3R19A

Chicken sulfite oxidase triple mutant with altered activity and substrate affinity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGMLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords Sulfite oxidase
total genus 95
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r19A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r19A01
4PW3A 2CA4A 2BIHA 3HBQA 1OGPA 2BPBA 2A9BA 3R19A 2BLFA 1XDQA 1XDYA 1SOXA 3HBPA 2C9XA 2A9DA 2A9CA 3HC2A 3HBGA 3R18A 4PW9A 2A9AA 2XTSA 2CA3A 2A99A 2BIIA
chains in the Genus database with same CATH superfamily
4G3YL 3WFHA 3UPRA 1MFCL 2PMZA 2X28A 4JFDE 5I5JA 3ZQXA 2J21A 4F2MB 1I53A 1IFRA 1OK0A 3FFOA 3MA7B 5BOJA 5B4MD 1MFCH 1UT9A 5D2NE 4HWZA 1EEZB 4W1TA 4XZUB 3JYBA 4AEIH 1QSVA 4LLUA 2A4CA 1E4XH 1CIDA 1D7CA 3RTQB 1IAOB 4HCRA 2WINB 1AP2B 5GHWL 4H4NA 2VLJA 3JV6B 1KB5A 3CFMA 1NMAL 2C7UA 1MUJB 1ZT7A 3EO9H 4YBLC 1HQ4A 2OJZH 5ABAA 3ULUC 2W9DH 3LIUA 5IFAL 2BO0A 3X12B 4DW2H 3IRZA 4R6UA 1VFAB 3FH7A 3Q8FA 5KBKA 4DHLA 2GEEA 3Q9PA 4LSTL 4QMEA 4NO5B 3TH3T 1JN6A 4UBDC 2VLMD 2IQAA 1I1AB 1BLNA 3NACH 1JCVA 1FL3A 1YEGH 3GHBH 2NLJA 4PJ8C 3ROLB 2WYHA 4TUJB 1EHAA 1B0GB 3ZKSD 4AYFB 1TNMA 3RVWD 4F2FA 1BZ7B 3S0PA 5AOJA 2BP0A 4POYA 3P3UA 5FYLE 1XCQA 5E2VH 2XXGA 1FORL 1KLUB 2RCSL 4EN2A 2GQHA 2GVYA 1UTDA 3MV8D 5FW6A 4JY6B 3MCKA 1NEPA 5T3XH 3X3FL 4P2OA 4OCYH 3VNZA 3NGBB 5FYKL 1SNRA 3VXSB 1WF5A 1HQ4B 4ZXBD 1TZHB 2PXYB 1ZK9A 2XZQL 5C0GB 1JGUL 1K6QH 1FSKB 3LS5L 4MYPA 1G7IB 1UEYA 3LNDA 3KBPA 4N2KA 5FCSH 2IMNA 2Y7SA 4YSQA 1KCWA 4BXSV 4OH2A 1NAML 3EW3B 5JDSA 5GS0D 4YHNB 1OAZH 4H26B 1MCIA 1QACA 3OKMB 1IX2A 3I3BA 4HLZG 1TZAA 3KLKA 5I1DA 3FRPA 3MROA 5C86A 1H5BB 3IB4A 1SYSA 2W80C 2IOOA 4FXKA 2G3ZA 3E1F1 3L2NA 4TSAL 4OJFH 3OB0H 1E4WL 3TCLB 2YD9A 5ISZD 5DC9B 3UH8A 3EGDB 3ZT7A 2BS8A 3QIUA 1VERA 2YAEA 1TVBB 4N2EA 4XI5D 4F7TA 3OJVC 2NSMA 1PX4A 4F7MA 4Z7UA 4LLMA 1UJ3A 4JHWL 2HKHH 4K9EC 5IB3B 1PZCA 3H42L 1YNLL 5JHLA 3MKGA 1OAQL 4MMZB 1O6VA 4PP1C 3BEWB 4NZFA 4PPTA 3FSZA 1U4FA 1OTTD 4U0RC 1Q9OB 1CICA 1KF9B 2VWEE 2Z64C 1FFQA 4Z76B 4PN6A 2CLZA 4R90L 3VH8B 1T0MA 3ESUF 1GZQB 5DS2A 3WY4A 1J0JA 2CG9X 4L3AA 3Q1SH 4JS7A 4YHIA 3PAYA 1KCVH 4HW6A 4MCYB 5A16B 5HYJB 1GYWA 1U58B 3EJTA 4JM2C 4YO0A 1WFMA 3KWVA 4K3GA 2FR4B 2EICA 1KG0B 1M53A 3E9TA 4I3GA 1RCYA 5E03A 5F88A 3FMGH 5B39B 1MW0A 2DQEH 3FMGL 3TOPA 2LHAA 4BDVB 4YVNA 3LPGA 4JFQA 2KMWA 1HZHL 4W9FC 2WO2B 4K15A 5JIKA 4IU3B 5KUKA 1MZYA 8FABB 5BRZE 5J6GB 3T4AB 3Q6FB 4MJIB 1EGJA 4U6XA 4M7LL 5KSAD 5BZZA 4JFEB 5KYUA 1RZKC 4AMWA 1ZT4B 5IMKB 5BQ7A 3G3LA 1S7VB 4N2AA 1HSBA 1RZJH 3PNWA 4BGDA 1NGQH 2FIRT 3VG0L 4OV6F 1UASA 2JCCA 4NCDA 3L9EA 1WT5C 3DMMC 3OKNB 4UAHA 2D3VA 1FN4A 2JTDA 5I74B 4L8BB 5JW4N 1TT6A 2OCJA 5HSFA 4I48B 4OR1A 3FTSA 4YVUA 4OGAD 2R1YB 2AQQA 1AQMA 4PJXF 3ARXA 4G8FB 3WJLA 2CNYA 4X7SH 4XX1G 1GPOH 4TULL 1Z6JT 4E9VA 5BQDA 2V33A 3TEWA 2ILLA 4PJ8B 4BD4A 5HI4C 3V5HA 4PJ9B 5IMOB 1C7TA 3TJEL 25C8L 2RTTA 3K72A 3MRDA 4GFTB 2BIIA 2DM2A 1I1AD 2HLAB 3N50A 1RK0B 2AEPL 2JJSA 1J0KA 5KVFE 1C12A 3HE7C 3K4ZA 5KSBA 3MGOA 2XFGB 5GRYA 1S7QA 2Y1VA 3GQFA 3RFRA 3J2PA 2ADGB 3PDGA 1TNNA 4YL4A 5CUSL 2BNRB 3QQXA 5LGYA 1H0DA 3L7EB 3QQ9C 1PZ2A 1F8TH 1KTJA 3EG9A 4MKMA 1GGCH 1YUHB 4PRNA 3SKJL 1XMWA 4Q9BA 3Q3GB 1UM4L 4KDTA 4OI7A 1TQUA 2CKBL 1XXDC 4NAMA 1UZ6F 3SDAC 1CQKA 2FX9H 1S46A 4RWHA 2FJGB 2GIXA 2H6PA 1L9SA 4YC2C 5ESAB 2CBPA 4MS8D 3VYNA 5BUGA 5JOFB 3WNOA 4KKPA 5AOLA 2B0SL 4A2MA 1MH5A 1IAII 2BNQA 3MJ6A 5F8QC 1CU4H 5G55A 3I2CL 2QPFA 3N40F 5CJOL 3PV6A 4QYAA 2GAZA 3C75A 2BINA 4EZJA 1AGEB 3NJMA 3HNVL 1YN7B 4GKZA 3MOAH 3GJFH 3S36L 1KFAH 2ZD0A 5AB1A 3FNKA 2HWZL 1Y0LB 3U4AA 2EDFA 5D7SL 5DHEA 4GG6A 1TITA 1UXSB 5AB0A 1YMHB 3WNLA 1QNIA 2XT1B 4K3EH 5ERWA 3FPXA 4ZBJA 2C9VA 4BFIB 4K7PY 3IGAB 4LDEB 5EZJB 3D9AL 4OZFG 4XX5A 4LOVA 3BRFA 1HN1A 4LP5A 1BFSA 5I76A 4IJ3C 3RKPA 2BY3A 4JO1L 1JHLL 5TQ0L 3CFQA 2MIZA 3DURB 4YHZH 4KXCA 4GIAA 1TYJA 5D4JA 3QIWA 3X3GL 2JXMA 4P2QA 