5FF6B 2XLLA 1QYGH 2Y5EA 5CR8A 4ZJ9A 4Z76A 1WE5A 3HA0A 4Y5XC 4RLDA 1V55B 3HE7B 2W59A 5FKAA 15C8L 3WFHB 2BP8B 5CU5A 5IWLC 1G4RA 4K3EL 5L2JA 1EBAA 5BS0B 2BWQA 2EH8H 1A7NH 1DSFL 1HE7A 2X3AA 3D85D 1TQSA 2VH5L 1KCBA 1UHVA 3MO1B 1DBKL 4D0CB 1FVDA 3VFTA 4HCRA 4FXKA 3QAZC 1CGSH 2CNZA 5EEUA 4NNYB 4FCHA 3X14B 1UOVA 4R2GC 3QFJB 4U1HB 2C1PA 3OSKA 5MHSD 3FUKA 1M6OA 3JTBA 4ZS6D 2N59A 2VDQB 2WZ0A 5DZPA 3BJLA 2YQ3A 1XH2A 2YD9A 1RUKH 5B38G 1EVTC 1AG6A 4X4KA 4QLWA 5I73B 1HH6B 3CSTA 32C2A 1EQWA 4JRYA 4HC1A 2DMCA 2ZXAA 4JPVH 3O8XD 4UBDC 4OCRH 3V0WL 3BPOC 1AAJA 1B0WA 2AXGA 5FUOL 3QUKB 4W93A 1MFUA 5CJ5A 4G59C 5KAQG 5CNHA 4BQBA 1LEIB 1FNEB 2W8CA 5L7XL 5JPMA 4BFRA 2ZUQC 1HCVA 1WC7B 3E6FA 1A9EA 1QX1A 2C9RA 1FUNA 2A6IA 2CALA 2OCJA 3ML8A 5KYYB 3QJSB 2OMYB 4F37F 1T20B 2OTUB 1CFNA 4MFHA 3NFPB 4KVCL 3US9A 1FFQA 3W9DB 2UWEE 3ZUNC 3GJEA 3NMEA 4PRDA 1TZHB 2YAOA 1OW0A 2ZPKH 3LZFH 4FXGB 4FHBD 2QFRA 1WK0A 3N1MC 4D0BA 1CICA 2J1ZA 2C8NA 1A3ZA 2J5LC 4FMFA 4J6RL 5FIEA 3U36A 2ZG2A 3BZFB 2PF6A 3OVUB 3LAFA 4FLRA 5H37A 4DN3L 2XN1A 3FQYA 4QTFA 1RZGB 1G7MB 5JR1H 4EI5A 2Y1ZA 3TA3D 3U9PL 1N64H 1BVLB 2DQUL 2VSCA 3VB8A 2YSSB 1FPTH 3NSYA 3L3HA 1HHHB 1IAKA 4N3TA 3W39A 3IBOA 4X50A 4FG2A 5D1ZA 1Z3RA 2XTJE 3OKNA 4RISH 2AQPA 5IHUL 2VE6A 1AD0A 3P4MA 3FH7A 3B3BA 4J39A 1R3IH 3F6LA 3T71A 2D3LA 3IGKA 3VD2A 2BDNL 2PYFB 4JQIL 4IMKC 4DZBB 3MUHL 4GP4B 5IF0A 4A7GF 5C0FA 1SFHA 1TTRA 4O5LL 5FFLA 1HOCA 2VDKB 3EHBD 3N6YA 4YDIL 4EUPG 5BO1H 1A21A 1NEZG 1UGNA 4O2CA 4I1RA 1INEH 4HEPG 1IC4L 2EXWC 3V4UL 1ORQB 4X7CC 2Q76B 1N0XL 4ZUSB 3K0WA 4LCYA 4NKDB 4Y88A 5HHVH 1IBBA 5JHDD 4KITB 4N9OB 3WIHA 4P5MA 4QTHB 2AK4A 2EIDA 1LO0L 4YK4C 1OF0A 3P2BA 1A5FL 3HBZA 4TLUA 3QT2A 4IMKA 1T83C 3KGTA 4WO4B 3SD5A 5IB3A 3GDBA 5H35A 2J44A 1YEWA 3UGXA 3U7WH 4XPHL 1H0DA 3FTUA 5HGGS 4X6BB 