1OGPA

The crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
388
structure length
388
Chain Sequence
PGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLFIKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSVDRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKDYKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEPGKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords SULFITE OXIDASE
total genus 103
structure length 388
sequence length 388
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ogpA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 1ogpA01
1XDYA 3HBQA 2CA4A 2BIIA 1SOXA 2A9BA 3HBGA 3R19A 2A9DA 3HC2A 3R18A 2BPBA 3HBPA 2XTSA 2A99A 2BIHA 2BLFA 1XDQA 2C9XA 2A9CA 4PW9A 2A9AA 1OGPA 4PW3A 2CA3A
chains in the Genus database with same CATH superfamily
1IQDA 4AQAB 4PYGA 4JY4A 4S1DD 4YH6A 5F1NB 4QRSB 2ZAHA 1V7ML 1CYWA 1K4DB 1XGZA 2NYKA 4YDVA 3FO1B 3PJSB 4AQ8C 1AXTH 4R90L 3DTDA 4UDUB 1S3KH 4JVUA 5F7EH 1VCAA 3N42F 2WLHA 3PDOA 3P4MB 4JVPA 5I5MA 2X3BA 2OTWB 2LT9A 1LO5A 1FPTL 2IV8A 1PFOA 4LCWB 4QTHA 1CL7I 4XPFL 2A9NL 5CBAB 4RQQA 3ZKXC 3EH2A 2Z92B 4W68A 3ZYOA 5F97E 1QR4A 1S7XA 5T33H 3F58H 3V9CA 4NZ8A 2WTRB 3AFLA 3TV3L 3V0GA 3ZTCC 1GGCL 2HVJA 3H6JA 2Y2WA 3Q8EA 4U1LB 3GLAA 4U6TA 4NM8L 3KPQA 3GSUA 5CM1A 4MJ6A 1XCTB 1NPJA 2Y5TB 5I1DA 2A99A 4JHVA 1UEMA 4NQCD 3G08A 1T1XB 1BJ8A 3CLEL 3T08A 3NA4A 4QEGA 1ZLWH 2EDHA 5HP5A 1OGAD 1JZ3A 1C12A 2Y6TE 4YFLI 2G2RA 2ZXBA 3RTQB 1BVNP 1TYJA 15C8L 3IE4A 3G5VB 3QWRA 3RTLA 1S7WA 3EFDH 4E9QA 4KUZH 5D7JC 2AABL 1VZGA 2IANE 1M7DB 5I16B 1H3UA 1JSYA 3KPMB 1NAML 3MACL 4U2ZA 5CJXA 1WFUA 1GXEA 5C6WH 3S7GA 4PRHA 5IBTL 4Z8FH 2XFXA 5BCAA 4Z1PA 3KR3H 5DTFA 1M56B 2Q0ZX 2R0KL 1TVHB 2XKNB 2WW8A 4YL4A 3TH2T 3MZGB 3UBFA 2IQ9H 5E1QA 1BWWA 1RZ8B 4GKZA 5F96H 5C8JA 4Q14A 4X8JA 3IWUA 4B9ZA 4FZ8L 4QXGH 5F7WC 5BUAA 5C0EB 5K39B 1RJZA 4DAGL 3G5XB 4GSXA 5CCHE 1IEBA 5HJ3B 3DTXB 2OLDA 2X87A 3B1UA 3K71B 1EEQA 1KJ2L 2GAZB 3WTUA 1L0YA 5DT1L 2EIMB 4HHAA 4KO6A 4XO3A 5IJVB 1S3KL 3UP6A 3VD3A 4E41A 1FZJB 2XKSA 1PQZA 4JHBA 3BYYA 4JN1L 4LIQH 1I9JH 5BUPA 3DURB 2P8LA 1CDUA 3WTXA 1W8OA 4DP9X 2HH0H 1RHFA 1ASOA 4Z0XB 4X9FA 3T2OA 4QRTA 5D70L 5SX5K 2VDPL 5KZCB 5FUOH 4WU7B 2ESVA 4Z95L 1LO4H 4PJCA 3DUUA 3APCA 2DIAA 2MNUA 3ESMA 1PG7X 3NN8A 1OF2A 2YKLL 2ZX6A 4JG0L 3L6FA 5GRWA 1WYJA 2YGPA 4H5SA 4MAZA 3KWWA 5JPMA 3D3VD 1B2WH 2JELL 3VD4A 4Q74A 2YA1A 4LSRL 5HHOE 3WKML 1A1MA 2AQSA 1DSFL 3A21A 4Y5VA 5TF0A 1OT2A 3VRIB 4AX3A 2JCCA 1A7PL 4DZBA 5IW1B 3LEXB 2FBJL 1R5WA 1BLNB 4NN6C 3SYOA 4ZZKA 3MRMB 1F18A 5D7LD 2W60B 2VR9A 3ZL4L 3QE5A 1EO5A 4RQQB 2VXVL 5C9JA 4FJ6A 2XZCL 3ZKND 3AAZB 3CZGA 4WUUA 1PIGA 1S7QA 2GK2A 4UILH 3BWZA 4R90H 1YYLL 5ACZB 4QTIL 1WAPA 1R3IH 4JFVA 5C1MB 4GP4B 1JGVL 1T5WA 3LSOB 1IBFA 3KPRD 3D52A 5F3HB 1M6UA 2DQHH 2Y36L 1MI5D 4HIIA 2EIKB 3GZOA 3MOAL 1NINA 2FBOJ 2KHAA 2UY7B 4NUPA 2X6VA 1UTDA 1Z3RA 2JKLA 1NFDE 4KKCD 4NFCA 4NJAL 4APQA 1AGDB 4N3TA 1WGOA 4OT1H 2VAAA 4DOHE 1BZ7B 2JIXD 1KIPB 4R5VA 5L8KB 3K80A 2FYYB 4AGPA 2CUHA 7PCYA 1VJSA 4L2LA 5KS9F 5BS0B 1QKZL 4G5AA 4NPJA 3UGEA 4K7PH 3GSVA 1T0MB 1DBKH 1P1ZB 5D9SB 1U93B 4XP5H 1N2RB 3RY6C 1MWAL 2A2QT 1NCJA 1I53A 2E59A 4GBXA 4OZGF 2PUQT 4I3GA 1T1ZA 1Z5YD 2ZNXA 4WV1C 1RZJH 4FXGA 4XR8C 3G6AB 3KNBA 3CCHB 4A7UA 1KIUA 3A6OA 3ZT5A 1KYFA 3BH8A 4OFQA 4QHKI 3W2DL 2IG2L 4PIBA 4AEHL 4EBQH 1MW0A 2ED9A 1JUFB 4NKDB 2Q76B 4G7YH 4UQCA 5JW3H 1AC0A 5K69A 2HFTA 1J0YA 1DQVA 2GIMA 1M9SA 3M46A 4WFGE 1U91B 2NZ9C 2KKQA 2DYRB 1XB8A 4MAYD 4P59L 1U3HD 3T6WA 3FAXA 3DYMA 5KVDL 2TAAA 4FZ8H 3LDBC 1NQBA 4OSUL 4QRQB 1DE4B 1G6RH 1ANUA 5A6MA 1QA9B 3ZO0A 3NJFA 5GGQH 3PL6A 1ND0A 1FFOA 2GUOA 4KROC 4XWOC 3WS6C 4EN3A 4K5MA 1ZSDA 4E0RB 1OTUC 1P84J 2APWA 5HYSA 3VVVA 5C09B 1GY1A 4CW1A 4HWZA 2J1WA 4JCWA 3QA3A 5SWSA 2IMNA 3DV6B 3PAVA 4LCWE 1BG1A 2W94A 5I1CL 1B4JH 4FTVA 4GSUA 3RLSA 3OC5A 4ZQKB 3I3BA 2BSEA 5I1AA 2MOGA 2C3HA 1TTGA 2CD0A 1L5GB 4UBDC 4DETA 4F24A 1HQRA 3O41A 1OOWA 4QGYA 4OCMC 1KC5H 5CJXC 5E1AB 1J9SA 3FOMA 4D8OA 1YO4A 4ZUTB 1H9DA 3EOBB 2P1YA 4G9FA 3O3AB 5HGDB 1BZ8A 2GJZB 2J1ZA 3IJYA 4XBPA 4Y5XA 4GSQA 4DVRH 2D7NA 4Z95H 2ETWA 5H94B 2PETA 4Y4KB 1MZZA 4LCUB 2WKGA 4OCWL 4Z23A 4TTGA 3A4EA 4DH2A 4HZAA 1PU0A 5ABAA 2AQTA 4HX1B 5D6DA 3W9DA 3FT1A 3GSNB 4BFNA 4UV4L 1IEHA 5GGUB 2EXWD 1DCEA 1JXFA 1NANH 3I6KB 1CGTA 5LGYA 5JLZA 2XNAA 1OPGH 2DM3A 4FI7A 1OP5K 3TBYA 1UZ6E 5I1JL 3PXLA 2OJEB 4V33A 1BIHA 5A3IC 2BRRH 4MSWB 5BPPA 1XVSA 2KDGA 3FTYA 4N68A 4XH2A 4ZMNA 3FFOA 2HUEA 2OCJA 2FLMA 1RHHA 2HVBA 2P5PA 5HHNA 4KRMB 4JM2C 5IVXF 2F18A 4IRZA 1GY2A 1I31A 3KXFE 3KLHD 2CJSA 3UTSB 1SQMA 1T7XA 3BDBA 4GI8A 2ZCLL 2YLHA 1FNSH 1E67A 3V4UL 1NOLA 3ABMB 2J4WL 4LCCC 1RUML 4GB9A 2BHFA 5BV7L 4Q89A 1G6RL 1MSPA 3O9WC 4GMSH 4KAQH 1T7ZA 4RX4A 1KACB 3ARFA 5TH2A 1JGVH 1T4WA 4PRAA 2J5LB 3Q6GL 3GZQA 1WS8A 4GH7B 4Y4FA 5CKAA 3V0HA 4F3FB 5E99H 3ATAA 3S35L 2GBVA 4OUUB 3HC3H 4M43H 4OLXL 5G2NA 5DK3A 3DSFL 5C0JA 3JV4A 1T3FA 3CCHA 2XN2A 3BT0A 4TLKA 2H32A 4KK6D 5DD3H 2O5XL 4J3XA 1WLHA 3BUPA 1HCVA 1UWFA 2V4LA 1WAAE 2OP4L 2Z1PA 3QUZC 5AOIA 4JRXB 3F7PC 3JWDH 3JXAA 3NJMA 4OZGE 