4KMTL 4Q7DA 2A7BA 2NDGA 1UA6L 4OFQA 5C0BB 5C3TA 3REVB 4DEWA 2H2PD 2ZT9C 4LL9A 3L3HA 5HPMB 3WAJA 1WUZA 2KL6A 1OP5H 4UINL 2AANA 4H0LC 3WUWB 2GCYB 2Y5QA 4Z7NE 1ZVSB 5D8JL 1HI6B 2HH0H 3GJFA 2VDRB 2L0DA 4YNYA 2YUWA 4MCMA 1IM9A 2CDEB 1YN6A 1BQHG 3UZEA 3H9SA 1TJIL 3L95B 3FFCD 3B2XA 3F2LA 1L6XA 2WCGA 3VMNA 3W11D 2JQZA 5ELIA 1KBKA 5JPMB 1JF5A 2B20A 2ZG2A 1A4AA 1PQZA 1T7WA 4X6CE 5AYUL 3AITA 5HDWA 2ZSVA 3NZHH 5DZLA 4H1LB 5ISZE 3M86A 1KDJA 3ROOA 3OKLA 1H19A 1O9WA 1KPRA 4XCNB 3KG5A 2C26A 3MRMA 3LNHA 1PNCA 4OD1L 5JO5A 5L8JB 1G0DA 2QBWA 3WJLC 2ICEC 3KPSA 4XPGL 4U49A 1CR9L 3AAZA 3ALXA 4HH9A 1RHHA 3F58H 4PV9B 5G4MA 5I1EH 2VQUA 3GRWH 5FYJL 4DZ8A 2V7HA 5HHQA 5A7EA 3LRLA 4G6KL 4WUUD 3U30B 5D7KE 3SE4A 2WVTA 1OLZA 4XGZB 5JOPE 2XPGA 4YDZA 1TVHA 1KBGL 4KK5C 3WNPA 7PCYA 4Y16A 3ABLB 3UAJD 2H0PA 1WRFA 3BUDA 3PHQB 4G8GE 4X6BA 3U82B 1W72H 2CGRL 2OP4H 3FONA 4HK0B 1GA2A 1MKFA 2ZX9A 3OSKA 4E9RA 4H0IA 1IQDA 2FO1A 2I60H 2IANB 4FQJH 3V4PA 2LGNA 4UMSA 4PV8A 4JEGB 2BZ7A 4WO4B 4M6NH 2EO9A 4ADIA 1M6OB 1SMDA 2EEFA 3ZDXF 1M2VB 4YHOH 4E9WA 2E75C 4JHAH 4PWHA 4EOWH 1PLAA 5C09E 1R17A 2YQ3A 1ZPLA 1B3IA 3DV4A 5ESVB 2WWNA 3MRGB 4MQSB 4ZNEA 1GYVA 1WIUA 2WQ8A 4YK4C 3QH3B 5H2BB 3VGGA 1AZNA 1BXVA 4GRLB 3DGGA 2Q6WB 2Y3AA 4P46C 4XMPH 4JO2L 2DLIA 5DHVH 1U8QB 1UOLA 3ZJAA 4HPOH 5TDPA 2BNRD 4R96B 3ZR6A 1D3CA 2HT4D 3O0LA 4QKTA 5FDWB 3V0AC 4E5XA 3TBYB 2BCMA 3GMMB 5ALBH 4ELMB 5F6HI 3GO1H 4JM4H 2I9LB 2MWCA 2WXGA 3PE9A 3K46A 2V2TA 4N8UA 2AKRB 4JZNA 3TPUB 4URTB 4AJ0A 3B7RL 2RAMA 2NY0D 1YLBB 1PBYA 1K4DB 1LVEA 1QATA 1ZKAA 2Z4QB 1BAGA 1OTUC 1XZ0A 4YSSA 5LGHH 4X4XB 5HHPB 5BZWB 3OLIA 1ID2A 4EMZA 4O2FB 2P5EE 1HE7A 3EBIA 3EJUA 5LBVA 4ESKA 3NCEB 3JWNE 3RGHA 1TG8A 2W0PA 1UH3A 2ZKWA 5PAZA 4YSUA 4WDIA 2VC2B 3OXRB 5FX3A 1S9WA 2HG0A 2A9NH 1AJ7H 2B1AH 2B1HL 3QJTB 3BKYL 4UTBH 3MI6A 2Y06L 3D3VB 2ADIB 1UD2A 1RZ7H 2EILB 3PGCA 3PWVB 3RWIB 3L2LA 3RE0A 2QPUA 3PY9A 5DUML 4UYQA 5DRNB 3KMDA 5E9DE 3Q1EA 3WNIA 3UTPE 3S8GB 4NHUB 2PW2A 4LASL 1TSHA 1MY7A 4XNBA 4AUUA 4AGMA 3MRKB 2BP8B 1DBBH 2YGOA 3V5KA 5L8LB 4RAUA 4CADA 2K4WA 4LSUL 2YPKB 5ADPH 3WKQA 4DP8X 3V5DA 5KSAC 1KXTB 2HSIA 1N7MH 1NUGA 2R69A 3BAIA 4G82A 1BVLB 1KELH 3AQYA 5IIEB 1N6VA 4ZMOA 4IKKA 4AVKA 5D7JB 4H88L 3RUGF 1T4KB 4GUCA 4RFNB 1FVDA 2E7LA 4UOJA 3VWJC 3I6GB 5IW6A 1MDTA 4ODWA 3ZL4H 4ZMXA 2G60H 4ANVA 1GKOA 1DVXA 2XQYA 3O8XC 1A3RL 1T22B 2WXFA 3QCVH 3V6ZB 4WK4B 2Y9RT 3DJSA 4GBXD 2Z92B 1RZQA 1RERA 2FDBP 5FHBH 3BCDA 1ED3A 4HLEA 3DHPA 3LIZA 5ANME 2OMXB 1QQDA 2NTFB 1N2RB 4UF7C 3NZ8B 3PUUA 4RFEB 3B9EA 3BN9D 5T5FA 3T2LA 3ZTJH 4FC3E 2DL9A 3JT0A 4APXB 2CLVA 3T08A 2DTML 2XKSA 4RRPM 2DQMA 3G6DL 1FNGA 3MV9B 1HCVA 3FZUC 2YPKA 3MA9L 2KLSA 4F92B 2OL3B 3ATDA 4S1DC 3LKSB 1FNAA 3WSQL 1JDAA 2HT4C 3N5AA 4OJEH 1UB6B 3AROA 4YHML 3WOVA 2C1OA 4HKXB 5GIRB 1NQBA 1HESA 4L4TA 1PTZA 2C9QA 3W9EA 3QHFL 3ZE2E 3MPCA 4YOKA 2Z93B 4MMZC 4E42B 2HMID 1FYHB 1NCBL 5GRJL 4KPHL 2MOQA 1TQTA 3RNKA 3WKYA 1G4MA 3VX0A 5AW7B 4Z3JA 4PY8J 5MEPA 3HE6D 4OLWL 5H4ZA 4P99A 1YEHL 4IKJA 5E2TH 3DPBB 1LYQA 3T3PE 5CD3A 4M9PA 5HVHB 3GMNB 4ZZFA 3A4AA 2N0MA 3WIHL 1XZ0B 3ZL1A 2ZX8A 3PPSA 4KXZH 1R3JB 4HJJH 4Y89A 3II1A 2CR0A 3MFFB 2FGWH 4H2CA 1DBJH 2WQVA 3GYRA 3KWWA 3LQMA 5JW3L 3V7AG 3MCYA 3O45B 5BRZA 4XHJD 1MREL 3VSTA 4EZKA 2Y4SA 2DJSA 3FCUB 2AJVL 1UXSA 3P2DA 2P80D 1QYGL 1RP9A 2H3NB 1Q9WA 2DM3A 3DGCR 3HNSH 3KAAA 2X4PA 4BIKA 4H8QA 2YGVA 1RXLA 5CD3B 4AH2A 2IFFL 2NXYD 5FDWA 4F37K 4JREB 3ORJA 4WJ5A 3CZLA 4DGIL 1R47A 5CU9A 2WLNA 3B5HA 3VB8A 4U05A 4B95C 4U1GC 5CUSH 3FRPG 3WDHA 4YDJB 2FWOA 1U8CA 4HG4K 1DUZA 5F7EL 5ICXB 3O6LL 3JWNG 5HYSB 1JHKH 1A1OB 3VYOA 4QXTB 1NGXB 5CSZB 5C09D 2OMTB 2X2IA 2F19H 4NLAA 3V79C 3MRNB 4P5TC 5BNXD 3QUYC 5D2LB 2C9RA 3COOA 3DX1A 3M6DA 3V0WH 3ASNB 5JNYB 2R69H 2CXKA 4PI0A 1R0AL 2ED7A 3CK0H 4LEEA 3NIFB 4QRSB 2UXFA 3VO0A 4JFOB 3D1MC 4U31A 4YZFF 1W0VA 4PJ6A 4KI5C 4KY1H 4NZJA 5IB5A 4PSPA 1BVNP 2QVTA 2KYIA 1QNZH 3T3ME 4GO9A 2ZXGA 5LKNA 