4LPWA 1N2RA 3SY6A 1EAJA 1M42A 3QDGB 2ATPA 5CINL 5FW7A 5K9OA 1QR1B 5AFAA 3VFRA 1SVCP 4PJXE 5GRVK 3PWUA 4HZAA 4PRID 1NOAA 2DAVA 4AT6A 3PABB 4GP5B 4JFDB 2GTZA 1KBKA 5JHBA 2APSA 1G7JA 2WUBH 3CH1A 1A14L 2KZWA 3HJ0A 4FKEA 3PYCA 4LSPL 4ZPVB 5DRZB 1ZDSA 4LF3A 4BKTC 4Q56A 1YYLL 2V7HA 1CLOH 4QRQA 4OCRL 1JPTL 2I25N 2WTPA 2NNRA 3SQOL 2PW2B 4MWFA 3STLB 4J3BA 4OGYL 4MMYA 5DHDA 3N1QC 1HAWA 2A4CA 2C3WA 2M2DA 4IRZH 4B27A 4EKJA 5L8JB 1RD6A 1EFXB 3FONB 4HUMB 3MBXH 3I6LD 3T0DA 1NIAA 1WFNA 3OR6A 4JM0A 3MRGA 4RZKA 5GSRB 5KBKA 5IOKA 3DIDA 1KGWA 1RZPA 2XFXA 1ZD6A 3N85H 1ODUA 1QFUH 3H6AA 1VERA 2DLHA 4U2YA 4EDWL 4YSEA 3SDAB 4Y8DC 2WXPA 4WVRA 1IM9D 2CSPA 1H8LA 5D6DC 2WCPA 3PS6A 4AQ1C 3NEOA 1LO3H 3QG7H 4MJJA 3ZE1F 5AKVA 1H3TA 5SWSD 3T2NL 4GG8A 3DX1A 5BZWB 5I1KL 3UACA 4DNLA 4LSVL 5KS9A 4QT5A 1AO7B 1N0LB 3LN4B 1S3KL 4JQVC 1I8LC 1KPVA 3NJNA 4PBXA 4DQOH 1MCSA 1K2DA 3BH4A 1WIOA 1JJUA 2KQMA 1EUTA 4FQIH 4KDWA 2CUHA 4LLWB 1QBML 4R84A 3WUWA 1FAIL 1XH0A 2ICWA 1NDMA 3RY4A 2X4QA 1IC4H 2DLIA 2DLTA 2K3TA 2OI9C 2X6VA 4TPRL 3VFUB 1IZJA 4M8VA 3KPMA 4F8LA 1T6VN 4RQQA 1OCRB 1NAMA 4Z76B 3LZPA 2FQGA 3D18A 5C0EB 1SDDB 1O6SB 5IJDC 5KYWA 2VIRB 5AOJA 3BKMH 3HZYB 3JVGA 1H3XA 1ZXKA 3PE9A 2Q86A 1HOEA 2IQAA 1QO3B 1XF4A 3H9HA 2QADD 4DFHA 1MDTA 1ADWA 4HDIA 5CIPH 1BVNT 2WQ8A 3PU7A 1FPTL 3FTGA 4GUOA 3RZCC 2Z35B 4TUKH 3CLEH 3IMVA 3OXSA 1I8UA 4DEPB 5CSZA 3RDTB 3T4AC 1F8TL 2AXWA 4J7RA 1TQVA 2ZKYA 3G08A 4WCYL 3D9AH 3OAWA 1GAFL 1EHKB 3VXMD 3VTMA 2WQXA 3CZFB 1G1KA 3V7MA 1K8IA 2GCYB 2QV4A 4N26A 3VCLA 4DESA 5EZLA 5FWRA 3H6JA 4J3SA 3WGVB 3WL9A 3L2MA 2QSQA 4UNTA 3UL4A 3BCFA 3GTNA 2VDKH 1IQWH 2IPTL 1I3RB 4NQEE 4PJGA 3F83A 2I07B 3O6FB 1B88A 5MENA 2H9GA 2F8OA 1MDAA 4PCSA 2J8UF 4R2GB 3E2HB 2YOCA 4ZAKA 3MXVL 3DUHA 4JFQB 1QRNA 4TULL 3LQZA 3L4YA 3SE6A 4F8TA 