3QZBA 5ID1A 1WG3A 1D5BA 4GXUM 4K23L 3ABZA 4L8CB 1YDPA 2AXJA 2NLJA 1CLVA 5JIKA 2EDYA 1G9EA 4LDOB 1K6QL 4FFYA 4P2RA 3BAIA 1BZ7A 2GABA 4MS8C 1VACA 4S2SA 1EJ8A 2F54E 2Z35B 5CZRA 1U3ZA 3B34A 5JLZB 5B3NA 3KS0J 2F5BL 3MRDA 1BQHA 4QWWC 2D7TL 4YR6A 5BZDB 3QUXA 2ZP8A 2ZSVB 3L6FB 4UU9B 1RD6A 3PABB 2NSXA 3EDDA 5CNHA 3FFCD 1U8CA 4Z7UF 1U8QB 2YAOA 3W9EA 5IB1A 1OKEA 4Q4EA 1WZMA 4GW1A 1WZAA 4XMXA 1RU9H 1M7IA 2P7TA 4X5PA 4CKVX 2WXKA 1GVIA 1DO6A 3UC2A 5HGDA 2VR4A 4UOW1 4E2OA 3JV0A 2XWTB 4X6EA 1QSED 4AJWA 4MWFB 3NTCL 1JXJA 2CHXA 5BUGA 3VXTA 3PWPE 4YJZL 3QORD 1F90L 3WTVA 3ARFC 1YEDA 2UY6A 4KO9A 3U0PA 5IHUH 1SUJA 4HK3J 4UANA 2EYSA 2BIOA 2C9XA 2P28B 1Q94A 3TA3C 1X6NA 1PLCA 3W5NA 1QO3B 3QRFM 1J1OL 1RJCA 2JMRA 5EO0B 5F3BB 4FXLA 4HFWB 5T3XH 1JF1B 1OTUD 1QA9A 4KWUA 4OFYA 3LQAL 4RISL 2RMNA 3HS8A 5DLML 1PF3A 2P80A 3RPKA 5L88L 4Q52A 2CRIA 5D2LE 4ZMQA 2BSED 3EJZD 4KQ3H 1BZDA 3MLZH 1HWGB 4OTXL 4L4JA 1WWCA 1E9QB 1U3HC 5DUBA 2FEEI 3GIZH 3B9KC 1ZT7B 3RIAF 3K91A 1TG8A 2PW2A 1UZ8B 2R0KH 4JBSA 1A14H 1DJIA 1TMCB 1FO0A 2ZCZA 1OP9A 3NQKA 4BCZA 3SDDC 1TMQA 1BX2A 2AAVA 4G6FD 2WYIA 5J9PB 2HFGH 1E4XI 1F3DJ 4QXGL 2QEJA 4BHUA 4PUBH 4U7MA 2HWZL 4GKNB 4GAGH 2ZXGA 5L4JA 1I1YB 4IIQC 1ORQB 4R96A 1WISA 2IOMA 1HXKA 1B0RA 1L9SA 3NCWA 3OBAA 2A4ZA 4FG0A 1F0LA 4PJIE 5ICZA 2XTJC 3SOTA 1F86A 3SIKA 4YBLC 1E8ZA 1NCGA 2VABB 5A2IH 3FZUC 2VM9A 4IKLA 2DMHA 3LY6A 5EOCJ 3RY5A 3TPKA 4HZLB 1GGTA 5DUMH 4D94A 3QP3A 1IFGA 1U33A 3P73A 1XGPA 3D39B 4N85A 3N3EA 4ZMYA 2VIRA 1J5CA 2F0CA 3CLEH 2OTPA 1YPZA 2OI9C 3RWCA 1TTBA 4P3DB 1MCWM 2X4QA 3K2UH 2ZP9A 3GHEL 3VG0H 3MRIA 5IW6A 4PB9H 3BEWB 1W6LA 4NCC1 4ABWA 1YEDB 4CGUB 3PDOB 1A4KB 1HKLH 1RZIA 2FO8A 4ZDHB 1QOKA 1ZV9A 4YEEA 4QMEA 4WO4B 4FQIL 5EC2B 5E6IA 1R47A 3OJVC 5E8NA 2FX8L 1W0VB 4E42B 4M43L 1R3LB 3BVWA 3H9YA 3EJZC 1XGTA 2VZVA 3O11B 2YWZA 3RURA 2TRHA 4JY5L 3FU5A 1FYTD 2K7QA 4X9GA 5C0AA 3QJVB 3EXLA 3P1VA 4OCRL 3MOQA 2NT1A 4IRSA 3ULUE 3G08B 4DEUA 3QIUB 3UROR 2K45A 1ED3B 4LAJH 1V05A 2J8UA 5EU7C 4GRLA 1C7SA 4MA1C 2X0VA 2VDOB 5K1JA 1SEBB 4BXVA 4Y1TA 5EPMA 5KVGH 5IW6B 3KE0A 2ZKXA 1GS7A 3DIFB 4KOCA 4OJCA 1W9XA 1G7HB 2CBOA 4FNQA 3RFRA 2YEVB 3IRCA 3L13A 4XZ4A 5DRWB 3TYGL 2OTWA 1HE7A 1KIQA 2D4DA 3VI3F 5C7XH 1KIRA 2F8IA 3HE6A 4ORGA 4H26A 3OKDB 5D6CA 4KXBA 4Q9QL 5E4IA 4DP1X 4HZ1A 4N26A 1P7QD 5FCUL 1JHLL 3ILPB 2P5WB 5ID1B 1L9TA 2FJGB 2OTUA 1G7HA 4HJGA 3D4YA 5BNXD 3WMPA 3LN4B 2ESVE 4ZS6D 1K4CA 4PJ5B 2IADA 5I8KH 3LIZH 3LN5A 3A6BL 4JFHD 4Y9BA 1UGNA 4CN4A 3LKQB 1BQRA 1JZJA 2HXAA 3WI9A 4KUCF 3BD5A 4XMUA 3AWFA 3KDMA 3B5GA 3T2LA 4DKDC 1KCVL 4G43B 1AOZA 5TFSL 1XX9C 3QDJB 4PMEA 4UB0L 2WTPA 4WGVB 3O6ML 2OFQA 1PJWA 1XCWA 1U8IA 4FLSA 3VI3B 1JNNH 2K7PA 3ZR5A 2OK0L 2XZZA 3NK4A 3TZVD 5E03A 1JVOA 1UZ8A 4Z7WA 3VG0L 3NFPB 2YD5A 1MAKA 1IT9H 1XR9B 4CADA 1CGSH 1O6TA 3IMTA 4NUGH 1TJIH 1ZTXE 4JE0A 1IL1B 4L29B 5DZVA 3LMJH 5T3XL 4WTXA 5HJDA 1RZKL 2PYED 2EDKA 1U3YA 3REWB 3FYEB 3Q44A 4H20H 5SX4H 3SOBL 4P2YA 3TO4A 3LNFA 4HIJA 2OMTA 5CKGA 5K5YA 3VD0A 3VFWA 2NX5E 1NCBL 4NQDB 4F5CA 5KEZA 2YRBA 3ZDYF 3DWTA 2XPZA 5DVPA 3U4BH 3ZZ1A 4MSWA 3BYTA 2I07A 5KUMA 5EDSA 1XGQA 3ETTA 1KJVB 4PJEB 1AH1A 4QKTA 3GI8H 4J3BA 1KTDB 3CE1A 1JPFA 2ZSWB 3T6ZA 4P2OB 5DZAA 4PJIF 4YMPA 4CADB 4XMWA 4JQIH 1WFNA 4Y2OB 1XCQA 4GAGL 1AYRA 3LH2L 4FTVD 4HHWA 5IJVA 4M6AA 2NCEA 3DX2A 5E2UH 4UZSA 4U6XA 5IM7A 3CPLB 2BJMH 2DQDH 1FVDB 1ODUA 2QV4A 5ECJE 1QNZH 3TVMA 1NTDA 4HH9B 1M9WA 2VMDA 2UWEE 3MREA 3T0XA 3NIGB 2C1OB 2J21A 9CGTA 1NCCL 5A3ID 4KZDL 3CFBA 1I7UB 4PJXF 4XNXH 3FBKA 1C08A 3IFOB 2ZWSA 2Q2LA 1M42A 4I13B 1MWOA 4DVBB 2NX5D 4OCWH 3S36X 2CA3A 3CDGB 5D5MA 4MDJA 4BZ1A 1WIPA 2A9MH 2LVEA 4QXUL 3AXHA 1LP9E 1KN2L 6PCYA 1IKFL 1I8UA 1MI5A 3PP3H 4MJ2A 1KNOB 3ZRFC 4R2GC 2BSDA 1CDCA 5E2JA 5IHHA 4N6QA 4PCTA 4NWTH 4LP8A 1IM3A 3M17A 3QJUB 5TDPA 3C8KA 3U1PA 2FT8A 4IMKC 1UD2A 5FM8A 3V0AC 1X5ZA 2X4PB 2IBBA 3F6JA 2XN1A 3FU7B 4LMQI 5IV2A 3B5TA 1N3NB 3ULUF 2VL5B 1JI2A 4QO1A 2J56A 2B1OA 2C4FT 4UTBA 3NIGF 3VRLE 1TZIA 4QRFA 3MRBA 4UBDD 4D0BA 4LE8A 1N64L 3II2A 4AXWA 1NSNH 3F7VB 4NQEA 3DV4A 3I3DA 4GP8B 2VLRD 3KJ6L 4LO9A 4A63A 2ZPKL 5J3HD 3LN5B 4FHJA 3FQWB 1X5AA 3VXNB 1WEJL 2PTUA 2VO5A 4IJ3C 1PY9A 2YPVH 4X8GA 1R3LA 2VN6A 4MA8L 5ABDE 5KVGL 4PGBB 3NCMA 1IQDB 1DLFH 1MI5E 1BVLB 5AVZB 2X44D 3IETA 3SZKC 4XWOD 1NDGB 1MFUA 5E00B 2ZP0T 3O6FC 2HT4C 4M1DH 4EO5A 2OXGB 2Z3FA 1OQOA 5CU9A 3EZ8A 4XPFH 1ZTXH 4OLUL 3TBVB 5CU5A 3MYJA 4YZFF 3UBXG 4WK2B 3T77B 1HVXA 5I1EL 1GYCA 3GYRA 5D2NA 1FYTA 1X4ZA 4JN2B 1VZIA 5C08D 1SEBA 3F6IA 3PGCB 4RGND 4NM8H 5IB3A 2XKUA 1IAMA 1QW8A 4PTUA 5EF0A 2R0LL 2ZKMX 3BX7C 2X4OA 3BAYA 1R5VA 1S9XA 5TFSH 1JHTB 3TJHD 4AKPA 4DTGL 1R5IA 4PJIA 2RH0A 2QPFA 1CFSB 1C16B 4ZO6A 1JNNL 4QRPD 1TJHL 4AOFA 1PY4A 1FGVL 5A16A 3ESVF 4ZMTA 5HPOA 2SODB 5I28A 1EDHA 3S8WA 2CKBL 1DQTA 3MNWA 4MNQA 4B7LA 2VLJB 3GKWL 3JUYA 1DJSA 4MVBC 4WU5A 4XXCC 4HUVA 1YYCA 2ZUWA 1YNLL 4K8RL 4W1TA 3VXQA 1FV1A 3HBGA 3D4CA 2WP3O 4EPSA 3ENEA 1VGKA 2EDOA 4WO4A 4OKVB 3SOBH 2R8SH 2OJZH 2WBWB 1I1RA 1HJCA 4OVUA 2VJXA 1NAMH 3MACH 5ETUB 1FNFA 4TOYL 5INCA 4G6KL 1FNSL 3U4BL 2WJ5A 1DYZA 3Q2LA 4ODTH 4LCYB 