3O6FD 1A6VH 3V4PB 1Y6KR 1IQDB 3OAZK 1CGWA 1E7VA 1QOKA 1U8NB 4FFZA 4K5MA 1N19A 4FQXD 1Q9LA 1RMFL 4LHUA 4DPCX 1X5GA 4QWWD 5EO0A 4PV9A 1OCWL 1ZV5A 1R3HA 4XPTH 1Q9KA 4D9LL 4DQAA 3NABH 1XHHA 3WIIL 4QAMB 4PGZA 1DN2A 3D39E 4I85A 2YN5A 3ML9A 4R7XA 1D5ZA 2C3GA 3BSZA 2H4EA 3UBGA 1A1MA 1MCJA 1OSYA 2XZCL 3DXAD 3KPLA 3SIKA 1D5XB 3KL0A 1XAKA 1FZOB 5ANMB 3BH9A 3GZOA 3LN5B 3TBTB 1W0VB 5IIEA 4WSGA 3K8KA 1XL4A 4GQPH 4OLZH 5MI0C 4UOZA 1CLVA 5IV2A 4OFYA 3AB0C 1VADA 5DK0A 5D7IA 3LH2H 3HAEG 2K9FB 2QVFB 1FO0L 2AMUA 5FKPB 5GGTL 5GGVH 5IZ7A 3CSFA 4OZHF 1M1XB 4JNXA 3Q6FA 2OMTA 5F7NC 2B4CC 2WXJA 1AOZA 3KXFE 1KIUB 43C9B 2YPVH 3ZYZA 2JSFA 2E4TA 1E50A 1Y18A 3KXFB 4UUJA 4X7EC 3RIKA 1RUKH 3AQDA 5CO1A 4BKLA 1AHWB 4EDWL 1HIML 4GLRH 1R5VB 1KGCE 1KC5L 2VAAB 3RY5A 1ZHNB 2VRQA 4JHVA 4P4RB 3FQNB 4LAJH 4DKTA 1NIBA 4R90H 1I9RL 3NEOA 4XN8A 2XA3A 2PP9A 3KYNA 3BPNB 4LOUD 5AWNL 2WKGA 1AC6A 3MOBH 1DVSA 4MNGA 1G7MB 3M45A 2FO4B 2I26N 2AQTA 2UWEE 5AWNH 5L2KE 3DURA 1T1XB 4HLZH 3ARPA 5D7JD 5F7DB 3IGUA 3ZN6A 1T0MB 5L9DL 3SBQA 4MA1B 1VGKA 5IJBC 1T89A 3SE9H 4PTTA 2MQCA 2W9EH 3O81A 4OAWA 4WTWA 1AACA 4R3SB 5KVEH 3MBWA 3OGCB 4DEPB 4F24A 3IJHA 3H9HB 1RUMH 5CEZH 2XQYG 1OAUH 4TQEH 5GSRB 2IXQB 5I0WA 4M48H 3AW5A 1IO4C 1YMHA 6TAAA 1F2XK 3T0EB 4FL4B 4N8PA 2X4OA 2FX8H 3QW9A 4PBVC 4MAUL 3N85L 5SX5K 3W5MA 3L3IA 3HC0B 1EO7A 2APSA 3HZKA 2OBGA 2LU7A 5F3HA 2J5LC 4PJHF 3OKKB 4J6RL 5TF1L 4Y2DB 2G4EA 3K71B 3BAEL 1OKEA 5C70A 4FA6A 3VXRD 3TYFB 5JZ7D 4XP1H 2EXYC 4PJDA 4ZFZA 1LNUB 4KZ0A 2Z8RA 2YHGA 1OCWH 2EDJA 4F3FA 2A0LC 3MRFB 3QXWA 4BK5C 5EEUA 4W6XB 4OLYL 3VFPA 2EYRA 2CKBH 2DLTA 5IWLC 1QRKA 3UJIL 1XD0A 3U7WL 4W6WB 3CSTA 3ZU8A 4O2CA 4QPEA 4I1RA 4C59B 4JO4L 4M7JL 3IM1A 1JWSA 2VMDA 4FG6C 2ZOOA 2F6AA 4RFOL 4N2CA 1SXBA 4X8CA 4JLRB 5KJRL 2Q86A 3N1QC 5C09B 1VGEH 1VACA 4WU7A 4JUSA 3FPYA 4UIMA 1W8OA 5IQLA 4HXAL 1JNNL 3ZK0A 1DQML 5BZXA 3HZYB 3OB0K 5GGVL 1WBYB 1XH0A 4NX0A 3JQOB 2VM9A 2ZOLB 2ZKMX 3LZNA 4Z7VB 2H2SC 2ODIA 1BG1A 2V6HA 4JCWA 3DBXB 3V9EA 4Z7VE 2FIKB 5HPOA 1G6RA 1T0NA 1N0LA 1KY7A 3WY2A 5K69A 1SFHA 4QHKI 4CW1A 2EQDA 2PWGA 4PLOB 3FYEB 1IC0A 1GRWA 2NQ3A 3ILQC 3T65B 2N7SA 1X5AA 5K1JA 1ZXKA 3SKNB 4P2RA 4Y1TA 2NPLX 1NFIB 3B2PA 1OPGH 3U6RB 3OAYK 5DS8B 4J3BA 5L2KA 5DRXA 3CHQA 4HHWA 3TZVC 1WYJA 3WE6A 4M5YL 4NKMB 2LT9A 4TUOA 4XMKH 3RFZA 3HB3D 4QXVA 1FFTB 2QQQA 3FDWA 1ODUA 4XOAA 5MERA 2P8PA 2Z35A 2ETWA 4NQSB 5J8OA 2YEZA 5MI0B 1NOAA 2NY4B 4L3EB 1KB5B 3JBG7 1DUYA 4JFWA 5A3ID 5B39A 3ZDZF 3VD1A 1YN6B 4RWYH 2RH0A 2Q20A 3S5ZA 3WLWD 2DYRB 4AYSA 3QEGH 1XR9A 1EX0A 1G1YA 1GGUA 3G08B 1ASOA 3OD3A 1PFOA 4FG2A 4NQVA 5HDLA 1QLEB 1KTKE 4YFLF 2PWHA 4YHIB 3SD5A 4DERA 3KEDA 1WFJA 1I7ZA 5C0BD 3AU1A 3L08A 3O6FB 4Y9EA 4MAUH 4F7CB 3LEYH 3Q01A 5GRUH 2VXVL 3U6XS 3G5ZA 4MLIA 1NPNA 3FCBA 4R4BB 1ML0A 3C8DA 1NEZA 1HILB 3UG3A 2VQ1B 3ME0B 4Y8DC 4ICXA 5A2CA 3MRCB 1BMGA 3OG6B 2H41A 3CAFA 4OZGE 2NUTA 1TR7A 4PB0L 1KTLB 5D1XD 2X05A 2X44D 1FA4A 3QORD 4FLSA 3ARQA 3MGTA 1QSED 2AKRA 5D4IA 2X0VA 4BUHA 3HB3C 4U6TA 3LHPL 4OM1L 1FWXA 3UOAB 4OKDA 1R5WA 2WHVA 3LEXA 4K23L 4HJTA 3LHPH 4OM1H 4BV1A 2OSYA 4A2LA 1TXKA 4LCIL 5IF0B 4QOKB 3B4NA 1SUJA 3HE6A 2ZG3A 3SODB 3IDGB 4MD5B 2XBZA 1A14H 1NCIA 1UYWL 2EDBA 4AT6B 4YHNA 5JHDE 2ZYSA 3BH8B 3WSQH 3CPUA 2CO1A 2XZAL 1MRCH 4K9JA 1FBIL 3SE8L 4R4NC 3ZMEA 3WTUA 3MLYL 1MCNA 2J44A 4MB4A 1U30A 4KMQA 5L7XH 5DT1H 4F57H 2VNCA 2PABA 5IK3A 2NY7L 2I7SA 1A7RL 3AWEA 5CILH 4ZUTA 1LD9B 4LHJB 3UTZB 4KK8C 5EDXA 3LKOA 4HCGA 2MSPA 2Z31B 2JLPA 4XODA 3PHQA 1TIUA 2VDNB 2JFCA 3MX0A 5E5RB 3MV7D 3MLPA 1JTPA 3JWDH 1XB6A 2OM5A 4YBLB 3TX4A 3IEAA 1ZLEA 3MRQA 4LSVL 3VFTB 3PWJA 3N3EA 4MXWH 2AMGA 1USZA 2P24A 4HDIB 1VZGA 4F7PA 1WT5A 5C0AA 2D7MA 1P7BA 2NY6D 5JIHA 5I8KH 3KPRD 2NLJB 2VC2L 1NCNA 3PGDA 5C08E 4FZ8H 3UDWA 4FEIA 1ID5I 1UHVA 2Q3ZA 1OT4A 2AEQH 4G6JL 2F1BA 3WTVA 4TKWA 4XN1A 3ULUL 2OAAA 1YUKB 4J3OD 2VXQA 3O11A 4AVJA 4GFXA 2F2HA 4X8GA 1BF2A 5LXGH 1G87A 4NUGH 4HFUH 1M71A 3VQ1C 