4AQ1B 1KJ2H 5I9QB 2XZCL 2H0PA 2LGNA 3RY5A 3F5WA 2HTKC 1W6LA 1PW3A 5AB1A 4D7PA 2CDFB 3IGAB 4J4PA 4Z95L 4AIOA 4EUPB 1ZSDA 3LY6A 4UILH 2D2CC 4AKQA 1R24A 2Z9TA 4M7KL 4PPTA 1C8PA 1DSYA 5DEJA 3HS0A 1KIPB 3QP3A 1U42A 5SWSB 4YHZL 3NFPA 2PPAA 4P2OD 2X9WA 1WAEA 3W9DA 3OJVC 1HSBA 1LYQA 3N40P 5ERWB 2AZUA 5I26A 1AS6A 1YNLH 5C07D 1OVZA 4XNAA 1ZTXL 3AWEA 4G71B 1BD2D 1KG0A 3HG1A 2DI9A 5JMOC 2NY2C 2CHWA 4PG2C 3U4BH 4DO4A 2C5DC 4WJ5A 5LBVA 1QI4A 2XV3A 5DEGB 4S1RL 4HJ1A 5DJAB 2WQWA 1Q0EA 2BNUB 2DQTH 1Z9SA 1BVLA 4FF9A 4L1BA 1GY2A 2BVUA 3EJPA 5G2NA 4E42A 4X9HA 5KOVC 2VR9A 2X6MA 3LN9A 3V52H 2FLBT 4DTGL 3B7TA 4KKQA 4LFHG 1BPVA 3BKCH 3I6LE 4G11A 2W95A 2V0AA 2X3BA 4FKHA 5D8JH 5EU7E 4DERA 4HWZB 2BVPB 5DJ8B 4HT1H 5IT2L 1CFTB 1RP8A 4AZ8A 1R5IA 4TSCL 4D9LH 2X2YA 5BVPH 4HS8L 2FUTA 3RTLA 3E6FB 4F92B 4LT7A 1KBBA 3N42B 5H2BA 1E9QA 2YRLA 3EG9A 3MGOB 2R1XA 2FECI 5DQDL 5DEFA 4Z7NB 3QXDA 2H26B 1MJ8L 4PBDA 3FYIB 8FABA 2FJUB 4TVPE 1EFQA 1SYVA 2LT9A 3LEVH 1JPEA 3DMMD 5BVPL 1NFKA 1DJGA 3IPFA 1KDIA 4M6NH 4ISVA 2ZCKH 5BO0D 1ZK9A 3FO1B 1JN6A 3KR3L 1YYMH 4LP5A 5FOJA 5FYLL 4ZTOH 4YHIA 3DHJA 2XT1B 3A47A 3FQTA 1BJMA 2O26U 1JZGA 3CUPB 4PJ8C 4L37A 5I30H 4WKZA 3BQUC 1AS8A 1G7LB 2EILB 3Q0HA 3NJFA 5BQDA 3VFRB 1GHFL 4UMSA 1RZIA 1F86A 3FPXA 4QNPF 4IMLA 4ANWA 3SYCA 2E7HA 3MRNA 4GLRH 4RH4A 2F53D 4W9CC 1XGUB 2YOAA 4AL8H 1YN7A 1JK9A 3MRPA 3QIBB 5ANME 2AK4E 1ZRUA 1R1CA 2B59B 3D0VA 3FO0H 3PJSB 3BWSA 3CLFL 1K9TA 4Y9GA 3U25A 1U8IB 1WG3A 1YNLL 3Q9PA 4KRMB 4XX1G 2GJRA 5E6ZA 1ORSA 1RLWA 3Q3GA 1FFRA 3CCHB 3KPRD 1IKFH 4FAAB 1JXKA 4U6YA 1FGNH 4ELKB 2NZIA 3PFUA 3AFLA 2FBOJ 3MBWA 3PWJA 1KT2B 1NPJA 4QYOA 2HJKB 1ORQA 4ZUSA 3OHMB 5IIEA 2JELH 5I1CH 4TTGA 3PNWB 2AK4B 2BFGA 2XTJB 2FATH 2UWEF 2LLLA 3P77A 3CSYA 4OQTH 4RFOH 3TBYB 5EO9B 1HEJC 3QUXB 1UENA 1L9QA 1RLBA 