3UZVB 4XX5A 4ANUA 1EDQA 4TXVB 3RFZB 2OMWB 4G59C 3MBXH 2D7MA 2OMXB 4LVHC 4XE0A 4X7CC 4NZTH 1VFMA 2DWDB 3RX9A 4H5SB 3SPHA 2AV1B 1KJ2H 1VIWA 2J88H 2OW6A 3BP4B 4JHAL 2QQNH 1G4RA 3B3IB 3UTQA 4EUPA 4I0PA 4RMVA 1FNAA 4ZUWB 3IMRA 2JQMA 4FQXA 1I1FA 5DJXA 2VDQH 2Z7WA 3A5VA 5E8PB 3WNIA 4FRWA 1A9BB 1IBHA 4JMXA 1J9TA 4TSAL 1ZTXL 4EI6A 3U0WL 3HHRB 1QSFE 2P80D 5AW0B 5IVZB 1S5IL 3E3QC 2OP4H 4P2OC 4P57B 3U4EA 4JFDE 4ZUSA 4NXKA 2EZ0D 1A9BA 1E4KC 1M6OA 4GW5B 2VDLH 5GGRY 2O5YL 4XMLH 4Y89A 3RWGB 1AGEB 4KZDH 2EACA 1OAZL 2RBLA 3BWUC 3SDCB 4D0CB 1IAKB 3WIHL 4DP5X 2ENSA 5KYYA 3KL0A 1T1WA 3U25A 3SPIA 3CXHK 4HIEA 2VDKB 4M02A 4PV9A 4E5XA 2IAMB 4XT1C 1B2WL 5B38A 1P5VB 3HE7C 4J6RH 3KPQB 1J11A 2YR3A 2NW3B 2AF2A 4ORZC 3T1FA 2EIBA 4AYFA 5FR3A 5AW8B 1YN6A 5DJYA 3ZSSA 3ES6A 2BC4B 3BIBX 3TXAA 1XF1A 3HHSB 2YKKA 1GSKA 4AYDC 3ET9F 5IBLC 1CPUA 3O4LD 4XO4A 2D73A 3MLXL 3S2AA 4H88H 5CP7B 4D3CL 1LNUB 3TH3T 4I8DA 2V3FA 5DRZB 3AT8A 2Z31A 1E2WA 1FZOB 4E9XA 3IKCB 1AHMA 3L3OA 5EZIH 3OZKA 1ZTMA 2YA0A 4JFYB 1QTYT 5BZDA 2DLEA 3K2UL 3TF7C 2DW5A 1QBLL 3FO9A 3MUY1 1MXGA 1S78D 2GJ6B 5DLMH 2Y7SA 4IOSD 3ZQWA 3VVWA 2OA9A 5DWUH 5L2JA 3HOGA 1QVOB 3W81A 1T89C 5F0LB 2A6DA 2FX8H 4PP2A 5HHQA 3LXAA 3NEEA 4I4WB 4DQAA 1I8KA 3VQLA 2YGVA 4HWUA 4BGLA 1XEUA 1GS6X 4RSYA 5JZ7D 2VB5A 3MCLH 2GUYA 1TFHA 1BECA 1HDMA 1TJHH 1WUZA 3FHEA 1HT6A 2AZAA 4NAQA 3TM6A 4HUNB 4YIQB 2VDLL 5D55A 4BH7A 4A2DA 5AVUB 1TFPA 4DGIL 4DTGH 1HI6A 3EHBD 3QI9A 3UDWA 4JDEA 5I0DA 1GZQA 3FQTB 4NENA 2A6KA 2ZOLA 3D85A 3AUWB 1U4FA 3G6JE 4NO0B 3VH8G 3CGTA 1DUYA 3DJSA 3DX1A 4QRTB 3ILQC 5DJDA 2WIIB 1RZPA 2H47C 3CIQA 4F7PB 1VSCA 3VGEA 43C9B 5CCKH 1YEHL 3BUYA 4WSGA 2X05A 3GBMH 4AMWA 5JXAL 4IYKA 4ALAH 5AENA 3FB7A 3DK2A 3BSZA 2OXHB 2R29A 4PRIA 3L3HA 1JBJA 4WI0B 1KCLA 2X4PA 1AQKL 1Q72L 3TBSB 5IBUG 2XTJB 3NRFA 4Y2OA 1LWRA 4K3HA 3CFMA 1C8PA 2NY2D 4ZUVA 2XZAH 3C09C 2H9GB 3MRRB 2RAMA 3VWJA 4B96A 4LXFA 2DPKA 3EOAB 4RFOL 2XN9A 3HNVL 5F7NC 4ELMB 3FFCE 4KO7A 4NHUB 3I3EA 1BD2E 4PS7A 3V79C 5B22A 2B16A 3OKKA 3QORA 4GIPD 4CW1B 3Q6FA 2R7EA 1ZT4B 3BFOA 2V6HA 4XHQA 1E2VA 2C1OA 3QIBB 4G8GE 1I9RL 2ZUTA 4KTDL 5BZWA 1OCWH 4FXTA 4GPVA 4KDVA 5C0BA 4W9IC 1XGPB 3D39A 4XC1H 35C8L 3VFUB 3MBEB 3G5ZB 4APXA 5MP6H 5DVKA 4ELDA 2IF7A 2HFFA 3KPTA 5KSAD 3UBXB 4HKZA 3L3HB 2OV0A 2IMMA 3D4GA 3CZNA 3K0WA 3ARGD 4TLTA 4PJ6A 1Q1JH 2PTTA 2VKXA 1ZOXA 3ZIYA 3E3QE 3SE9L 4GLRI 5H8DA 2R4SL 1CFQB 1I4FB 3C6LC 2WKLA 2WLIB 1NCBH 1AZNA 2HFFB 2KLRA 4FF9A 1BBDL 3UBXA 3KD4A 4PV8B 2E56A 2MMXA 3HRPA 4XPHL 1D5MB 3G6JA 5K9OA 1QI5A 3ALWA 2F54A 3QQ3A 4XBGA 3SE4C 5I6XC 5IFJB 3GI8L 1NUFA 3O0RH 2R7EB 3VI4B 4OCNC 3L4YA 1D2PA 3MCKA 4NOFA 1DBBH 2X4RB 1N2RA 2I24N 3TN0D 1EMTL 3STBA 4OD3L 3DBSA 4GEIA 3HB3D 4XB8A 4FCHA 5K9OB 5CCKL 2WYTA 4G11A 4X5WA 3C8HA 6FABL 2EDDA 5HI5D 1YHPA 3L95B 4WI0A 1WDAA 3IRZA 3QSKB 1CD0A 2A6DB 1O6SB 2NTSP 4PJ8A 4XOAA 3TGXA 4B9CA 3K7UA 4KX9A 5INCB 4HOMA 5GJSL 5H37G 2WXIA 2E8ZA 3TEZA 1NFDA 1HK6A 2BWIA 2YEZA 1U91A 2Z6FA 1CGSL 4KJWD 4N20A 4NP9A 1IGYB 5AFAA 5I16A 1CE6A 2MQ3A 1PNDA 3SDDD 4H1LB 5D8JL 5E99L 5T3XD 4N2IA 3S35H 3O11A 5D1ZD 1UWYA 2XXGA 1GS8A 2VKWA 3LKQA 3B9KD 4R83A 4P5TD 4KKPA 2FT6A 5CXPA 4I2XA 3UTPE 3KWXA 2GJPA 3RKDD 1DUZA 3JWOL 4ECNA 5KSBB 3VWKB 2HMID 1PZUB 2V2XB 1IGJB 1JJUA 1O7VA 2B8OT 2WKOA 3HI1B 5A7BA 5MP6L 4GAJL 4IKIA 3I6GA 5CAYB 4XN7A 4ZG1A 4JM4H 3PS6A 4U3XA 4PH8A 2ZWKA 4MA7L 3TA4D 1DJHA 5J89A 2ENJA 1WAAF 3LZLA 5F7AA 4YX2L 2QVIA 4DGIH 1KFAL 4GRLD 1A1NA 1BQ5A 5F9DC 4G8EA 5FV2A 4P3DA 3DUSA 3QIWB 3R19A 3CDCA 3IFPA 5F7HA 4WKXA 4PJXE 1GTFA 1J8RA 5JXAH 1UKSA 1TTAA 3UC0H 2E7LA 1PS3A 3M1BB 1OSYA 2O6CA 1KXHA 1ZXQA 3MNZA 2DWEA 5FKAB 2DQDL 2F7QA 5FCSH 3ZN6A 4LT7A 1LDSA 3BJ91 5ISZA 4GRMB 3TASA 3GSOB 5I17A 2BSBA 3BI9X 3C2AH 4PIRF 2WQVA 1NC4A 2VAJA 3WJLC 4RFNB 1RJLB 4MB5A 1VFAA 1DQKA 2HZHA 1QAWA 5GZND 3V7MA 4CMMA 5F1IB 1QSFA 2G0LA 3EDJA 2GB2A 4ZTEA 3BRFA 4OR1A 4MQXD 3SGJA 5E8PA 4PJAB 1BX2B 3CFQA 4UM9A 1XTLA 5F7KC 4D9LL 2A74C 5L2KA 4OGQC 1VDGA 1OAUL 1F90H 2WO2B 2Y7OA 4WNJA 3QK0A 4XNZC 2R2EB 1K2DA 4Z0BH 4C57C 1I8IA 3TO4C 4UT6L 2H3NB 1IEBB 5HJ3A 1EO7A 3QXAB 3RU8L 2L7JA 2CQVA 4DCQA 1YAZA 3PL6B 1D5MA 3ELQA 1BCIA 1YEFH 2IDTA 2VDMH 3F64A 1FAIH 5ERWB 1T22A 3DXAB 4N8CL 3W0WA 4PGZA 1KGWA 2OR9H 3QWQB 1YNLH 4NC1E 4HIEB 3UG3A 1TVBB 1CF1A 4WK0B 1UCBL 3D08A 1L7TH 5FX3A 1SDDA 4JY6A 5I19H 4FLHA 2ICEA 1ZLVH 5FM4A 4K3EL 3M7FB 1N59A 3BXNA 3WEXA 4RA0C 2C7FA 4Q9RH 5HI3C 4YS4A 3HRZB 4GXVH 1P4UA 2GEQA 3LS4L 3CC1A 1X4YA 1PSKH 1H0DA 3QDGB 1H5BC 1I3GH 1KDIA 2PYEE 4OLUH 5AVVB 2Q6WA 5GRYA 4L0ZA 5I1HH 2ENYA 2Y69B 3VXPB 3SDAA 2VYRE 3H9SD 2IWFA 3BKCL 1BG9A 3ULVC 3PLYA 4AJVA 1H9VA 3LS5L 2QQNL 3CFDB 4ZO7A 5CILH 3MPCA 3QFGA 5KJRL 1SQ2N 3HKFA 5FO9B 4P49A 1VPOH 3GMQB 1I3RA 3HG5A 2V5MA 1X44A 2YHGA 3MJWA 3ILQD 3NH7H 2IDQA 1ZHNB 4FN0A 2RQEA 4XNQA 2B9AA 3V52L 1XB6A 4QRAA 1GOFA 2VE6B 3GM0A 3JVFC 4MNGA 2YGOA 1AR1B 5F21B 1MVUB 2CO6A 4C56D 4EZJA 1AVAA 3AXIA 4XXDB 2WBKA 2DL9A 3P4OA 5D2NE 3F7QA 2FQFA 2D31B 1W0WB 1YDPB 4HIPA 4N6RB 3IGAA 5JUEH 2HA1A 4R4NC 4AYID 3P0VL 4HJUA 2P44B 3ARQA 5D8JH 4U1NB 2UV3A 3EDFA 4IRSC 1JUFA 2SEBA 4AGNA 5IVOA 