4NO5A 5I1LA 3MODH 3TURA 2QLYA 1ZT7B 4BFEA 2BVOA 4HPYH 2CJSA 2Y1ZA 3SKOA 5ANHA 3L8QA 4BZYA 2VDNH 2HFEA 4MD4A 4PVNA 4ZUTB 3HHRB 2VDLH 2VDNL 3IN0A 1Z9PA 1NEUA 1NLDL 4ZAKA 1TVDA 4F20A 5IY5B 3F8UB 2P45B 2FT6A 4ZX5A 4ZK8A 4BCZA 2DBLL 2M26A 5HPMA 3WXVL 3TIEA 2KZ1B 3CUPA 3RTQA 5KYXB 4KMLB 5GISL 5IBLD 5F93C 3G9AB 4P2QB 3ZY7A 4JQXC 3L5IA 4NQUA 4AT6A 4X0KB 4MVBD 2EUXA 2PCPB 1NUNB 3QEHA 4GRMB 4KPHH 1KCRH 5K9JL 4PJIE 4G8EB 3SDAA 4CKQA 2JV6A 2VDPL 3CN0A 4HUWA 2D7TH 4F9LA 5D1QC 1A0QL 4U7MA 1VFBB 2XFXA 3EYOB 3NRPA 4XP9L 3N41F 4AW7A 4UQDA 5HD8C 1QBLH 3NJGA 3ASWA 3A6OA 3GWJA 4PREB 4HJSA 4PRID 3SJVD 1GCYA 1VZHA 2CUIA 4H8VA 5SV4A 2WP3O 5HP5A 3Q7JA 4B53A 3L45A 2R0KH 4NM8L 2APXA 4AEFA 3FT9A 4UI2A 3MUGB 1TEYA 5IKCB 1UD3A 1LO5A 4JFHE 3KLLA 4AE0A 3GSUB 1UKTA 1YC8A 1X5YA 1B4LA 4MQXD 5SX4I 1XB8A 5CS7A 1HILA 6FABH 5EZLA 3HB3B 5C0IA 2I27N 1LQSR 4PGEB 3OG4B 1QSFA 4NO2A 3NDZE 3ZE1B 1TTAA 3BCFA 3EJZD 1V3LA 4XVJH 5HYJD 1WWAX 4Y2NA 1JE6A 1BVZA 2XWBB 3WKML 2YD4A 3FCSB 5I8OL 3OJDA 4P3CH 3EG9B 1A4KB 5IP4A 4ZNEE 1WZLA 1SF3A 4FQXC 5T1MB 2MPAH 3E2HB 4EKXA 3QULA 4N1CA 4JRYB 3V52L 4HUVA 2PLTA 4XWGH 3D0AA 1AZBA 3O9WC 3ULAB 4OZFB 1UD8A 2XTLA 4XTRC 3ZHKA 5LDUA 1WAAA 3VI3E 1SQMA 2Z35B 1CN4A 2H1PL 3HBZA 3P73B 5TGBB 5HBBA 1F3DJ 3PWPA 5AVTB 1YHPA 15C8L 4HHAA 3NJKA 4K8RH 5EA0L 1JK9A 4AITA 4S1RL 2XQBH 3MRDB 3B3IA 15C8H 3IMSA 1XH2A 5FYKH 2PCYA 5HJ3B 3JV5A 3DKHA 1GR7A 3A67H 1FHGA 1U95B 2R27A 5MENE 1GGIH 1DBKH 4I2XA 1JYWA 1H8SA 1ZLWH 4A6YL 4DK6A 2QMKA 5FF6B 4NPYB 1G7HA 3QHFH 4KOCA 1XB3A 5C0AE 1Z5YD 2BIOA 4Z7OE 3EUDA 1IJNA 4XX1E 3B7TA 4L8BA 3D69A 3D0VB 4MLSA 4LXFA 1NMAH 3VDBA 1I1AA 5IOKA 2H0JA 4HXBH 1FG2A 1U95A 1HSBB 3PNWB 2XG4A 1JTOA 2DLFL 4FFTA 5BQ7B 4DGWC 4HJUA 5KVFH 1U8IB 1W15A 5FYKU 3G5VA 4B3VA 2D0GA 5J6GA 2EYTA 2H6UA 4UDUB 1YMMB 1BX2B 4MWFB 5TE4L 1EDQA 4LDOB 3NFPB 4MZ2A 1JZGA 3ECBB 5I1GL 5CINH 2YPLD 2QFRA 4ADGA 4KK8D 1RUQL 3EJZC 4LPWA 2BSSA 2OK0L 1F3DH 3AJ7A 3S96A 4LHUG 2ZSWB 4M61B 4PRBA 2YOCA 4IEFB 4A6YB 3ILPB 4S1SL 3O4OB 1NUFA 4PJDB 4MKTA 3NJVA 5EEVA 3ARDA 3ERXA 4PJEE 2FJHA 3S5LA 3STLA 3ZE0B 4F2MA 1KGIA 1TCRA 1AZUA 4KRPC 1FF5A 4E41E 4NXSA 3GSWA 4YEEA 5ICZB 2WLIB 3MUY1 4CGTA 1UCBH 3FT2B 3T3PF 5J06A 4ZOAA 4UT6H 3AWFA 4LLAA 1AGDB 1XBDA 2IAAC 1IFHL 3BAXA 3QRLA 4YAQB 5F0MB 1MXDA 2PW1A 4IOSA 3LHAA 1GGCL 3ULVC 4FJ6A 1I3VA 4TNFA 2XZQH 1P4LB 2APVA 1DEEA 5CIPA 2X6MA 4OB5H 3HAEA 4YWGL 4Y1AB 4Z7UB 4ZD3L 4XWOC 4NSKA 2ZXBA 1A7BA 2OFQA 2Z7WA 1Y6MR 2V8MA 4Y1AE 5FA3A 5LBSL 2AFNA 4RIRB 3VI4A 3WENA 3VI3A 1BOGA 2P26A 2B0SH 1TQCC 1CGXA 1P6WA 1QSZA 1SYSB 2WLIA 3U2JA 3ARGC 3B7SA 1IM3D 1NCTA 1X5IA 5DJ6A 3RGVD 4YUEL 1OIOA 5AFAA 4H8UA 4MB1A 3NIGB 4PB9H 2B5IB 2OSLA 1G7LB 4H26A 2GBAA 1AQKL 4JN1H 3IFPB 5FS5A 4IEFA 3UZVA 5FW7A 4ES8A 1LXMA 3G08A 1MCQA 1QWNA 5KVMC 2NUPA 1MCCA 4P59H 3VI3F 2YAPA 1FG9C 2ATKA 4IS6A 4UWQB 5HHVH 3V0GA 2OTPA 1Z9NA 1CGYA 2J8UE 4JAMB 5HI4D 1Y18B 5EPMB 4RQQB 4FRWA 4MXQC 2XWZA 4NQSA 1EV2E 4YR6A 4JRYE 2PN5A 2COVD 1QI4A 4QXWA 4TUOB 1TPXC 4XBPB 4DN3H 3RFZB 4FXGA 4RA0C 3IXAB 2UZIH 1UC6A 4J12A 5EC1B 2BCKA 2BFGA 5LN8A 3U6RA 1JGLL 5EEWA 4I7ZC 4K8RD 2OTWA 4P04A 1DBAL 4ODUA 2IBZY 5HDQL 4OZHE 3UTTB 3LAFA 5E2JA 5DLLA 2AQRA 3ENEA 2C7FA 1BZ7A 4OF3A 4MCNA 4OUOA 4D94A 3KPLB 4ZOEA 5CJ5A 5D9SB 1QVOB 2HRPL 3WN5C 4EIUA 1GIGL 5A40E 5KTEH 5L8KB 1EFXB 3D2TA 4DKEL 4RAVB 4NXKA 2H32B 2PKDA 3T77A 3C6EA 3VI4F 5C6PB 1QUNB 1JG9A 3B37A 3FOMA 4X83A 3D25B 3IGKA 1OGAD 2DQTL 4PTUB 5EO0B 4N2DA 5HHOA 4PRPA 4XO9A 2Q86B 4OGZA 2IQ9L 3O3DB 4U4IA 1QKZL 5DEFA 1GS8A 4KNTA 1NL0L 4L1HA 1U2HA 3Q5YA 4JX0A 2GUOB 4XAWL 3WKPA 1IFHH 1TTGA 1HNFA 4GRWB 3WO4C 5I6MA 4LLUB 1A4KA 4PGBA 4XP1L 3NVQA 1CVRA 2OMZA 4WHDA 4AMKL 3MLYH 2VJ0A 3QEGL 2DIAA 2J4WH 4YSOA 2DQCL 2IV9A 2RR3A 4L4JA 5B1CA 4AXWA 4YE4L 1P1ZA 3RILA 4XVTL 1YY8B 1QSFB 4L1LA 1KJVA 2QSCH 1PPIA 3KBHE 3CVBA 2WPGA 1LM8V 4TSCH 5JPMC 2X4OB 5I5MA 2I07A 4JPWL 4P23A 1B6UA 1WZMA 3NBNA 2WBXA 3CFEB 2X1XR 3HC4L 4YGAB 