1A02N 5I17B 2WOYA 5KEZA 4KMQA 4WI2A 1N59A 4OBSA 2ZOLA 5D71H 1H0DB 5FEBA 3DJ9A 3N1FC 4KHXH 4XO5A 3QORA 1KWGA 1M71B 2IPTH 5GJSH 3X13B 1KZYA 3RWHB 4RGOL 5I23A 2R83A 1JWSB 2HVJA 2C9VA 5LAPA 3BGFC 3MNVB 3SOBH 3VWKA 1U8OB 5BVJA 3BXNB 5DZAA 1K4CA 1XCQA 2D9CA 5AYUL 2JCCB 3WO4B 5D96B 1T4KB 2BW4A 3SY0B 2OMXB 4F33B 4K7PX 3GT6A 3BHBA 2WKOF 4HZLB 2AAVA 5AB9A 2J6WA 3SGEH 2EAEA 2XWTB 1CF8L 2DM7A 3WY3A 2WWKT 1U91A 3ULUD 4WEEA 2DLFL 3KL5A 2A2QT 3FC8A 2WBXA 4ZX5A 3VSUA 5CD5C 1MVUA 1BHGA 1H6TA 4MNHA 1Y6KR 2COVD 2YS4A 5I1LA 2FO4B 1AXTH 3GMLA 4NRZB 5E8NA 3O6KH 1CI3M 2DWDA 4JLRB 3PWVA 5M95B 3L1FA 4HJIA 1YMHA 4K7PL 3AQDA 2RQ8A 3VE0A 3CSGA 1JF6A 4QEGA 4H40A 2EDTA 4NYLA 4OT1H 1TEGA 3FU7B 2ZWNA 4LDLB 2NY1B 4QAWA 1S7WB 3EKCA 3BPNB 2J4WL 4OF6A 5BZDA 3QDMD 3FTXA 2B08A 5C71A 3WTXA 2C3XA 3CNKA 1JFQH 5I16A 4PJ5A 3NIFF 4S10A 2CJUH 2VN4A 3VAEA 2KUTA 1UVQA 1SXZA 3TZVD 5GJSL 2FJGB 3MV11 2NSMA 5AKRA 4HVBA 1JTPA 3O3EB 4L4TE 1BD2B 3KYNB 3BWUC 4F80A 1HEZB 3UP6A 4HJEA 4PTUA 2AJZA 2DQHL 2B4CC 5EA0L 1RPQA 3B2UC 3O3UN 1KEGL 3FQRB 3BKCL 4ANXA 1FZMA 1IX2A 1KB9K 3V79C 4XVTH 4PJGB 2FRGP 3VXSB 1OM3H 2D4FA 2Y7OA 4K0OA 3TN0D 2LQRA 3KPTA 5IQ7L 1ZVSA 5DD0H 3F7LA 5C0EA 3GMNA 3MFFA 4K4KA 5HDLA 1ET7A 4P2OC 1UB6B 5E70A 1KCSH 2X1XR 5BOPA 3QVAA 3UG4A 5IHWA 4OFPA 3FO2A 1FBIH 4HQQH 2H6OA 1TENA 5J6GA 1ZTMA 2HJFB 5L88H 5T1MB 2PO6C 4Q2ZB 4FG6C 4H5SB 4Z3EA 5IUCA 4X2UA 3BH8A 1GGYA 1I7TB 4P07A 4R26H 5E9NA 3FQWB 1JK8A 2Q1EA 1CZ8L 4RDQG 3TCLA 5KBLA 1N68A 2P7TB 4UILL 2NXYB 4WW2F 2X05A 3ULUL 4IHOA 2EIJB 2P4AB 2BFVL 3IN0A 2XI9A 3MV7E 2VW4A 1RVFH 3EYVB 2XKUA 2GQHA 3FKUS 2ZKWA 5DJAA 2H1LM 1BZEA 4OCYH 1IC5H 5FYKL 4BSVA 2AK1L 2C9UA 1JMXA 5ES4B 2XNAB 2ZQKA 2ZYHA 4JM4H 3CBKB 1KCKA 4JCLA 3F84A 4AG4L 1I1AA 3ARZA 5CKGA 4X9FA 1BLNA 3RWCA 3VNYA 25C8L 1HI6A 3LZRA 4FJ6A 