1KZQA 5DYFA 3EJPA 5TF1H 1ZVNA 4R7DA 5KBNC 1EHNA 2HX7A 4Z0BL 5GRXG 4IRJD 3WHXA 3S88L 1P1VA 2NQDA 3Q5TA 2ATPA 2DAVA 4NQSA 4ZFFA 1VEPA 3O3UN 2VAAB 3LPPA 3PYCA 3LOWA 3C5SA 1NH6A 2KYIA 1QFWH 2YD4A 5EC1A 3X1GA 2GFBB 4AXWB 3MRQB 4JFQB 1DN2A 3NJGA 2WYHA 4OI9A 4BGDA 1T7WA 3F62A 3C5XA 2Z91B 4JM4L 2UZIL 2B0SH 3NCEB 3FFDB 4MNQD 2MCG1 5GGQL 1ZA6B 1FI8C 1T5WB 3F7LA 1MHEA 1NCAH 1V7MH 3BQVA 3X13A 4F8LA 4HAKA 4IW4C 4LDCA 2WXJA 1KB5B 4D3CH 1OP5H 2ZUSA 5IR1A 4WTWA 5I1CH 2NNRA 3WLBB 2CIIA 3MYJB 3CHQA 4FABH 1PZCA 7TAAA 2WCSA 3HI1A 4PJ7E 4N2OA 3TWCH 1R6VA 5CR8A 1CC3A 3FHQA 5TDOB 2WVVB 4B9KC 3ZGHA 3OZ9H 4F33B 2IEPA 4EDXA 4Q0XH 3HZKB 3VI4A 4BSWA 2ZXQA 1NC2A 5DURD 4DGUA 1S7QB 5FHAH 3DURA 1OCRB 2QQLL 4FZEH 2Z91A 4PGCA 5C08E 2QPUA 2OQJA 3VH8B 1QRNA 2G4EA 4C56A 2GHWB 5BQ7B 5GGUA 1FNGB 1MCHA 1R24B 3RKPA 1F56A 2W81C 4HKXA 3WTWA 5HHPA 2XNAB 1XIWD 1U95B 2C3WA 4V1DB 3SD2A 2HT2D 4PYHA 3OKOB 3T2QA 2FIKB 1ZLUH 4DEWA 3S34H 1YQVL 3PWVA 3EDKA 5LGJB 4JPQA 2HB0A 3ARDD 3U6XA 1YMMB 2BRRL 3A3YB 5DUJA 5E1IA 3LMJL 4JS7A 3W82A 5F7UA 3HMWH 2K6ZA 5I1IH 2IDUA 2V33A 4WCYH 3NBNA 2HFEB 3FCUB 4PPTA 4KRPD 1EIBA 1I85C 2JJSC 2X1OA 3Q8FA 2Z7YA 2G4GA 4OV6F 3GEFA 4N3UA 4HD5A 1J8HA 4ZUTA 2EYTA 1CGYA 2NX5A 3CDZA 4RGOL 4AV0A 3WNMA 4NS0A 4OGAD 4F5CE 3VW3L 4KFZC 2WN2A 4KJQD 4LGPB 1HAUA 1KULA 3RPIA 3PIQB 1QO3A 1QFWL 1TCRA 3QFDB 1IC1A 1V54B 3SQBA 2JB5H 2AJYL 2O6DA 3FT3A 4XNQB 3PGFH 5IFJA 4LSTH 2IAMA 2JJSA 5J13C 2H8PB 1ZWIB 2IJ0C 3LZNA 3GJFB 1A65A 3QDJE 2WZPD 3ZHDA 5FYJU 2WTOA 3WBDA 1XR8B 1JFHA 1SJMA 3HC3L 2IIJA 1ZEAL 4ZPVA 2NYYC 1XCQB 1FRGL 1RK0B 4AIOA 4Z7OB 3GJFA 3U48A 3HFML 5HSFA 1B88A 4LBAA 2YPVA 4XI5C 3RL2A 1F4AA 3RZCB 3G6JF 1E4WH 5JXEC 5A2KH 3QC6X 1I9JL 3AGWA 5D70H 1NKRA 3V52H 1G4MA 4XP4L 2Y07L 3ZZQA 2XWCA 3O45A 1NPUA 1G6VK 4N0FA 1CICB 2FJSA 3CFKA 2V7NB 3QDMA 1E8YA 4JFDD 4FQ1L 1PDKA 2N7SA 4OI7A 1JWUA 4MASA 4TUJA 3HE6D 4BKSC 1AKPA 1UWXK 5HHVL 1T2QH 4MJ6B 5A1AA 1P7QA 1XZWA 3ORJA 4QXUH 2BWQA 2DWDA 4N8VG 3D0VA 5HGAA 2O5NA 3BUQA 3QWRD 4LQ1A 2WWNA 4Y9FA 4XPHH 4JKNA 4PWEA 3M07A 4J8RA 3VFSA 3HG2A 1CMOA 3P2TA 3RHWF 2JVUA 4BUGA 2QZQA 4N0CD 2XJLA 1MWAA 4PHXA 5E70A 1PCXA 5DEFA 1QX1A 3VG9C 1WWWX 5E5MB 3E6HA 4EIZC 3GLDA 3PAUA 2APFA 4P2OA 2NSQA 3O6FD 3K6NA 1DBBL 1G7LA 5EWIL 4ZNEE 1MH5B 2ZPKH 3NGBC 5C3IA 5L6YH 1N19A 3FB5A 3T2NH 3L3JB 5LB1A 3F7KA 5CZVL 3GMPA 1KB9J 2F19H 3SQBB 3W57A 3B2VL 4Y8DC 2CPCA 5KVMC 3LDBB 2EDTA 5IEHB 2WNXA 5I2IB 1XL4A 2A6KB 3D85B 4JY6B 1W72H 3TA3D 1KB3A 4QJ3B 3IDNB 3MNZB 3T0EE 5IHUL 4PV1C 3B56A 4ZFZB 5BW7C 1MFDH 4NQVB 3REWA 1J0IA 2WBJC 3MLWH 4GAYB 2IGFH 5KN5B 3P3YA 1JPST 2J8HA 3QZPA 2X2JA 4OT1L 3DBXB 3KMDA 2LLGA 5HYSG 2X4UA 3HAEG 1YMMA 3CZKA 1YPZE 3L1OL 3OZ9L 5HGHB 5JOFA 4KY2A 5GRVK 1Q9OA 4GINA 2AJVH 4XP9L 3ZHKA 3VD5A 5JIMA 2FCBA 2MFNA 5CLTA 3PGCA 1UJTA 3II3A 5IB3B 2RFXB 1UVQA 1ZPUA 4PJFE 5DR5L 4Q6IA 2X4UB 4S1SL 3WSQL 3ARWA 4JDTL 2CIIB 2L7UA 5HVHC 1FFQA 3X11B 2VJ0A 2VWEC 4ATWA 3QDMB 3ZDXE 2VL5A 4PTTA 3U1SH 5FGSA 3BWUF 5AVXB 3F8UB 3AQYA 3HZKA 4R8WL 4UUJA 1KBVA 1L3NA 1IFHL 4X5XB 1ZA3B 3MLVH 3DV4B 4AEHH 1V3LA 4NRXA 3HTLX 4EBQL 1Z5LB 5IVXA 1KFAH 4DP7X 4UZUA 4OD3H 2I9TB 1HZLA 4P5MB 4NIYE 4N0YH 2BNQA 1TU2B 4R4FL 5BOZG 2MJWA 1JV5A 1WITA 2WXNA 3VNZA 3VXUA 4WW2F 5DQJA 1MCDA 4J4PD 3FSZA 3ARGA 3U9UA 4G6KH 4NBXB 3LKPB 3JTSB 3KXFD 3BGAA 2MPAH 3PNWA 3FH7A 1IM3B 4OFYD 5MI0B 1G7QA 1A47A 3CQPA 4MJ4A 3CHSA 3FF8A 2Y36H 3UZQB 2CU9A 4H40A 3U9UB 1I3RB 2YK1L 1B4JL 2RA1A 1AQ8A 1SF5A 4HJSA 1L4IA 4YSSA 2ICWB 4PJDF 1XGTB 3KPOA 5D7JD 4BFRA 3H85A 1BQKA 3QIWC 3EH1A 4X5RA 5IUSA 1E4HA 1USZA 2CM6A 2CLRA 4GIAA 4MNGB 3U82B 1OAUH 4NPKA 4P05A 5EF1A 4JJOA 3I50L 1ES0B 3CHXA 4KZEL 5C70A 3KVPA 4Y2DB 5T1DH 1QFOA 2AP2A 4XVOA 4E9LA 1QQDA 1DBJH 3GHBL 1JPTL 3SHSA 4PS8A 3IGAB 2LU5A 2OMNA 1K8DB 2AJVL 4XP9H 4TTDD 5BV7C 1XR8A 1HOEA 5LCVA 4MD0B 4C4KO 3MMEA 4H1LH 1Z9NA 4S1SH 5HPMB 1L7TL 1G9MC 1T20A 5I19L 2CJTA 4XXWC 5B7EA 2WZPA 5KVFE 1N18A 4J27A 5EO0A 3UP1A 3W2DH 3VXRE 3OJ2C 1NUGA 2O4EA 4MXQC 3ZE2B 4DERA 1WZ1H 3UC0L 1R1CA 3O2DH 4G7YL 3MA9H 4KJYB 2CHDA 4U1GB 1SYVA 4UOQA 5GS0C 3D07A 1SFHA 1LO0H 4J6RL 4PREA 4PRDB 1BFOA 1HU8A 4UQ3A 1WJ3A 3LZFL 4RETB 3RGBA 4NHUA 5ACLA 5B8CC 5FB8B 1F3RB 3PWVB 3EAKA 2R23B 4JPVH 4KQ4L 5IREA 3EDEA 1KN4L 2F68X 1KYOJ 4AGLA 4QUOA 4NCC2 4QDGA 5D2NB 4BM7A 4J12A 1NFKA 2HTLD 1OO2A 3C2AL 3T65B 4AV5A 2ZCLH 5EU6A 1JK8B 2VISA 4G5ZH 5DC2A 1F6AA 3QEQD 2PPAA 2VLJA 1JNHB 2F19L 4WSJA 3VYPA 1S9KC 4BFFA 2EXSA 4F8OA 4UTCA 1P53A 3MXVL 2C1PB 5I0VA 1FC1A 1VADA 4FFZL 1EO8L 4PJBE 1UACH 5C07B 5LBGA 1A6AA 2YPLE 1J5HA 3DGGB 3QQNA 1HINH 3CFNA 2AGJL 1QRKA 2VJ8A 2WXQA 3QUXD 4CVZA 4G42A 3TCTA 3EYVB 4D7PA 3OAYH 4TS6A 4E36A 3HZVA 5AB9A 1P7HL 4G9DB 2XRAL 2R4RH 2Z64C 3QPXH 2ITCB 4YBQD 4PW9A 2E7HA 2QSTA 3D18B 4MQ7B 3DSFH 2MNJB 2W38A 3KWTA 3EFOB 1MIMH 2H32H 4JDTH 2IADB 4UQIM 3I02B 4Z3HA 4M48H 3HN5A 4MMZB 3VACA 2IQ9L 1MRCL 3MV7D 5DR5H 3ARVA 4I4WA 3HE6C 3UTTD 2ZXDA 1JPSH 2DDQH 3N1QC 4NRZA 3OD3A 4TUKL 3BCDA 1IGCL 2A6JA 2FGWH 3OR7A 3QXWA 3V0WL 4XCNA 4ZMVA 1QBMH 2CR0A 4HIXH 3Q2WA 4L9LC 3HLKA 4NM4L 3CIAA 3PRZA 2QADD 5H2BA 5HVFB 1G94A 3UMTA 3P2BA 4B9FA 