3APDA 3MLTB 2E7DA 4KJYA 4CMHB 5LGJB 3HCVB 5DMJB 2N59A 4YXKH 5DD3L 1GKEA 4ELKB 3DRQB 4FZ8L 2GSIA 2WUCH 2HFGL 4HIXH 3RUGB 2A1WL 5DD3H 5HYIA 4M1GH 5HI3C 1RJZB 3WS3A 1PF3A 2NUTB 5DO2C 5C7ZA 3RB5A 3VFWB 3BZFA 3BRGC 3O2WL 1WAEA 4J4PD 1T1XA 1HXKA 3S2AA 1RKRA 3JV4A 1S9YB 3BOVA 4R83A 5H4YA 1FLTX 3D8MA 4JN2A 2WC7A 1PYWB 5H94A 5SV3A 4S11A 2ZP0T 2PWFA 3TESA 4X5PA 4U6YB 3QGVA 4K5PA 4WNQA 3II2A 3QQ3B 4JRXE 3NJJA 1ZHBB 3GBNL 5KYYA 1BFTA 3FB5B 3IJEA 4WSKA 5EZOH 2B39A 1EDYA 3FTUA 4NDMB 2FCBA 1EQWA 4JRWA 3B9AA 1S8DB 5B1AB 3WFDH 3DOSA 4ZAKB 4S1QH 2OYLA 2FRGP 2WXLA 1C1EL 1JXGA 2WTPA 2M2DA 3TZVD 3CZSA 3TCTA 1QTPA 2HFEB 5DMKA 5AVYB 3AG2B 1EEQA 1KNOA 4HH8A 3TO4A 1GHFH 1AOHA 1SJEB 5I1LB 1WTLA 2JCCF 1OHQA 1DSWA 2V7NA 2FBRA 4QHNA 3BUPA 2FK9A 1P7KA 2LLNA 4APXA 3DHJA 1H3UA 3H4FA 4JCMA 4LLWA 5D6DA 4Z3GA 5FV1L 4OGXL 5TDNA 4CBPA 4ORGB 5DS8A 1P9MC 4AOFA 3OX8A 1T03H 2VSKB 1HEZB 4LHQB 3CZKA 4PD4J 2EVGA 3DV6B 4WKZA 1N6QH 3QDMA 4OZGF 3J27A 3PLYA 3CSGA 5L0QC 1N70A 1BWMA 3POCA 1FFPB 2DV6A 3H3PH 4NQDE 1BV8A 4YDNA 3IDNB 4V33A 3LKNB 1F6LL 5F9JB 4RGNC 3WUZA 1X3DA 4LOEA 3Q8BA 1MAMH 3RWHA 4YFDB 1F11B 4FQQB 1WBYA 5AZEL 5A2FA 3HI6H 4IBWA 1N18A 1OANA 1AR1B 1YQVL 4P2AA 5KBNC 1ZMYA 3FQYA 4WU7B 1EO8L 1HXMA 3T0DA 3UTZA 4AEHL 4I18C 3ZPDA 4KDVA 4RMSA 1U3JA 2CLRA 2X4RB 3DYMA 3JTBA 3GSXA 3IXTA 1MCWM 3ZL2A 2ATPB 1ZGLM 5TE7H 3F7VB 1BIIA 4LPCA 1EVUA 4HUUB 4HZ1A 1A1OA 4IOSD 2W65A 3R06A 1D6EB 2DW5A 3MRFA 5IFJB 5F96L 5D1ZD 5KWYC 1L5GB 4LBEA 4OZGB 3A24A 3QZOA 1F6AB 1L3WA 2EYSA 3HPJA 4YDIL 2A83A 4N9GA 4KKQA 3CDZA 5C2BL 1QSFE 2JMRA 2LU3A 1KLGB 2FEDD 5HDBE 3QXUA 2AXFA 3NSFA 3F6JA 3PG2A 1UGKA 2VDRH 2CJTA 3BZ4A 2DJMA 1J0YA 3SDCA 2P5WA 4O2EA 1U6AH 5AKRA 5FUOH 5DU7A 1DJIA 5CM1A 1XFPA 3F5WB 1ZVYA 1EFXD 1M9WA 3G6JB 3K74B 3LKRB 3U7YL 2BLFA 3QCUL 4W6YB 5LWYL 1T3FA 2ARJQ 3RDTB 2X1OA 2EXWD 3TN0B 5LAXB 2F53A 4ATWA 2C3VA 1TYEB 2LFGA 4JZJA 5AVRB 3PDDA 1NCBH 1JZIA 4M8RA 1ZLWK 2JCCE 4KJWC 3M07A 5DZJA 3RVUC 4FHBD 4WWPA 3ARBC 3MUHL 1DZ0A 3HMWL 4RX4D 3VXPA 2P7TA 1NFDF 3C09C 1JIBA 5MENA 2MPVA 5E4EC 2QR0A 5FV2A 4E9XA 2PPEA 5K9QI 2OTUB 2XU9A 4HPYL 1UVQA 4JM2F 4GKSB 1XR9B 1CG9A 1SQ2N 1ZA6A 2A83B 4N9GB 1QI3A 3NT0A 2ZXCA 3P4MB 1ZHNA 4IBTA 3HZMA 1CD1B 4UQIM 5AAMA 2C3WA 3M1CA 3LKSA 1VHPA 1YC7A 3CC1A 1IC1A 4JDVA 4JM2A 2X88A 4B3EA 1J5OH 1JPEA 4WY7L 5DMYA 5I28A 4CDGC 4TV3A 4GSQA 2YWYA 3RURA 2P8MB 1AS7A 3X3FH 2JVUA 3LIZH 3VWJA 3ETTA 4WFFD 1IGJA 5IJKC 1JF1A 2AXGB 1Y6NR 2BOCA 2E7BA 4LU5L 3MNZB 3ZW3A 4ZSOE 1G1KA 1Z9SB 4Z6AT 3WIFA 3H2QA 3NIDF 3QYNA 3WTTA 1RIVH 3BXNA 4ZUUA 5G4OA 5J6SA 1A3ZA 3NH7H 1GC1L 4PLJD 1TJGL 3V95A 3V6ZA 4PJDE 1QASA 2A6JA 3N2JA 4YDVA 4B27A 3DO4A 1UZGA 5C9JB 4P05A 5E2UH 1D7FA 1PZ5B 2FQEA 35C8H 4M6OH 3SGEI 4NQDB 2CRYA 3KPSB 2ED9A 2YFOA 3ET9F 2L4OA 3OLGA 3BPLB 3GTTA 2AXWA 3ZMRA 1J88A 4Z78A 1I1AC 2FYYB 5DEZA 1JV2B 3V5DB 2BOCB 2Q8AL 3Q5TA 1IC5L 2EEXA 4UQCA 4XNXL 4GG6F 1NAMA 1AIZA 4JPKL 3UJJH 3NJXA 5AYQA 3HRZB 3GNMH 3RZCD 2WXPA 2MNUA 1S9VA 1G7JB 4OKVA 1CDJA 4JDVB 1RURH 2GTWA 3WIIH 1OXYA 4NKQB 1YG9A 1RV6X 1LNUA 1JZFA 5JIPA 3V0JA 4FABH 3ILEA 1ZCRA 4X8XA 1LE5B 1HT6A 4E0RB 4YNYB 1J1XL 1MNNA 3ZTNH 3K71A 3ABGA 3GTVA 3ETBF 4A68A 3U1PA 1FFOB 2DQIH 3W0WD 2DI7A 2R0WH 2FWOB 3FB5A 3IJEB 5I15H 1ZVNA 1FZKB 1HH9B 2OPCA 1MVYA 4CVZA 3RTQC 2QKIB 1NANH 1QABA 1FCCA 1S7XA 3NN8A 1PYWA 2DLEA 4LSTH 2K45A 3R8QA 2FATL 1HL8A 3SKMA 3L3DB 2YD7A 2PPDA 4XOEA 2VIRA 3QUKA 3MCG1 4X4XA 5HHPA 5I75C 1UWGH 3WEMA 2HG5A 4PTTB 5EU6A 3O3BA 3RWFA 3KJ6H 1TZ8A 3KGSA 4RGMB 1Z5LB 2AXHA 4BZ1A 2KZKA 4IBYA 1D5RA 2HMIC 4HJGB 4TRPH 2EDHA 1WA0X 4G59C 3QDMD 5JQIB 1G7PB 2VN3A 4E5XB 1OM3H 3D09A 4BSVB 4LP8A 4QRTA 5GRJH 3FB6B 2BNQB 3S5LG 1P84J 3GMOB 3ESVF 4PP1D 2BRRL 3B43A 2AS5M 4ODHL 2TRHA 3RI5K 3ARBB 1F58L 3QI9C 2C8NA 4N8CH 3D12B 4MHHI 4A7QA 3QDHA 4KI5E 3EYUL 1BQHB 3HBPA 1R9FA 4XI5C 4KY2A 5JW3H 3IVKB 4PCSA 1SLUA 4FFYA 3NIFE 4OLVL 5D7LB 1D2PA 1I8IA 4PRPE 2UUDK 4E9SA 3SE4C 5E6IC 1NCAH 3ZDZB 