2R23B 3QWOB 1OQOA 1T7ZA 4HC1L 5HDQH 3E2HC 4QLRA 2DQFB 2DV6A 4LLYB 3SCMC 5CCKL 4D9QE 2VZTA 4EUPA 1WTLA 2KZBA 4NO2B 1I85C 3EO1A 1G9NC 1K3ZA 2CJ3A 1INEL 2QL1A 4N24A 3QK0A 3SGKC 3OKMB 2MQGA 1P1ZB 4UCFA 1WZKA 1C7SA 2H26A 4TLKA 4JNXA 2OW7A 1EEZB 3GRWA 2HT3D 3GK8L 4DGYH 1YNTF 2Y5TA 4MMZB 4PJ7E 3BZ4A 4QHLB 1P4IH 1DN2A 3E8UL 3MPCA 3PHSA 5IW1B 3VMNA 4NKIH 1A2YB 3QDGD 4ONFL 5KSAB 2W9DL 3HN8A 5CP3A 2ZAGA 2C3VA 2ITFA 1U8MB 2MTPA 3ET9F 4H8WH 1W0WB 1U3ZA 3S5LA 4JG9A 3IDGB 4F2ME 2OAAA 3ARBA 3QUMA 2PCXA 2LAGB 4AEIH 3QNYA 4NRXA 5CJQH 2OCFD 1QBMH 4GNKB 4PJDA 5B3JE 3JVFC 1F1AA 2PO6B 4R5XA 3F64A 5H37H 5JDSB 4U7MA 1ASPA 2FH8A 4Z7VA 2PUQT 2WC7A 2EE2A 3K3QA 4K5LA 1H9VA 1CFSB 2NTFB 3LZFL 3K72B 4JRLA 3T3MF 4H8WL 1KBGH 2YD2A 3EG9B 1I3VA 1LO3L 4G1MB 3BJ91 2QQLL 1P4BH 3UJJH 4EN3A 4P4KA 3BX7C 5GGRB 1J1PH 1S78D 3DX9B 4ODHL 1YMMA 1JTTA 1D5RA 3VG0H 5FOBB 5I73C 3DX0A 1XIWD 4QO1A 1I82A 1JL8A 1NWOA 2G2RA 2VSDA 2R59A 2RTTA 4N0FB 4PY8I 2W65B 3GK8H 4DGYL 3NFNB 2VISA 5I18H 1UT2A 1ACYL 2XA8L 4U05A 4ZMYA 4CADA 4JG0H 1T5KA 5FM5M 4H0HB 4IRJB 2CHNA 1OB0A 2BNQD 2OSLA 3C5ZB 5AZEH 4WDIA 3QAZB 5DDHA 3V4LA 2IOIA 3WFCL 3WIHL 4TVUA 2B8OT 4HOMA 1S8DA 5SX5K 1AC0A 1WAAA 3VD1A 3L1GA 4TNEA 4HBCL 5JO5A 1AKJB 4L3FA 1TT6A 4EIUA 1VEPA 3ULVE 1IFHH 2DKMA 1OTUC 4C55A 4PCYA 3GI8H 1ACYH 2XA8H 2ERJB 1F2XK 1FHNA 2JJTC 4MCZB 4TUJA 2WIMA 4Z7NE 3UIZA 1NCAH 2UWEA 2WO4A 4WI6A 4XTRC 2APBA 2Q7YA 4AEFA 2JJTA 4RSYA 2P5EB 1CBJA 5JOPD 3A6BH 2C9PA 3D51A 1TOXA 3I6KB 4U6YB 3RRQA 1NUDA 1X6LA 4L8CA 3DVIA 1DFBH 2VLLB 4MD5B 3HNVL 4RWYH 5JDJA 3QDJB 2CG9X 5DI8B 5I1GH 2FATL 4NRZA 1NAKL 5E8NB 2EIEA 4JREB 3U7WL 5EEYA 5E2VH 2SODB 1K5NB 1HILA 1OQXA 3BAIA 3FZUC 3I85A 3X1BA 1T0MA 4B53A 1AANA 15C8H 3L4VA 5KS9F 2R29L 5T3ZL 1U8QB 4UU9A 1TZAA 4WFFD 2OQJB 4HK3N 3VA6A 3NEEA 2CO3A 