5ICXB 4MXVF 4OUUA 2YEZB 5BZZA 4PG2C 4C54A 1T4KA 3QR1A 1RULL 3MRGB 3V4PH 3DHUA 1JGIA 2X70B 1DJXA 1FZOA 4DO4A 1YPZF 4LIQL 5C0NC 3HMXH 1CFNB 4HWEL 4UT9L 3LTVA 4YEFA 4HIHB 1F97A 4FYSA 2P8MB 4A6YA 3OPZH 1BM3L 1YEIH 5GQBA 5I6NA 3QZWB 3QJHA 5B1JC 3QEHB 3KYOA 3MX0A 4JO2H 2V2XA 3JSSA 3O2DA 4FQJH 2XZAL 3ES6B 1D6EB 3MFGB 3OM3B 2A9ML 1CURA 1YNKH 3HZYA 4NFDA 1D7FA 3LCYA 5DC9B 4A55A 4X7EC 4FCAA 1RK7A 3HNVH 4ONHA 4L23A 5FUZH 5L7XH 1QWNA 4P3CH 2VDPB 2ATAA 4KJQC 1H8LA 4PSRA 5B38B 4K07A 2QKSA 1UACL 4GG6B 3W0WB 4W9LC 3MJ7B 2LTQB 5DJ2A 4PW4A 3RDJA 3ZTDC 4W9KC 1A7RH 4JDZA 4Y4FB 5D7JA 2MCMA 2WXMA 1GYAA 4HYTB 3MZTA 4NQXA 4O51B 4WCYL 5DQDH 4JFYA 1A6TA 2UZIH 2G75A 3NSYA 1Z32X 5ECGA 1CLOH 3AM8A 4RZKA 4ZW5A 3HAEH 2J72A 3VI3A 2C3VA 4U49A 2VDKL 3U46A 4EVNA 3TN0C 4E9YA 4P2QD 3SDCC 5E6IC 1JK8A 1Q0EA 4K4KA 3QAZB 1E4XH 1M3JA 4HSAC 1RJLA 1KJ3L 2JB5L 3ZO9A 4J39A 2WLIA 1ZT1A 2CLZA 1IGCH 1UB5B 2ADJA 1NIDA 1HH9A 1KXVC 4GG6F 1BSIA 4M7JH 3QJTB 3S6CA 1MJJA 4P48A 3JWNE 1KLUA 1TR7A 4NJAH 3ZE0B 5CJQL 2YUXA 5AOJA 3B7UX 4KQ4H 2EXYD 4R7NB 3VWJB 2NCMA 4KVCH 3D33A 3QG6A 1KN4H 5E5LA 3STZB 5MHSD 1UB5A 4JDZB 4WKZB 1V3MA 1L3WA 3FHAA 4HJGB 4LOEA 4ONGH 1QKZH 4DEPC 3ZZLA 3HR5A 4M7KH 1T22B 3DXAA 3V0JA 1NMBL 4WHDA 1M1SA 1NOFA 2EKJA 3X13B 3MC0A 2WWMC 4Y4HC 1QFPA 1RSFA 3H9SE 3HUJF 3I74A 1DJZA 1EZSA 3U30B 3BUYB 1NDMB 4Z7VE 4JQVA 3BGFB 5LWYL 2ICWI 2XWRA 3LKOA 4ZXBD 3QEUB 1H5BB 4GT0A 1CJYA 4NENB 3WS3B 2BP0B 2FLBT 3WUWA 5L7XL 1AQHA 2HCZX 2EE6A 4NO0A 5AG8A 3FCGA 1U3HA 5B7FA 2AK4D 1VLXA 1ORSB 1EFXB 4Q6YA 1LTXA 2GSMB 4WUUE 1T04B 2VXTH 2ADGB 5J1TC 4RNRB 1IC4L 1HHGA 3MI6A 4ELMA 1D7BA 3JWNH 1SHMA 3RGVD 5D1QB 4YBLB 2YAEA 1MFCL 2EC9T 5DS8A 2P5WA 4A68A 1AQDA 4H25A 4WI5A 2AXFA 2BSTA 1SDYA 2ZXCA 1C5DB 3KHOA 4YLBA 5I0XA 4JVWA 4MD4A 1QBML 2W95A 3SKJL 1YNTF 4B9JA 2X4QB 3VGAC 4B9PA 3EYVA 1S6NA 5CEZD 5ESAA 5I6KA 2AK4A 2F15A 1Q9WA 2NXYC 5E6YA 5L4IA 2AXFB 5CZKA 4Q9QH 1E8XA 1KCRL 2XTLA 3FMGH 4NKMB 3L4WA 2VDQL 2WZ6A 1LQSR 2Y72A 4Q56A 4A2MA 4KK8D 3L5XL 3FB6B 4LLVB 3MLWL 3GBEA 1TQUA 1U8LA 3A24A 5ICYA 4YNYB 3CVDA 2JQAA 4XCEA 1GZQB 1T6VN 2DQTL 1CL7L 4LLYA 4NPYB 4DVRL 3BH9B 4YZWA 4LFHG 3ZGIA 5T33L 3OGCB 1R5IB 1Q8MA 3GHEH 4PJIB 4CDGC 1DBMH 2WPGA 4FQJL 1R3HB 1BVZA 3B9EA 3O6MH 9PCYA 3H4HA 2X4SB 4XGZB 4FQIH 5I6OA 2HPTA 2JCCB 4OKDA 2BY3A 1MDTA 3X17A 3VFRB 3MRMA 3M7OA 5D96C 3RU8H 2JTDA 2ZUQC 2N59A 1EHLL 2H7WA 3GXFA 1YEFL 3S4SA 1R9FA 3PFUA 2WNGA 4PJ8B 5CGYC 2J3SA 1T1YA 2WVUA 3DDGA 3T8XA 3S5ZA 3IAQA 5AW7B 3QWNA 3WFZA 4U1HA 3ZKMD 2G5BA 3PV6A 2VSDA 4M3HA 3SYAA 2WWMD 3RVTC 1INQB 4JFOB 2MOQA 2OR9L 4N8VA 5ACZA 1KXTB 5EBGA 1D9KB 1N5YH 2G30A 1DO5A 3FU8A 5IQ9B 4ZUSB 1W72L 4DP8X 3VTAA 1MG2C 1QFWI 4PRHD 5FWQA 2O5ZL 3N85L 5C0BB 3MV9B 2IFFH 4AC2A 2F8OA 5HY9A 1I9IL 2Q3AA 2DQJL 3HRZA 3K8KA 3LS4H 4XVUC 1U8KA 3WY2A 3LS5H 4A7SA 1PZDA 3L2LA 5I1HL 1J9RA 4C59B 2IDFA 4Y5VB 1RUAH 4J1UB 3GXDA 5CHNB 2O30A 3NT0A 4L8SA 3RX7A 1JV2A 3FH5A 2BIMA 3INUH 1ROWA 2IPKA 1IKOP 5ICXA 4YPGB 3SDYH 4XBPB 5D4HA 4K8RD 4ZFGL 2FQEA 3A6CH 4RGNE 2VQUA 3CN2A 3R7QA 4F20A 1MPAH 1T1WB 4JREC 4M7KL 1KEGL 3FU0A 3OKEB 3RZWA 4TQPA 5CD3B 1P6AB 1MLCA 4JDEB 2E5EA 2PWEA 2PXYC 3DX0A 3KLAB 1KXVA 3BGMB 3OLIA 2JKRM 5FFOA 3WDJA 2IPUG 2F1AA 3OAZH 4FL4C 1FL3B 4YC2B 1KLGB 5MI0C 4KTYA 1J0KA 5E9DB 4L4TB 3VDBA 1UXWB 1AD9A 3BVDB 3ZU8A 2EAEA 4XOCA 2ZYSA 3MX0B 5F9JB 3BE1L 5A16B 1D5ZA 4EIUA 1K4DA 3CHOA 1E3FA 3EJTA 4MX7B 1N70A 1HJBC 5HYJB 4DHLA 4E68A 3ESOA 4ETQA 2GAZA 1HCYA 1GZHA 4OLVH 1WBYB 5HHMD 4L3AA 2M2DA 4O58L 3Q9PA 3BPOC 1QRNB 3N04A 4N2BA 2V5TA 5DMIL 3STLB 1A7QH 5JMRA 1TZHB 2JF1A 1T0MA 4OIAA 4WWKD 4FADA 3BKML 4X6CE 4PRNA 3QPQC 3N06B 3EW3B 3IBOA 1GYWA 2QL1A 3UZVA 3PE9A 1K4CB 4PJ5A 4P04A 3UCQA 4FJZA 4XMZA 3BPNC 1CT8A 5C0GA 1OSEA 5FFGA 3ARZA 4KJPC 2BP8A 5CBEB 4UINH 1HZHL 4L8DB 1ZJBA 3TWCL 3L3KA 3VCLB 3I50H 3QJFB 4EZLA 5I1EH 3FO1A 2RIKA 1IAOA 1CT8B 2MQCA 1BBJA 4K8RC 5JOFB 5AVRB 2OYLA 4PG9B 1HINL 2AKRB 3A4AA 3GTTA 4I1RA 1MJJB 3PV7A 4BIKA 3NRPA 1F6LL 1AGDA 1B0WA 1AO7D 1HSBA 4XNXL 1Q1JL 2ITDB 3CLWA 5IMLB 3MRBB 4D0BB 4F1ZA 2YBRA 1U58A 3I6KA 1TJGL 3LRSA 5I1GL 4NN7C 2Q7AA 1I7RA 5C97A 2E47A 2VERN 3HG1E 3Q3GB 2A73A 1THCA 1TTRA 4K7PL 2BZDA 2CIKA 2QGCA 3BEVB 2BVYA 1ID2A 3QJQB 4ZFFB 3TO2B 1EHLH 1BZEA 2BIIA 5BZXA 3O2DL 4O02H 5AYTA 3ZY7A 1T0NB 3HC2A 3FU3A 1F2QA 4RDQF 4PUBL 5J06A 2IANB 1HNGA 1WQVT 4BJLA 1PYWB 1SEQL 4DKEH 3WIHA 3TBVA 2RR3A 1GIGH 4DVBA 4XO9A 1TDQA 1VAHA 5EMYA 1JDCA 1OWWA 2VXQA 3L48A 4MDJB 4RGOH 5FDWB 3O3AA 2YRLA 5DJYB 5EFIA 4NWUH 2XZCH 3G6DH 2IAAC 3HBZA 5KBDA 1QLEL 1AI1L 5TDPB 2DD8L 2Z8VC 4AEIH 4PJGF 1A6ZA 1RPQA 1ROCA 4LSTL 3NIDF 3QJOA 4Y16B 3VGBA 4APQC 4LF3A 3KGTA 5CIPH 4LOVA 3O4LE 1S7SB 1I9IH 2Z4QA 4KI5C 1JWUB 3MRHB 2J88L 3IJHA 4JHAH 2B15A 2K4AA 3Q5YA 4FFVD 4BKLA 3BPLC 4MJIB 5C8JB 3OSVA 5EC1B 1ND0B 4UIMB 4L2YA 2ZAGA 1BXUA 3ROOB 1LMIA 1VKXB 1KXQA 1FL5B 3Q1SL 1FRGH 2AZUA 3FB7B 3INUL 3I9PA 2F58H 3GBDA 3PWJA 3O9WD 4U1MB 1VGKB 4Y1AB 5F9JA 1N5AB 4E9SA 1BAWA 3MUJA 3LVTA 2XFGB 4F8QA 3DX7A 1U92B 3JWOH 4E41B 3MUZ1 3FOMB 2V37A 1NGWB 3BEWA 3LB6D 4UM8B 2I5YL 2O5YH 4XMLL 2HJLA 2MKLC 5C92A 3IB4A 4NYLA 4Y5VC 