1ORQB 5A2LH 1CDGA 2OJEA 3UJIH 4UQEA 1HHHB 1AXSB 3V6BR 3HRZA 4PJEF 4FQ1L 1JPFB 5TE4H 4V1DE 2UUDH 1AXIB 1FPTH 1AANA 3DVGB 1C12B 5FLVA 4APQB 3O3DA 2VDPB 1RIHL 1TDQA 2H1XA 3FFDB 4CU6A 2WBJD 3GIZH 2V7HB 4ENEC 2C9PA 4PYHA 1D5IH 2Z92A 2VERN 5ACZA 4LLQB 4WV1A 5LBSA 4KZDH 3AADB 1AYRA 5AQ0A 4Y8AA 2VW6A 3BQVA 3OKDA 3DV6A 1MXGA 2EIJB 3DX9B 3TTYA 2A6JB 1QPPA 1ZGLP 5D9SA 2R1YA 5E1IA 1T5WA 5TDNB 2P48B 3FTWA 2E9WA 1JPST 2NYYC 3BXNB 3QJHA 3OB8A 1MHHA 4RGOL 3UDWC 1ZA3B 2IJ0C 3B9DA 3KPMB 1J8RA 1KXTA 1J9SA 4TUKH 2XKNB 4I18A 2XYCA 5AKTA 3FQUA 4KQ3L 4PJEB 3ZE0E 3BI9X 4TUKL 4ZUSA 5DD5L 1RPQA 5FO9B 3V5KB 4MNQE 1GGYA 1SOSA 4WW2B 1IU1A 3BEVB 3MBEA 4RDQG 2XG5B 4X7TA 4RMUA 2AP2A 4XPFH 3UBXI 1U2CA 4M7LT 3BSZL 1IGCL 5HYSA 4LEOA 4OJDH 1ZVSA 3FT1A 3LH8A 3NQKA 4KVCL 5C0FB 3VXTA 1PMYA 5SWSD 3PGCB 1RPUA 1IGTA 4WFFE 2OTUA 5EULV 3N85H 4Y4HA 2B9AA 2AW2A 2ZWZA 5EEXA 2Z4TA 3FU6A 4AQ8A 1GL4B 3EHBB 5C7XL 2P7TB 2E86A 2YQBA 4X4ME 4Y88A 1PG7L 5DJXB 2H3NA 3R7QA 1E30A 4PR5B 3TIDA 5DWPA 2FZ3A 2UXTA 4DP9X 4JW3A 1TQWA 1UWYA 5EU6B 5I26A 5TQ2L 3U4EB 4Q4EA 2NCEA 1GS6X 2NZ9D 1Q1PA 1UH2A 5LAXA 1W16A 1J7VR 4JFUA 3WD5L 3TBBA 3P3TA 4MDJB 3NSJA 1IBFA 4RGND 3T8VA 2DWDB 5J4MA 3VM7A 3DVNB 3CZJA 4RISH 3Q05A 2DQUL 1AGBB 3R4DA 1P4LA 3JV0A 4QAWA 4RNRA 3ZYOA 1IGTB 5DTFB 2ZWKA 4M7JH 1KIQB 3H2PA 3W2DH 5JZ7C 4UT9A 1JBJA 1MAKA 4BK5A 3EO0B 4BK4A 5L4FA 5T3XE 1ZS8A 5C0FA 5HHNA 3TC9A 1CT8A 5GS1A 1FPTL 4EDXA 3BP6A 3IKCA 4R8WH 5AW2B 2IADA 2BZDA 1EHKB 4ZMZA 5CLYA 4R5XA 4F91B 4HD9A 4YSRA 3UYRL 3D05A 3D4CA 1U91A 4NM4H 4UQ3B 3S37H 3HUJA 3V6FA 3JWOL 3V6OE 1A3LL 5D70L 3BGAA 2QSTA 3KPRA 4Z95H 3KPMA 2CHZA 3QFJB 3F64A 3VFMB 1FIGH 3C60A 4HCRH 4P3DA 4Z3EA 1AKJA 1CFQB 4ZFGH 2HTKC 2WN2A 4ZMLA 4B7LA 5E1QA 2WIIA 1M6OA 1PEWA 1PZUB 3FO2B 1XGUB 4S0HA 1OD9A 1A9EA 1JWMB 2EXWC 3P30L 3PRZA 4TNEA 5DD1H 1GZHC 2AK4E 3IRCA 5T3ZD 2NY2C 3EIFA 4MA8L 3HNTL 4WUUB 1SDDB 2XOTA 4YFEA 3MNWA 4QGTA 1HHJA 4CU8A 5D1XE 1CK0H 2F74B 5CJQL 5IJVA 3C5ZC 1MWAH 3K5RA 3FOMB 2DI8A 4KUZH 4QXUL 3CFKA 5DJCB 4F9PA 1DBMH 4IK6A 3WFBH 3L4XA 2J6EA 3P3RA 3VQMA 3RZCA 2N7BA 5IMMB 4KRLB 2XICA 3A6BL 1F3JB 2CBTA 1NFKA 1KMGA 2VC2H 2UY7A 2NY3B 3O9WA 1F4YH 3EBGA 3PHAA 3ROLA 5C07D 3D50A 1WAAE 2JNZA 5HGBB 5FK9A 1MHPH 4C8XA 5F1KC 3D52A 4I3SL 1E0OB 4QHUB 3UCRA 1YEKH 4KMTH 5IUCA 1JNLL 1BEXA 1KCUL 3FRUB 3RAJL 4LLWB 3GZQA 3S34H 2XVKA 2DOCA 2R4SH 3EH1A 4GAAA 3NFSH 1SOQA 3C9NA 1E9QA 1MUJA 2VSMB 3BFWA 4UZGA 3U7AA 2R8SL 3L4UA 5D7LD 4P4KB 2BH0A 2K6YA 1DQIA 3HPLA 3W38A 4EI5B 5DZ9A 3FB6A 4XVSL 4DN4H 4BSVA 1JGDB 1FORH 3NJHA 3H9SD 5CJXA 3V4PH 5C6TH 4XXCC 4NNYB 1PIGA 2WXQA 2OZ4A 3ULVH 2ZOUA 1XIWC 4GO6B 3QNFA 3BKYH 3VXUD 4KKLC 4PJ7B 4WDIB 4CN1A 2JCWA 4EIBA 4Y4KD 2TAAA 4B9YA 5KS9F 1NBZA 2NY1D 5KN5A 4FNUA 4ZUVA 1MLBA 3SDCC 3FSWA 3CFUA 1XH3A 3LX9A 1SEQH 3LTVA 4K7FA 1GAFL 3LKQA 1MG2C 3T2QA 2VDKL 2YEVB 4PRAA 4P2OC 4TPRL 1CXEA 4UCFA 5EZJA 3SKMB 3E8UL 3B1TA 3VRJB 4G6KH 2IFGA 4F80A 5EH1A 3CTTA 1TO4A 4PJGA 1RJCA 1A2YB 2WNKA 1YDPA 4TUUA 1ADWA 4XPAL 4HWEH 3W81A 4L9LA 4YK4B 5TJWK 5AB9A 1YQVH 1U8QA 4DT2A 1GC1C 5A6MA 3MMEB 1LE5A 1EAPB 1QBLL 4M6NL 5IROA 3B9KB 4AEIL 4AEEA 1VESA 1DO6A 4W9IC 5GRXG 3OM3B 4I0CC 1O7SA 2WQAA 1W8EA 4OZ4A 2ZSWA 3QORC 4PRBB 1G7JA 4HYTB 4KGLA 3THML 2CH8A 1CYWA 4LEBA 1EZVX 1NAMB 2OSXA 4HISA 3SDYL 3HS0C 5AZEH 4ZMPA 4JGUA 1OGSA 2WB1A 5CJ8A 3VD7A 2VH5H 3QEQA 4NO3B 4UTAH 5GGRA 2YRBA 5DMIL 2R39A 3U4BL 1G9HA 1DVFA 2FE0A 5A6LA 1YEEL 4YL9A 3VJ6A 1I82A 3KVPA 4WV1C 3ULUE 5I2IA 3CLWA 4PRHB 4F8NA 3DOIA 5ICYB 4MGXA 3TWYA 32C2B 3NH7L 1RK0A 3EOTL 2Z1KA 3RY6A 4AL8H 3O11B 3V7MA 2Z7YA 3ZUCA 5CMAA 3VRLE 3D25A 4HH9B 3ARDC 3IJYA 5GZOD 2IDTA 5E6ID 4ONFH 4ALAL 1B0GA 2UWEF 3B5TA 1IAIL 5CGYD 4ZUUB 3ATFA 2E8YA 1LO3L 1JNJA 3SCMD 4FFVD 1EAOA 4GRWE 1XF5B 1HEZA 1FAIH 1XCXA 4F7PB 1LEGB 2VMCA 1G7QB 1N8ZB 2B5IC 4RDBA 4N2LA 2SODB 3ZR5A 1TFPA 3BPOC 4LKCA 3FQ4A 2I69A 3FH5A 3AXLA 4OLUH 4DW2L 2VDRL 5K9JH 2GFBA 4AK1A 3GS4A 2NY3C 2OTWB 4Z7QE 