3RPKA 2ALAA 1C8QA 2HX9A 2OXGB 3B6SB 4P3CL 4BZ2A 4KKLC 3DO3A 4KI1A 4NWUL 2NYYC 4J3OF 5E6RB 4RX4A 1C9SA 4XHJD 2HN7B 8PAZA 1GYCA 1J18A 1PZ3A 1DQKA 1ED3B 3FUIA 1Q0YL 4C56B 2FJFA 3GHEH 1OK0A 3L4ZA 1YPZF 3HUJE 3DIVA 3MTRA 3KBFA 3CHQA 2J1KA 1W0YT 5I76B 1YEDA 4OCLC 3V2AR 4Q8BA 4ANKA 2BO0A 4UQIM 1CMOA 2DQ6A 4FI7A 3N0PB 5HHOB 3GZOA 4A1RA 2RCSH 4AYSA 3MUZ1 3RIKA 1MCHA 2BK8A 2JXMB 5K9QI 1FSKB 3HCVA 3ILDA 3FSAA 5EA0H 3KE0A 1MFEH 1MFVA 1XEDA 1X5FA 4Z7UA 3CDYA 3ARDA 2EDYA 5JYLA 2XN9D 1Z3GL 3LKNB 3DX6B 2GABA 5BRZB 2KKQA 1MF2L 2GSIA 2Y3NA 1JD9A 1AO7E 4HIHA 5C70A 1S6NA 3P0VL 1UWEL 4IDLA 3BEWA 4K9EC 5J6GB 2V7NB 2G4GA 4NZRH 4ACTA 1KYDA 4G6AC 4JQXA 5HDBE 1OEZW 3DGGA 2VDNL 4Z7WF 3MV9E 2QGEA 4XMXA 5E00B 2DEYX 5TE7H 3Q8FA 5F7DB 1DBML 1HAUA 1O6TA 1YEHH 2FWUA 2ESVA 2YWZA 4URTB 3D48R 4DGWC 3ARDC 5C8JA 4X7EC 4LEOB 1IIIA 1U3HB 4PYGA 12E8L 5LXVA 4G80A 3L5XL 3QNXA 3SGKA 4XPHH 2JKTM 3VSQA 1QUNA 2JB5H 4M4RB 1DQJA 5I1CL 4F7KA 2ZCHL 3IAQA 2XDHA 2Y24A 3PWPB 2PYEE 3O6ML 1ILSA 3U9WA 5EOTB 2EEDA 1ZANL 2YFNA 4L05A 2JIXA 3CFKA 3CFBB 2VQUA 5FUZH 2DWSA 2ADGB 5BW7A 1V05A 1G94A 3RIAF 1SVBA 1T4WA 3IU3A 1QZ1A 3L9BA 3ZL2A 1KGIA 3KPRB 2YSTA 4R90H 4G8GA 4AQZA 2NY0B 1KC5L 2XG5A 5BNXD 5I0ZA 1OAZH 3G04A 3QQ4A 5CEZE 1UUSA 3SOBL 4CU8A 1IAII 2PXYA 3O2WH 3KH4A 1P5UC 1HZHH 5HXMA 3ZGIA 1GHFH 6TAAA 2OTWB 4P23D 4X6FA 4ZNEE 1CN4A 3Q05A 3JV5A 1OCZB 2VDML 5AD0B 2OMYA 3GJFK 3ULUC 4OW6A 4LEXH 4DKEH 4I89A 1JGEB 2FWOA 4I0PB 4LGPB 4ZK8A 1W8EA 5E24E 4J3XA 2WGNB 2X9XA 3ARFA 4JB9H 4JRXD 1NGZB 1OAXH 4WHYG 4HSQA 4UQ3B 1A2YA 3NQKA 2R8SL 3NABH 5HYFA 3VQLA 4KKNA 3NK4A 4XNXL 3T77A 2HB0A 4AIXA 3KWWB 4NC0B 3DKHA 4U1KA 3BWAB 3WTYA 2BSBA 2OW6A 2AVFA 3KW7A 4AV4A 2GT9B 2NY3B 3BFOA 4G7VH 4G8EB 2J4WH 2VLRD 3MV8B 1GZQB 2IH3A 5E6YA 3RP1A 3T08A 4A2DA 3UPRB 4PU2A 2QT6A 1A6PA 