4NAMA 3QC5X 1Y0LA 1ZK5A 2ATKA 5F89A 1TETL 1FVCA 3PUCA 3FXIC 3HN3A 4CGTA 1CLOL 5IMKA 3GK8H 3LD8B 5PCYA 2FATL 1CD1A 1Z0NA 3CSBA 4NC1C 2E8YA 4QCIB 5FO8A 2W0PA 3MRJB 3MHZA 4RAUA 1TCRB 1CI5A 4RFEB 3OXRA 3BN9C 4IHOA 1OPGL 4CA4A 4LSDA 3P3TA 4X8JB 4J6IA 4FFTA 2WTRA 2E9GA 1KV7A 4LLDA 5BXFA 2NNAB 2PCYA 1AYOA 5I66A 4P23B 4LKXB 1AZVA 3CUPB 1O7DC 4X6CF 5IIEB 1VFAB 2IGLA 1MNUH 3B9DA 2RQ8A 1U36A 4WU5B 3DHPA 1NC2B 5GGRB 1WF5A 3MFFB 2VXQL 1GKOA 3EH5B 2HVKA 2W9DH 3QNXA 5H35B 4CSTA 3CFEB 1QSEA 2GTWA 4J3OG 2X6AA 3CH1A 1INQA 1QPXA 4N8VB 4UB0H 4KGLA 3ZVVA 4OZIF 2CO7A 2A77H 1NMBH 3JTTB 3V4PB 4HWNA 2OMUB 3ARPA 2WBJD 4IOSA 5AVYB 5EEXA 2WXRA 5D7IA 1HXYB 1N0XL 2A73B 1V27A 4IBTA 5JW4M 1MFDL 1U8HA 4XBMA 3VWKC 3QXTA 1OVZA 2RALA 1R5VB 2IGFL 5LDUA 5D1QE 4WNQB 2F61A 4R9HA 1YUKB 4M1CC 4EZMA 1FAIL 2IGTA 1U2HA 2NNAA 3GPSA 4JHZA 1SJHA 4WVRA 1S8DB 3MODL 5KSVB 1KB5A 5ELIA 4WFED 4KU1A 1NL0L 1MG3C 5C3TA 4DO5A 3LV3A 3VTMA 1T5KA 5GGVY 5HDRA 3RNKB 3RJQB 2P8PB 1IC4H 1TLMA 3CVHB 4HJ1A 1K5WA 5FECA 2X2UA 2NUTA 3FS9A 3FQ2A 4MWFA 3HS0A 4XE5B 3N40P 1PKQE 3N44F 4O02L 5BMFH 5I1KL 2EE2A 1MWAB 3UYOD 4G70B 2HRHA 3VSTA 3TIEA 2L7EA 4BSWB 4RAVB 2AKRA 1JVKA 1U3NA 4WWNA 4XNAA 3BKCH 3DMMA 1PLGL 3HRZC 2KUTA 4M03A 3B8YA 1FH2A 4YSPA 3SCMA 3VFVA 1AD9B 5EORL 3KPLB 3N2JA 2XVBA 1II4E 4P23A 4E9VA 5TTRA 4B0MM 1YJDH 4JEGB 4UNIA 3GBML 4FQQA 2R83A 2XIDA 3P9WB 3V5DA 3GZKA 4NUQA 3BHBA 4HSQA 3VM7A 2Q2EB 3ULSB 2BY2A 4AEIL 3N44B 4XNYL 5F88A 3IDIB 2N0MA 2QPEB 2Y2TA 3BMVA 4JLRA 4ELKA 4X4XA 3QUKB 4FI8A 4ZOAA 5EC2A 1QWUA 4U1NA 1TZGH 4MKMA 2WBJA 3RRQA 3Q6GH 4X7TB 4L8SC 5C0IA 1MCEA 3CFKB 3C2SA 4LEEA 4BFOA 1SBSL 1ETA1 5D7IB 1IAIM 1CFTB 3R1GH 1C5BL 4I85A 4GKNA 1URIA 2ATPB 3HKZA 1SLWA 5GGSB 1K3ZA 4JZJA 4FLRA 1OTTD 2VC2B 4HKJB 3COOA 1I7ZA 3LH8A 5DJCB 3UERA 3FT2A 5LLIC 1OF0A 4HH9A 5IG7B 3FONA 3M88A 5J6HB 2F58L 4NC2B 3GINA 4XC1L 3U7AA 4RRPM 1JOIA 2PWGA 2LABA 4RDQG 3I84A 3IFNH 2I5YH 1I9RH 3PJNA 3NVQA 3DHMA 3TFKD 1AAJA 4Y4KC 1U8MA 3T6QC 3FUJA 3TNNA 3CHPA 1R3KA 4AITA 3FONB 4AW7A 2ZWZA 4NQDA 3PHOB 3FZUD 5I8OL 3V5KA 3WMQA 2F54D 2OSLA 5DHXB 4M93B 1WCBA 2E6QA 2AITA 3RVUD 3GIZL 5JA9A 1VENA 3KG5A 2F5BH 1WZ1L 2IBZY 1FFNB 2YPKA 1KPUB 5JDJA 3GUFA 2D7OA 3JTSA 3ELAT 4BYHA 3HPJA 2DQJH 2F53E 4QLWA 1MFEH 2LFEA 1EMTH 1OQXA 1BFSA 1D5XB 1W0YT 1GJWA 3AW5A 4QRPA 3ZLQC 2ALWA 2DQIL 2EYSB 4AYEC 4K5OA 4U4IA 5F7FA 3H7BB 2CGZA 1QTSA 4GBXD 4HP5A 4ZO9A 2WQUA 2AJUH 5CP3H 1O9VA 2YMXH 4IHBA 2O61A 1UASA 3DYOA 5I17B 4NC0B 2W1NA 4FLQA 4X5LA 5IB4A 3V6FB 4HLJA 4MJIE 3AJ7A 2FO4A 4KRLB 1XT5A 3ZJAA 5FOBA 5DC0A 3MV7A 3ZPDA 3ULUH 2VW7A 4MA3B 5CN3A 3MU3A 4Y5XB 5DJ6B 3HS0B 4L3ED 4AL8H 1KG0B 4FFZH 3L81A 5J6SA 3ARFD 4M6NH 5EU5B 5F3BA 1K5NA 1WD8A 4F37F 35C8H 3QXAA 2PYFB 2ARJB 1TTUA 5AD0B 3Q5OA 1MIML 1PTZA 5IT2L 2LAAA 1JGUH 2XRAH 2XV6B 4P9MH 5GRJL 5LCVH 4CMHB 4Z7NE 4MZ3A 4EDXB 1Y6NR 4YO0B 5EN2B 4DP2X 1EAJA 4NIKB 1CB4A 1TQSA 3F85A 4YFLF 2AJYH 1PCSA 3VFMA 1D5RA 1MRCH 4ZYKA 5GPRA 3V6OE 1PYWA 3QEQA 5BMFL 2H1PL 4FXKB 3AMKA 3WO3B 5EBWB 3ZKSD 4BWWA 5FO7B 4HULB 1YMHB 4M61A 5C0CA 4R0LB 5CSZB 1T2JA 4YX2H 1SDAB 2GC4C 1XF3B 2IBZX 3S96A 4G72B 5IJKA 3D06A 4LLQB 5HYQB 2YAFA 2EDRA 2EABA 4HXAH 4I5BA 4O2EA 3T3MB 5C7XL 2O6EA 5FO7A 2R2BB 1OM3L 4N2EA 3BZFB 4WEEA 4Y19D 5C2UB 1EUTA 1E4WL 4JFEE 3AM8C 4E42A 2FJFB 1TYRA 4KKNA 2V9TA 3QUYC 4X7DC 4JFTA 5IW3A 5ILTL 3O8XB 3PDDA 4NOBA 3KWVA 2APVA 2KPWA 3P54A 1JNLH 4N2GA 1WS7A 4HUUA 4ZDHA 5JQ6H 3NCYP 3P77A 1ZT7A 4KPHL 4IRJC 1DVQA 1HH9B 4XNUH 4N6RA 3N41F 3ZT7A 1UA6L 1QG3A 4D7BA 3UO8B 3K5RA 3S2CA 3EYOA 3IGUA 3SN6N 2YEQA 2OK0H 1NJ9B 4PBDA 3P73B 2E27H 2WANA 4JY5H 2Q7NA 4IDJH 5DDHA 4B0MB 1A7RL 5HGGS 3GT6A 3U79A 5E6UB 5DD0L 2FGZA 4Q4IA 4OIIH 2ADFL 3EJJX 1JXKA 3QCTL 3MGAA 3SDCA 4D0CA 5JDSA 3BIKA 3DROB 1G9ML 1S9WB 4H4NA 4YFDB 4ZAKD 1NBQA 4PP1C 3WAJA 5GRJH 3SKMB 1HH6A 1Y6KR 4G6JH 4W9HC 5FYLE 4X6DA 5C0FB 5D72L 1QLEH 2P5EE 1JCVA 1AXTL 3KEHA 1DFXA 4DGYH 4F2ME 5CGMA 1PSKL 1RUPL 2HYMA 4PG2A 5EZIL 1G0DA 4W9EC 3BIAX 2PW2B 1XWVA 2H1PH 3GXMA 4KO5A 4L4VB 2H3NA 3C12A 1X5JA 1NWPA 4FXGC 4C47A 5AAWA 1T5XB 2Y1YA 1KCUH 2WAQA 3CDFA 4GBXC 5I8KL 3BSZL 2VDOH 1GGCH 2G3NA 1JZ2A 5J7CC 1WBXB 3TVMD 3UOAB 5LUMA 1XGUA 2G2PA 3NP3A 4X8XA 3SSGA 4QRQA 4TYUA 1TJGH 1BPVA 1OSZB 5EF2A 4NGHL 2AJUL 1GCFA 2E7MA 3ZX1A 2AQRA 4JKMA 3KS0H 3S36L 5DMYA 1BHGA 2AC0A 1F42A 3DOSA 3L16A 3DHJA 1BAFL 4XN1A 4W9CC 4HAGA 1UB6A 4L1SA 4LBEA 3GWJA 5LVEA 5FGRA 2OSYA 3QCUH 4WO0A 4ZSOE 3I9GH 2APXA 4ACTA 1X5IA 2F74B 4PJGE 4FHKA 2F8VA 1TJIL 2ZAIA 4UU9A 4LNRA 1QSFB 2ZCKL 2ZUXA 2H2SC 2QDVA 2ICEC 4PLJC 2BNRB 4YVNA 3RDTA 5DCCA 4BQBA 3NYKA 5BRQA 1QSVA 3TCXA 2P7TB 4IDJL 4QHPA 1CVSC 1D6EA 1JGUL 4PD4J 4DUXA 3US1A 5GZNC 4AH2A 4XN5A 3S3DB 3LEYL 4OAWA 4O02B 1Q72H 4Q9RL 4KKCC 1X5HA 4CJ1A 4FULA 1O6VA 1HQ4A 3MRNA 3MRLB 4C4KT 2XG5B 3FTSA 1QASA 3KBEA 1QUPA 2KT6A 4XXDA 1ZJAA 3TOPA 1IGTA 4OJFL 1RZ8A 3NJIA 4GKZB 3TTSA 2WOYA 1T2XA 1FO0L 4BFEA 3MLPA 2X9YA 4ZMLA 4DGYL 2KS0A 2WWKO 3RE0A 2N56A 2WINB 2K8QA 2Z7ZA 5I26A 1KCRH 4QJ4B 2UVEA 4RBPK 4Z7AA 5AAPA 2D7PA 3I9AA 3D0AA 3WHE0 2WZ5A 4QHMB 1PZ2A 2XCMC 2ZNWA 1K8IB 5E6RB 3B2MA 5F1OB 1MCJA 