2X3CA 4GP5B 4X4YA 4NT6A 2YXMA 1IEBB 4JRXA 1DBKL 2IV8A 5GGRY 3O4LA 4D0CA 5EDSA 1N4XL 4CL7A 4YSTA 5I6OA 2BDNH 5DMKB 4XXDA 2WINA 1E4XI 5F7YC 2OXGB 4RRPA 3DTUB 3RIAK 3WMSA 4HWZB 5DZPA 1F42A 3KWXA 5EN3A 3IMVA 5IQMA 1NDMA 4U7KA 3WXWH 4EF3A 1DVTA 1SN0A 1J8HD 4A67A 5E5MA 5EO1A 2WNWA 2J88L 1G7LA 2IFFH 1MJ7L 3FUFA 2FQFA 2CK2A 2VLKA 3VXNB 1ZK5A 3OKYA 5GPRA 1YZZA 2FWUA 3BT2H 5E9NA 3GKZA 1E9PA 2QTEA 3BGFB 1CGVA 4O58H 1SRDA 4XVJL 4ZQKA 3QFDB 5K9OA 5AZ2L 4H44C 4YFLI 1WBZA 5CLZA 5ESQB 3HHSB 2HZHA 1NGPL 4GXFA 5DI8A 1KB5L 3SDCB 3P4LA 5CGTA 1T5KA 3AGWA 3SQRA 3FUNA 2VDOH 5ESQA 3I9GL 1LWJA 2GT9B 3GI8H 3UGUA 1YN7A 1WEJH 3B7YA 4QOKE 3NK4A 1KLGA 4KNUA 2BSBA 4F7MB 2VLRA 2BNUA 3KPTA 5E8DH 1A4JA 4HJ1A 3DSFH 1DEDA 2YLKA 4N5EC 1B2WL 2ZAHA 1KJ3L 1WICA 3UPCA 3D06A 3EUUA 3KLAB 3TVMD 1J9TA 1T2QL 1UXLA 1VEMA 4IRSB 4YGVB 3WJJC 1MCSA 2D9CA 4JHUA 3GSNB 3HC3L 4E5XG 5LGKA 3E3QC 2CALA 3EYSL 1OP9A 5D5MB 5MEOB 1GOGA 3BLPX 1CLYH 4NRXB 5F7AA 4EI5C 1JGIA 1NIEA 1KCSL 3NZUA 1TCRB 4LOFA 3QUZD 2BFVH 3Q6GH 3BVTA 1WUNT 1Z3GL 4LNVA 2AQ1A 1CBVL 1S5IH 3CX5K 3IXTB 3C6LC 3V0IA 3Q6GL 4HVBA 3BWUF 5D6CA 4XO4A 4ZD3H 3HMXA 2OMZB 4PGBB 4MA3A 2D9QB 3LZLA 2A74A 4M7LH 4P23D 1M6UA 4WGKA 3RWGB 1ZY9A 4JGJA 3US1A 3BVVA 4PS4L 3FQRB 5SWZE 2HX7A 2ROXA 3SKOB 3TONA 3QEQE 5LHDA 3OHXB 4EPSA 2EEDA 4DGVH 1A22B 2Y3NA 5CEXA 1ERNA 4OLUL 2VLLA 3CV5A 4JL1A 2EDWA 4P2OB 2WYIA 1PG7H 4GO8A 3PP3H 1J0ZA 1CDBA 3CFTA 43CAA 2F7OA 4PRHE 2Q87A 3VH8G 4LIQH 5JQHC 4Y5XC 3NPSC 3REWB 2J1XA 2HRHA 1T2XA 2F5AH 1N4XH 2X89A 1D5IL 2E7CA 3QUYB 5AOMA 4E9YA 5IVNA 2FBJL 2AK1L 3CFCL 2O6EA 3K2UH 1L7TL 4HQQL 5I8OH 2XWCA 1RUQH 2PPAA 4MASA 4O9HL 3LRGA 1IGIL 1XR8B 1RSFA 1WO2A 3PWJB 1KGUA 3U9PL 3L1GA 3UBFA 3RWJB 4P2RE 5H35B 3KJ4B 2I32A 1BLNB 1WA1X 4QHNB 3PCYA 1E6JH 2D7QA 2CKNA 32C2A 3P73A 4KJPC 5I19L 3RBSA 3PXLA 4G42B 2DKSA 4J3OG 4PWIA 4X4KA 2GUYA 4ANWA 4M29A 5E9AA 5DD5H 2BC4B 5EFIB 1TLKA 2R29H 3CHOA 3TM6A 4QT5A 1F56A 1SJXA 3F58L 3LB6D 3FCTA 3SSGA 1NH6A 2AAAA 4FAAB 3VXQB 2VLJB 3DK0A 4Y4HC 5CZXD 2F5BL 1A3LH 5D70H 4U1HA 5F88B 1IKFL 1K2DA 12E8H 3CHRA 5T1KD 5I74C 3AM8A 1EEZA 2DQCH 2DMKA 4FN0A 2EDTA 2CMRL 2H7WA 1NAKH 2P5EB 1CD9B 2N56A 3WMQA 1HOCA 3K2MC 2WKLA 2X40A 2FD6L 3WFCH 1K85A 3RWCB 4HUNB 3ELAT 3SYQA 3GS7A 3DIFB 2FD6H 5LJYH 5T3ZH 1CDYA 2NY5C 4OCNC 1UD4A 3JTTB 4RMQA 3U46B 2Y07H 5EUOA 1AQKH 4Q97A 1RK7A 3KNBB 3VXMD 2K7PA 3UBXG 4MMZA 1UD5A 2YUZA 3K6SB 5E0FA 3BE1L 2ADJA 4MAYA 1S5IL 2E6JA 4UT7L 4IOFC 1B2YA 5AW4B 2BJML 1KFGA 3BKCH 3TV3L 4NKDA 1MFEH 2WMPA 3IJSA 1N5YL 2JIXD 5IHZA 1F4YL 3MDJA 3MRCA 5A2JH 2G2RA 4HUWB 4QJ4B 4YAQA 3HG1B 1HVXA 1WCBA 3QRFM 4HIIB 3SHSA 2NYYD 3VTTA 3ZE1E 5KJRH 3PP4L 5GGSB 2WAHA 1L0XA 3PQYE 2GG1A 4LK4A 4NRYA 4OY9A 4AZ8B 1JDDA 1L9TA 3AWGA 3GRBA 3IDUA 4FI6A 4KJQD 2UZIL 2ZWNA 4RGOH 2CIIA 1DBAH 1M7UA 3LVEA 3GLAA 3S3DB 3RGBA 5GRVL 1SYVA 4OI8A 2VKXA 1K2DB 2D3LA 1J5HA 2ZIDA 1E5BA 4PJCF 1TTUA 2GIMA 1SY6L 2PTUA 3SQOH 4EBQL 4KO5A 4OV5B 3QZWB 3PAUA 4I0PA 1T6BX 4KHXH 2DIJA 1FIGL 2K0RA 5CHNB 1VEOA 5FA4A 4X4YB 1I7RA 4XBGB 1M1SA 1K8IA 2VWEC 2EYTB 3UTSD 3GMPA 3L16A 3GGWB 1AO7D 2L8AA 4OZHB 3UTTE 1DQJA 5J13C 3BWAB 4PJCA 1GZPB 4XPHH 2WLLA 4K4KA 4RMBA 1OPOA 3O2DL 2UZYB 1I7TA 1R4XA 1BXUA 4XPHL 1SEQL 1KYFA 4FMFA 1I4FB 4HWBL 4ZW6A 1MIEH 1SMAA 4H0HB 5C0AB 4HDIA 3D08A 4S1DD 5KVEE 4N2HA 4KK9D 1J05A 4W4OA 1LP9E 2NX5B 4PJIF 5E4AA 3LNFA 4XPBL 4PLKD 5EU4B 1N68A 4HOWA 4OVVA 5DA0B 3SCMC 4F8QA 4Q9CA 4IBSA 4MMXA 2NZ1A 1IT9L 5F9DC 1C7SA 2AJYH 5CGYC 2DEXX 1OZTG 4DO6A 4IRSD 4MZ3A 1A21A 1Q72H 1YEJH 3GXUB 1OSZB 5L4MA 3ARFC 5KAQF 5CBEB 2NY5L 4RAHA 4I13B 1Q0XL 2A77L 5F7LB 1UEMA 3GKWL 4Z7NF 1T83A 5E9DA 2ICEA 5DJ2B 1NFDB 3V4VH 2VLRD 1TJIH 3VWJD 4L4VB 4MA3B 2DYPB 2H6OA 4G1MB 1PDKB 1E3ZA 1Q90A 3BDXA 3HUJB 1L7IL 2FH6A 2HYMA 5E24E 1S9KC 3CXHJ 5I8EB 4LEXH 1OT2A 1T6WA 2WBKA 3JXAA 5DRZA 5A1AA 2CIIB 1R3LB 1XSJA 3V4PL 1J5CA 4MMYA 3FTVA 1LLAA 2DDQL 3L1FA 4NRXA 4NZ8A 4OGAC 4PI2A 3MRLB 5EBLB 3OKKA 3SYPA 