5EU6D 4A7UA 1HEHC 3A4AA 4LRIA 4UNUA 4YVNA 4K8RD 1XGRA 2AI0H 1O5PA 4JR9H 5DD1L 2Y07L 1OSZA 3L45A 4O9HH 2Y7SA 3OKMA 1W8NA 4AEEA 3KR3H 5MEOB 1ZV2A 5DVMA 1AH1A 4JFED 2AP2A 2XN9B 5JORB 1MRDL 3MKKA 3THMH 4CC1A 4DHLA 1JHTB 1TZGL 2JNZA 3VFNB 2VN7A 2F7QA 3C9NA 1CI5A 4MS6A 5ACLA 3PWNB 2WLIA 4DGVH 4QRRE 3V4VH 1YMMD 2DS4A 2OSLB 4WDIB 1A4BA 1E4XH 1QWNA 5EIIG 4YH6A 3H0TA 3NIFE 5E7BA 4FQIL 4U1SB 5E8PB 3O2VL 2FR4B 3HPLA 5H4ZA 2R2EB 3ZKSD 4AEHL 3ARTA 4QHNB 5GGSA 1EMTL 3WHE0 3AZUA 3AREA 4M5TA 1AOZA 4XCEB 4I88A 5D96C 5HY9A 2W0PA 2XWRA 2DQDH 5FC9A 5IJVA 1A6AA 1AO7D 4KTDH 4YZFE 5KSUA 2VWEE 5IWLA 4XXCC 4ZMOA 5AKTA 2B0SL 4I0PC 4HA1A 2Q8AH 3C09B 3PUCA 4BD4A 3EJCA 1CFVH 2Q2EB 2B3RA 3LKSA 3O6FC 3TVMA 4O2EA 3VFSA 1HXYA 3A6CL 1MFCL 2DMBA 2A38A 2N0KA 4PRPA 3WE6A 2VLLA 4JEGB 4CJ0A 4DP0X 4KPHL 1WV7T 1KIRA 3NQIA 4FADA 4FQCH 4NB7A 5IKCB 2Y69B 3NFNA 5DQ9A 1U93B 3DX4A 1QVOB 4GS7C 4M7ZB 4Y2DD 3WHE1 3JTTB 3KM1A 2VXQA 3OB0K 2V2WA 4WU7A 4P59H 5MEPB 5CBAB 4KQ0A 4LP8A 5D2NB 1DANT 43CAA 3OKKB 3KYOA 4G3YL 3T6WA 5IHHA 2CDEB 1DEEB 2WANA 4JO4H 1A14H 2F54A 4AVHA 3F7YB 2P5EE 3U0TA 3OGCA 2Z92A 4NOBA 4DVBB 4GG8B 4UANA 1FCCA 4OQTA 2WLHA 1FFPB 3ARXA 4PRAA 2YPKB 2CCVA 5TE6L 2CQVA 1A3QA 5GHWH 4FQJH 1BZQK 2X2JA 4I8DA 4GRLD 3MRKB 1B2WH 1O9ZA 5LGHL 4FGMA 1P6WA 4R6UA 2E6PA 3TH3T 2OXHA 1PL3A 3L13A 1JGDA 4AE1A 3D8MA 2MTAA 2FBJL 4PR5B 5F7EL 4S0HA 2AJXH 1NCGA 1LEGB 3GSWA 4N2FA 3OXRA 4UTAL 3VMPA 3UJIH 4LK4A 3WKPA 4YLCA 1RZ7H 2JKWA 4OZFG 3RWJA 4HUCA 2NT0A 3QRLA 3HZMB 3RWGA 2O61B 4F5CE 3MZTA 3HBQA 3TN0C 3WEXA 1GCFA 1FYTB 2NY6D 3SDDD 3ZL4H 5HSFA 4MAYB 5LB1A 3QQDA 5DGQA 4FQXC 1Y07A 1C12A 4ZT1A 3MRMB 3GC3A 4LGRB 4BBWA 3JV4B 4WTZG 3CDGA 4JFEB 1B2YA 1MCCA 5A2FA 2EYRB 3KEDA 2Q0ZX 3UAAA 2BNRD 4EJ1C 3D2UB 2BDNH 3K91A 3F85A 1KTLB 1ED3A 3BKML 4MD4A 4YQXL 1AYO