2GY5A 3KLKA 4HDIA 4FXKA 4U1IA 2IPUK 3RB7A 2MIZA 2WWOA 2VUYA 2X2HA 4A38A 1RVFH 5FHAL 5C9JB 2NY7H 4LCWD 1M05A 3PHAA 3QR2A 4WSKA 3LX9A 3B2XA 2EKSB 5TQ2H 3U46B 2XPGB 1P9MA 2R1YB 1S9VA 1HHJA 3UIYA 1B90A 2YQ3A 2VC2L 4GT7A 5IB4B 5KSUB 4C55A 3ALXA 3OJDB 3UPCA 5EUOB 5AG9A 3C6LD 1T83C 2FBJH 2VLKB 3WDHA 1ZLDA 3EF7A 3ZL4H 1CTOA 2CJUH 4YPGA 4FNUA 2OXGA 3UJJL 2D0FA 4LOFA 3QFJA 1C08B 2HG0A 3V9EA 1BLNA 3EYFA 1CLYL 3WIIH 4JPWL 1SM3L 4MJHA 3KLDA 4PWHA 2GKIA 3CZEA 4NBZB 5E9DE 3B37A 1MH5A 4MA8H 4CNIB 2XICA 4N2NA 4NN7B 3IE9A 3D9AL 3L3JA 4UQBA 4ODTL 5E4EC 4CDHA 2APTA 1OE2A 5T3ZD 1L0XA 1ET5A 4PV9B 4I0CC 3U2JA 4E5XB 4Y5YA 2KERA 3CU7A 4W9JC 4AQEB 2GCYB 1FL5A 3WL9A 3REVA 1LD9B 2LV4A 4L37A 4LL9A 1FO0H 4EZKA 3G04A 1CF8L 3MLTA 4UDTA 1U8CB 1JPFB 3K6IA 3T4AC 5ANME 1QPPA 2NY0D 1KBPA 4ZFGH 2E7CA 3QIUC 5CMAA 5D4QA 1UHVA 4H8VA 3CFTA 3ECWA 4LVHB 4KXCA 1ETB1 3MBEA 3SPJA 3UAJD 3EGXA 5BVJA 3OTTA 2R0LH 3IJ8A 1FFPB 2YGQA 4ZUUB 3A6CL 3QXUA 1JG9A 3FPXA 1V7NL 2ORBH 2IFGA 3ME0A 1MW1A 4QRPE 4TUKH 3S34L 2ENPA 1YEWA 2KL6A 1G87A 3PWNB 4KKLD 1PZ5A 3KWUA 1HIMH 1HXMA 1MHPL 1TO5A 3U0PB 5BVJB 3GD1C 1P1ZA 5HHVH 4Z7QE 4E0RA 3TYFA 4K71C 3O8XA 4UYQA 3K2IA 2EEFA 3ML9A 1YQ2A 2FL5B 1PJ9A 4FQ1H 5TQ2L 5HYSB 5CZXC 1LJMA 4G8GD 4QRRA 1TNNA 4RMUA 4WJ5A 4I2XB 4M5TA 2OULB 4NO3A 4P2QA 3MNVB 4PRIB 5ACMA 1EQWA 1F02I 3U6RA 3WE6B 1CFNA 4ZPVB 3TBSA 4AQZA 4XVJL 4I1PA 4I0PB 1J1XH 1FG2A 3HMXL 4R4BA 2BY1A 2Q76A 1RMFL 3NJHA 1WC7A 3WJMB 1OK8A 2CJUL 1U58B 3P4NA 3KDMB 5FUCC 1QWHA 4K0OA 1CDYA 3L7FB 3DMMD 1AY1L 4N87A 2EUZA 3UACA 5DMIH 3RZCC 2H6PA 3S96B 4JPSA 3DJRA 4FKKA 4NO2B 4X80L 5GISL 3ZUCA 1J8HB 3R8QA 5IHWA 1ZIBA 2DQMA 1REIA 1T6BX 2YA2A 5D7LB 1FQ9C 1I1AB 2HUHA 4HEPA 3R1GL 5FUZL 3OR7B 5GZOA 3E8UH 1AGFB 3NZHH 2F08A 4N0UE 1INDH 1ERNA 5D5MF 1L9NA 1AQDB 3L3DB 1SGKA 2WC7A 4O02A 2NPLX 1EEYA 2VH5H 4G3YH 1JE6A 3IETB 1FFRA 2D9CA 2AEQL 5EZLB 2G0KA 2YUZA 3GGWA 3VRIA 5BRPA 3OXSA 2R1XA 4DT2A 4EQ2A 5I76B 4OGXL 2FX7L 3KPRB 3VXUD 3HUJE 4J3OF 2OZ4A 3ZE1E 3BKYL 1PBYA 1WP6A 4LGSB 3FB5B 4FQ2H 5HXMA 1A9EA 3K4ZA 2C1PA 2VC2H 3LRSB 2R1XB 1R17A 3WSQH 3ZYIA 4HU2A 2XG4A 3U1SL 1B2YA 1YZZA 3KPRA 3U0TA 5BRZB 5HI4C 3QI9C 4MMXA 4A2LA 2NY1D 2W9EH 1ZHLB 4I89A 1JZ6A 2IVFC 2ISDA 4LOUD 2UZPA 3KGRA 3WO4C 1KEML 2JTYA 2E4TA 3UH8A 4FD0A 1FH5H 1BF8A 1RJYA 2CLVB 3NCJH 4YSTA 2EVHA 1BVNT 3U2IA 3UJTH 2Q9OA 3VXSA 4TUJB 1GIGL 1ILUA 4GFXA 3NH7L 1IAKA 1I1FB 3KPOB 4XVJH 5IOPB 3MREB 1ZS2A 4G8IB 5IB5B 3QA3B 1WHOA 1WZLA 5SWSB 1PX4A 2UXGA 5AKSA 4PGDB 3ZE2F 5KSVA 5ICUA 4BFJA 4DZBB 3G5XA 5J4MA 4P57A 2YSSA 1FNHA 4KITB 1CBVH 1XBRA 3EGSA 4CC0A 2YPKB 4CKQA 3QNFA 4ODWA 1QACA 2WXLA 1NAKL 4M7ZC 3WG7B 1AGEA 2DQGL 2P24B 3P3RA 4F1SA 2XACC 4MAYB 3MV7E 4OD2A 3JQOB 1U3HB 2Q87A 4RFOH 3WFEL 4YSRA 4YXHH 4OZHA 4JHUA 4PJFF 2ERJC 3KYKL 4NDMB 2BXYA 3VO0A 1HHIB 5J1AB 1G7MB 1A6TB 2XN9D 1D5ZB 5FM5M 4KZCA 3SYPA 4AUJA 4BE5A 5JQIB 1SYSB 3QDAA 4G7RB 2C34A 1BGXH 1TQBC 4JX0A 4LCVA 5F2FA 3HPLB 2P5EB 1CD9B 2DQ6A 3HZMB 1HYSC 3OMNB 3QIBA 2D0GA 3F00A 5IJCC 4K23H 2JJTC 1JPTH 4EI6B 1F4HA 1TETH 4NFBA 3A22A 4JFUA 2JI3A 1G9MH 3TBTA 3CFCL 4NN6B 3GK8L 3UYRL 2WQXA 2FATH 4OCSH 3IRPX 2EDJA 2AJXL 4YUEL 3K71A 2WQWA 2XLLA 4JLRB 4ELKB 4PJFB 1Z9OA 3VFOB 1A4JB 2QVTA 4YDIH 5DZNA 4AWJC 3Q05A 4ZUVB 1BBDH 5ESQB 4Y4KD 3BPLB 3EJSA 3LZFH 4R4FH 1Z1WA 2CHWA 1X9RA 5B7MA 2XTSA 3KPSA 2HPOA 2B9BA 3LRHA 1DLHB 1KTLB 3ISWA 3VB8A 5I5RA 4M5YL 5I0YA 5B1AB 2FECL 2A6IB 4U6HA 1M2OA 2W0FA 5F1IA 5DMKA 3DOHA 5EUKB 2JQZA 2ZXEB 4ODXB 5EEZA 1PKQB 1Z5LA 2H0PA 4LCIH 1IGIL 5DI8A 3X12B 3L9YA 1J86A 1DSYA 4Y2DC 5AW1B 4ZQTA 3NOIA 1M7IB 3OF6D 3PPEA 2A77L 2LR4A 4HJ0D 3ILEA 1C16A 2ZWLT 4KX7A 4ZMPA 1YMHA 4M61B 4TNWF 3T4AB 2F7PA 3PQYB 2M26A 2A7BA 3US0A 1BAFH 1ZLUK 2WVVA 5JHDD 1F6FB 2BS8A 4GJTB 3SCMD 1AZZC 3O6LL 8FABB 1ZHBA 3IFPB 4O4YH 3LKSB 3I9GL 4AV4A 3CPUA 1EO8H 3DO7B 4KRPC 5IFAH 2XWDA 3FAWA 1F1GA 1IC5H 2OI9B 2ZX8A 4LIQE 4RISH 3ZHFA 4Z18A 7PAZA 3WNPA 1GGUA 3KYKH 4LRIC 2XXMB 4ZW3A 2AEQH 3GS7A 4KQ3L 4YK4C 3MLZL 5EZOL 1FN4A 2VQ4A 4FMFA 2R1YA 4X50A 3VW3H 2WQRA 5E8DH 3IDJA 1TTCA 4BFIB 1I8AA 1V55B 2RTTA 3KJ4C 3OHMB 4MS6A 2FB4H 4R3SB 5BVPH 1Q9KA 2FGWL 3OG6B 4HKBB 2HJFA 3KEDA 1F13A 3BLBA 5F1NA 4HIXL 4N8UA 2YUWA 3CBKB 3EXJA 1LO0L 5K9QI 3PJSA 4TVPE 2NY4B 1OY3B 4L0PB 5H37H 3SDAC 3V0WH 4ICXA 1U8OA 1UATA 1U8LB 3BDXA 3FUKA 4JRXD 4OV5A 2ZT9C 1A4KA 1LEGA 3V4VA 5B38G 2FE0A 3MGTA 4PRAB 1NIFA 1HHHA 3Q01A 4KROB 2CK0L 4QO1B 1MJUH 2GBUA 1ASPA 1NGXA 1LO2L 2VR3A 1N8OE 4FYQA 3HUJA 4N25A 3UG4A 1QLEB 3BSHA 4GKSA 2UWEF 2CCWA 2IOIA 1MPAL 3FU9A 4LHUD 4OCYL 1IM9D 4PJBF 5FB8A 1EJOL 4K5LA 3C60B 2NY3D 2LAGB 4AGMA 4OZFG 1NLBL 2AEOA 3MXVH 4K3JL 4XNYH 1HNFA 1NAKH 5B39B 5HHNB 2NNFA 3HR6A 1TZGL 4KDWA 1RVFL 1FVCB 4IGBD 1IB5A 4UIKL 3UX9B 2G9KA 1O5PA 4JO2L 2AGJH 3G7TA 3HW7A 3T0EA 1CGVA 4WHTA 2Q6WB 2XWBA 4Y19E 4H1LA 5KVGE 1YNKL 1ITBB 3EOTL 2R4RL 3QPXL 3JWDC 1FFPA 4YC2C 5JNYB 1H5BA 1EAQA 1QUNB 3US9A 4PWJA 4OZ4A 1QSEB 2GTWB 4O4YL 1XD0A 5SX5H 3WS3A 4H8UA 1DHKA 4W81A 2XIIA 4ZK8A 1AFVL 3WY4A 4U6YA 2RJMA 5C07E 4PI0A 1E27B 1M1XA 4M4PA 3T0DA 4Q97A 4N28A 2AQQA 5B21A 5BO0D 1VKXA 1CD8A 4LASH 3MJ8A 4MAYA 1TQTA 3QUYD 4R96B 5E5RB 5FLUA 1UH3A 1I3UA 5CZVH 3GMOB 2E75C 3MRFB 4IEFB 2DWTA 4YHNB 1YN7A 4F7CB 4OF6A 1IBBA 4FG4A 4K94C 1E4XL 3N40F 1KJ3H 1IIKA 5AVTB 1N10A 2FB4L 3EYUH 4ES9A 2H6UA 1BMWA 3L17A 1MKFA 2QVMA 3ALPA 3GSUB 3NJLA 5T1LD 5F8RC 5I1AB 3LB6C 1E42A 1RULH 4N1HB 4L8SB 3BCFA 5F7EL 4I87A 1OP3K 3W1ZA 1XR9A 4I88A 1ET7A 1Y0LB 3PJLA 4KKRA 1Q94B 1MFVA 4I3SL 5EIIG 3FUEA 4M6ML 3WJJC 2ALAA 5HGBB 5ETUA 1JZFA 1OAXH 2DQIH 3NSDA 4YHKL 1VFOA 5CLYA 2W07B 4G6FB 4NQCA 3SBRA 1ACZA 5JYMA 4NX0A 3D3VE 4FQCH 1G1KA 4R97B 2GPZA 1JYNA 5DUPH 2K8MA 4GRWF 1M7DA 4ONGL 2XUWA 4HX1A 2XV0A 5ANMA 1IUZA 4EIBA 2C3VB 1S9WA 1LGVA 2XETA 3V0EA 3HCVA 4ADIA 3MV8E 2FJHA 1TVBA 3WV0A 1X6LA 2FLRT 5FM5O 5IMMA 4Z7UB 5LWYH 5GRVL 3CXDL 4ZXBC 5EIIB 4NZFA 4APXB 5I18H 1KTBA 4IBWA 1I75A 1NWOA 1U8IB 1EVTC 2AJZB 4IU3B 3BT2L 1ZVHA 3BQUC 2VDML 4DPCX 5E95B 2P43B 3H6AA 3GSOA 2YSTA 3V2AR 5KTEL 4JRYD 4FEMA 2O93L 4ONHB 3NA9H 5JOPD 5INDB 1D5BB 2XBTA 3NQIA 4GRWB 4I9XA 2NNCA 4AC4A 4TNGA 1AFVH 4WO4D 1CFMA 5T8IA 2EVIA 4YDJA 5FW6A 1M7XA 4GG6E 1ZHBB 1SFDA 4R5TA 2YO3A 5KYUA 3SKJH 3B4NA 3Q8BA 4AM0B 1CWVA 3CFBB 1WD9A 1XZ0A 1G6RA 4Y0GA 3N91A 4K2UH 1A0QH 2E4FA 4B7IA 3HG1B 5CILL 2VXSH 2OL3A 5DK2A 1NDTA 3DRQA 1OL0A 3QULA 4YAQB 4M56A 3B9AA 3NMEA 4HOXA 5ADPH 5K59E 1G6RB 3FMGL 4HT1L 5CFAA 2Q10A 2GJ6E 5T1DL 3NDYE 1OAQL 1UH4A 4FNLH 3ZKQD 4WIQA 5C0RL 5JW5B 2UYLA 5IV2B 2ZXAA 5E4OA 1I1YA 1DBML 4RESB 1H0DB 2DI7A 2WXOA 3QJXA 4Z78B 4AM0A 1P7QB 2D3LA 4JM2B 5IK3A 3MROA 1RZJC 3MLUL 4WHCA 4D9RE 2BS71 5T5FA 4FFZA 4XNUL 1FLRL 4PJ5D 3S5YA 3WEMA 8PAZA 2Z93A 4HJ0C 3HNTL 4M4RA 4JQXA 1UXSB 2R0WH 3FQ1A 2W0KA 2DKMA 1CS6A 3D50A 1UA6H 1YPZB 4A2EA 3PXHA 2X1PA 2PO6D 3VTTA 5CMAB 1C7TA 3T4YA 2NOYA 2DICA 2Q86B 4YXLL 4MD0A 4LASL 5I8CA 1FH5L 4JFQA 4Y1AA 3CFDA 1NGPH 4HEPG 2EC8A 4JAMA 3CH1B 3UJTL 3FJTA 3UAEA 3TWYA 1JN6B 4WI3A 4Z0XA 4JRFA 5E8EB 1NBYA 3GSWA 1ORSA 2YARA 1LQBC 5TDNA 3VUAA 4AY0A 5L8LB 4WUUB 4WGKA 4G6JL 3BN3B 4OGZA 5D7SL 1RUPH 2IDCA 1H8SA 3KCPB 3OAWA 3SEPA 2H45A 3RILA 2X4NB 1AO7E 2PYEB 4XWGH 3FCSB 4PJHB 1KTKE 5DYOB 2QELA 4X4ZA 1INDL 3VE0A 4PBWD 1XDTT 3OHXB 1HX0A 1OAXL 2OS7A 3MRJA 4JKPH 1P4IH 4L4VA 5IHZA 3AU1A 3QVAA 3O6KL 1EDYA 1RJZB 3L7EB 1BF2A 1WHPA 4QXTB 1KPVB 1YN7B 4EI5D 4F7CA 3ULVH 4YHKH 1FFNA 1N4XL 3TEWA 1NL0H 2UVFA 3BO8A 3A0OA 2ZKHL 1GZPB 2A83A 3QRGH 4XVUD 1DANT 1K8DA 1Q0XL 4NGHH 3UBHA 3ZTJG 3MSPA 4DCQB 3S36H 3T0WA 1UOWA 1EGJA 3S3BB 3CSYA 4HUXB 2PYEA 4AQOA 3IPBA 1SLVA 5A40E 3CFCH 1T21A 2X41A 5F6IC 4BUHA 1KEMH 3IN2A 2AJXH 4YUEH 5ABZA 3CVHL 3S4SG 1BF5A 1BMZA 3MR9B 4H2CA 3ETSA 3BH8B 3HNSL 1IZKA 2JKSA 4UT6A 3TV8A 2GYSA 5HBBA 2NY5C 2OJZL 3UDWC 1OW0C 2Z31C 3QUHA 4FQXB 2XWBB 5H4ZA 1OSPH 1P5UA 1TZAA 5CGYD 1JTOA 2Q86A 4HV8B 5JR1L 4HUUB 4X4XB 2Q8BH 1BOGA 3D34A 5LQBH 5DHEA 3ILDA 3NIFB 3IK2A 1H6TA 4O00A 1UYWH 2IAMC 3HMXA 3LEYH 2RGSA 3HHMA 3GSVB 1ZLVK 2CUAA 4HD9A 2HVJB 1A7QL 3B6SB 3ECUA 3HEIB 5HI4D 4W6WB 1XO8A 1I1AA 4OJAA 3CXFA 3VMOA 4N86A 3WFEH 1K2DB 3GQFA 3FB8A 4GIOA 1GJUA 4GO6B 4HWBA 4K2UL 4PJCF 1L9QA 1RI8A 4P2RD 3SJVE 1MHEB 3P77B 3QG7L 3PWLA 4YHPB 1ZA3A 2N3JA 5IVXB 4J5VA 4B53A 2E9IA 2VLRB 2YZ8A 4A2FA 3GBNH 1KC5L 3FK3A 4P9HC 4J3WA 1SXZA 4RMWA 4PSPA 3GRWL 1UD4A 3OB0K 4UAHA 3BESR 4F93B 1MCLA 1OW0A 2HVKB 4OI8A 2EDBA 3WEOA 2PPFA 4FA6A 3H0TA 2NY7L 3AUVA 3ARSA 1IVTA 4NI6A 3UYRH 4HHGA 1BD2D 5E5MA 5F9OL 1AKJB 1GYUA 4O2EB 4ANVA 1LK3L 5JZ7C 1J8KA 1Q0XH 1MQ8A 2J71A 4EN2A 1HC1A 2RFXA 3MLUH 1JERA 2YPLD 5ESVA 4RGNB 4QOKB 2WLLB 3HI6H 1SMAA 1MLCB 3IDMA 2NY0C 4P46A 3BAEH 1DFBL 4ZX4A 1MFEL 3S8FB 5D1ZI 1Z9PA 1G7IA 3P3SA 2WB7A 3CSTA 3PWPD 4AUYA 3TFBA 4L4TE 4JREB 4AIXA 3AY4A 4JNXA 4YHOH 1MDAA 5F70A 2Y2YA 1W15A 1FBIL 1A3RH 1YN6B 1OP3H 3UJJH 1BP3B 4XCYA 1X5MA 3AU1B 4BFBD 1SY6L 3B2UD 5IHBA 3OKMB 4Y4KA 3GDBA 1H19A 3KBPA 4M29A 2UX7A 2VLJD 4PY7A 5EDXA 1J0JA 3RL1B 3B2PA 5GGRA 1MJ7H 4MJJA 4RDBA 2QPDB 4LK4A 1DDHA 2FH8A 1EVUA 1HZHH 4B95C 1BQUA 1E43A 5HGBA 2Q3XA 3T6VA 2XWJA 1CF8H 3DUUB 4XCFH 5FHBL 3MNVA 4GMTL 5HVGB 2VLMD 1DLHA 1KTLA 4LCCA 3NSFA 3VXOA 1OAYL 4Z7OE 2CH8A 1F5WA 3QB7C 5C09A 1E9OB 3EJRA 4Y9GA 2WIIA 5BQDA 3DI2B 3HE7D 2PTVA 3G5YB 1SOQA 1W72B 4KHXH 4ZS6C 2YJLA 3LKNB 1ZHKB 1WCBB 5A2CA 3ARBB 3TBWB 5EO9A 5I9QB 2BVEA 5BVPL 3K81A 2VR8A 1QFHA 4XO8A 4CSZA 4ZMZA 5AALA 4IBQA 4JQXC 4ZUUA 4MZRA 1D9KC 1A4AA 4XPAL 5D2NC 4XP1H 1NAMB 2NMSA 3B7RL 3CN1A 5F7BA 3TJEL 3NJKA 4PJ7B 4Z3IA 2OMXA 3VXRA 3SPGA 4R2GB 4NUMA 3MROB 4Z3FA 1I8MA 2DQUL 4X6FA 5GS1B 4LCCB 3VXOB 1XH3B 1ZDQA 4J4PA 3Q8AA 2HRPH 1CTNA 4U3HA 1TVHA 2XKNA 2FEJA 3B43A 4NWUL 2YOCA 1CGWA 2FJFA 3G6DL 3L5XH 5J1SC 3UBXI 4HF5H 2H8PA 3B7TA 2VCOA 2DQTH 1N0LB 3P0GB 1AQKH 5T5NG 4L0YA 1VHPA 2OQJB 3II1A 1ACXA 1G9NL 4MCNA 2EC9U 4ERSH 5IP4A 2WVTA 5LQBL 1DVXA 1FJ1A 4M5ZH 3LHAA 4G80B 4JR9H 1MNUL 3BWAB 4FKHA 5HGHA 2WLNA 4DKTA 3BPCB 3DPBA 5IF0A 3D48R 2H3KA 3NESA 4ZZFA 3QO0B 2Y5EA 1GCYA 4IU2A 4Z7NB 1O5DT 1A4CA 3WXWL 3SDXE 4XCNB 4NB7A 5EEVA 5I8EA 5J0BA 1MIEL 1TU2A 1CXLA 2DN7A 3CVHA 5GXBB 4B9YA 1KENL 5MHSE 4OZFA 3VXSD 3NACL 3NZ8B 3O4LB 3OLDA 4WFFD 5B1CA 5I23A 1P6FA 5E9NA 2MCAA 2J1KA 3OJDA 5I18L 1B6DA 2ADIB 1AO7A 1PPIA 1OCWL 3BAJA 3F6LA