3NCYP 1DQDH 1JDCA 1MQKH 2BNRE 5FM5O 1OHZA 1RZIA 4G6ML 1YDPB 4JG0L 3RNQA 3UEZA 3PWUB 1ZXQA 1KIQA 3ZYJA 3BVNB 3AACA 3MJ9H 3CSBA 4LVNC 5FYJH 4CILA 4BFJA 1U21A 1DDHA 3KD4A 3KXFD 3K6IA 5DJ0B 1BQLL 3EJRA 1IMHC 3GMRA 3TWCH 4ZNCD 2FUQA 2HRGA 3LRSB 4FNPA 5F3BA 2J1WA 3ARWA 3CDCA 1FDLH 1L4IA 3SDDA 3ZT5A 2ZUWA 4R4BA 4X8JB 3BUBA 2V37A 3QFDA 1TQBC 3TEXA 1B9ZA 3DUUA 4FQLL 4PG2A 1KTLA 1FO0B 1OGPA 5DHXB 5ADOL 4CMMA 4QCIB 3IMWA 3S5LB 4AI7A 1IV8A 3V2AR 1NC4A 5JOEA 2ZCKH 4PJCE 4HMCA 3RL2A 4Z7VF 1CE6A 3V4UL 4NLHA 1I3UA 5E2TL 5MEPB 4JDTL 4AV0A 1QSEA 1UXWB 2WZAA 5IVXB 3TFKC 4XR8C 1OTSD 4NCC1 5JXEA 2IG2H 4EI5A 1TMQA 5F1OB 4NGHH 4F15B 2JIXB 4LLYA 3TIEB 1FVEA 1U9KA 3KE0A 5CCKL 3H0TA 1R5VA 2VAAA 4XB8A 3QIWD 3HG1D 4PLJC 5CCKH 1LWHA 2OL3L 5HDBF 2RALA 5T1KB 3DSNB 3E38A 3QYCA 3C5JB 1MPAL 1KGWA 2Z91A 3QO1B 4M00A 3VNYA 4TQPA 1AZCA 4Y4FC 5CCHE 1JMXA 4YX2L 3OKEA 3DETD 2AQNA 2P5ED 4WFHE 3RJQB 3N0PB 4WWOA 4ZUSB 5MP6L 3D39B 1RJYA 1SM3H 1U93B 2R56H 1HCZA 1MF2L 2J88H 4JG9A 2XKNA 1GGBL 5DZNA 3MV7A 2OI9C 3AU0A 3ISYA 2P8LA 2CJUH 4B6ZA 3WN5A 1EO8H 4XNAA 2AABH 1EXUB 5I75B 1ZHKA 3AXLB 4G6FB 4LU5H 4UT9H 5BRQA 1BM3H 4YPGB 3HG4A 4NN5C 5IMMA 1JHKL 4Q0XL 4FULA 4YHPA 4Q9RH 4R4FL 5J13B 3MREB 1UJTA 2ZXAA 2RMNA 1AI1H 1Q8MA 2WTRB 4P5MB 3L17A 4EAEA 1GAFH 4KKAD 4I0KA 3JUYA 3EFOA 4IRZL 4D3CL 3AS1A 2HA1A 5JLZA 3UBXA 1V7NH 3UTPD 1ORSA 1PVHA 1SDDA 1JS4A 2ESVA 4Y16C 1A25A 3MRQB 1JK9B 2C4FU 1HC1A 5HDBB 4FDWA 1WK0A 1IL1A 1F1DA 1RHFA 2XZZA 4X5XA 3T6QC 1AO7A 5F0JB 4Z7VA 3TH2T 3KPSD 2CO4A 5T3XL 2EE3A 1V10A 1CURA 5ICYA 1BZEA 1SVBA 2G2PA 2HXAA 1YPZE 2ZJSH 3OHXA 5AW0B 3ZDZE 5C8JA 3V9CA 2WQRA 4PJBF 4AJWA 3D0LA 4CN6A 1K5WA 2PWEA 3NQIA 1BVLA 2ZJSL 2Y36L 3CHXA 2YJQA 1ECZA 2WV3A 1H9DA 1A7NH 3DIVA 3AY4A 4HCIA 4HF5H 4U1SB 1UYWH 2VOTA 1B0RA 5I8CB 4JPKH 2FSEA 4PJFB 4WGVB 3KL3A 1F6FB 3ECVA 4FXKC 4JDZB 4JQIL 4O2CB 4PH8A 2V5SA 1W8NA 4JHWH 5EU3B 2X4SB 4ZYKB 3RX7A 4ZMYA 5A2IH 3L9YA 3L6FB 5CR8A 2QHRL 5LWYH 1S5HA 1NSNH 3QDGA 4BWUA 5DT1L 4F57L 4Z0XB 4IRSA 1DLHB 6FABL 4G83A 4ZFZB 1BOYA 3CLFL 1NGZA 3KR3H 4YMPA 3N91A 2X4NA 4N2FA 3LNIA 1E8XA 2VLRB 2XC8A 1QP1A 3SO3C 3SJVB 3CVHB 4C83A 2H5UA 4L9LB 4NFBA 4JRLA 1KYAA 1NGYB 3GJEA 3MBWB 2MH4A 1K5NB 5ALCH 5DJZB 3TTSA 3QCVL 3S3SA 3DTDA 4YS4A 1P5VB 1XGRA 3OZ9H 1KIPA 1ZWIB 2CHXA 1RZPA 4K3DL 2C9UA 4PR5A 1JAEA 2AI0H 1QEWA 2HKAA 4RRPG 3MOBL 5FIEA 3OAYH 1MVUA 4JPVL 3RB7A 1G7MA 4Y4HB 2H9GA 1MFVA 2IAMB 4MD0B 4BQ8A 1MFBH 3BD3A 2JK5A 1Z9LA 3BQUD 5F7DA 1S7UB 5K9QG 3SEPA 1KB9J 4H20H 2PETA 3W0WB 5E51A 2DZEA 3KXFA 1F97A 2IIJA 5FUOL 5ETUA 1QRNA 1S3KL 2B14A 4KI5F 4L9DA 4PJHE 3DLQR 1TEGA 1DQTA 1V7MH 4FA7B 2YXVA 3BEVA 3KJ4C 4L5FH 2FGWL 4TM9A 1DUYB 3SOBL 1FAIL 3CJJA 3NFNA 4Z0BH 4G9FD 1NMCB 1IAKB 3RU8H 1KIUA 43C9A 1ET7A 5JHDA 4BH7A 4KV5F 1SY6A 4TRPL 4QUOA 5HVHC 4JE4B 1NCAL 4P07A 3U9UB 4UYPA 3WFCL 2XKUA 4RH4A 4OCYL 3S35X 2J8UF 4A55A 2ZYRA 3KPOB 2D4DA 3WAKA 1RZKH 3BESR 4P8QA 5F7BA 5B3JF 2ADYA 3OC5A 1FGVL 5D7IB 4AIXA 5JXED 1A1MB 2R4RL 4F8TA 3DMMA 2IAND 1N3NA 4WFGD 1A0QH 3SDAD 2F5AL 1CYXA 3TBTA 1YY9C 2ICWA 2PYFB 1QA9A 2DQ6A 4FZEL 4C56E 3EZJB 3FH8A 4CW1B 4JPQA 1X4XA 1GSKA 3VXMA 4DK5A 1J1PL 2F54B 2GKIA 3EDFA 5D7JC 2UVEA 3I6GA 3UGEA 3D18A 1B4RA 4I5BA 5FW8A 2F54A 3FQXA 2NNFA 4XP5H 1T66D 1EBPA 4UIMB 5KVDL 3BD5A 1IBDA 1YMMD 3GSNL 3O8XB 3PP4H 4FCAA 3OL2A 4XN4A 4XN2A 1IKNA 5SX5H 3VWKA 3G7TA 2YK1H 4DGIH 5HYEA 4J4PC 4JFOA 2R0WL 4JLRA 4BFKA 1BIHA 3IBEA 3BT0A 3T1FB 4Y0GA 4G8GD 2WXMA 1FIEA 1MCEA 1WDAA 4MJJA 2OXHB 3QJOA 4J6IA 5FLUA 4NKIL 5CFHA 2ERJB 2YPLA 3P0YL 4LSRH 4UQBA 2DLGA 4QHMA 2FATH 4U0RB 1KCSH 3VFPB 3LXCA 4KHTH 2V9RA 3HN5A 2WXKA 1A4BA 1CTMA 1FE8L 1AG0A 4XPTL 3RL1B 1QHQA 1U91B 3BMWA 3NSYA 1CD1A 5INCB 4GKNA 4Q6YA 3QG6A 4ZO8A 1O6TA 1MAJA 4R97B 2IADB 1UWEL 1YYCA 3C2AH 4CJ0A 1KN2H 2X2JA 4UM8B 5HJBA 4MA7H 1I7UA 4IKIA 3P9MB 1WGVA 1A6VL 2LV4A 4LNRB 5IESH 3VX1A 1A2YA 5DQDH 4L4TD 4KQ3H 2Q3XA 4KX8A 4W81A 5B38B 2XN9E 5I6PA 3CHPA 4OSUL 4AH2B 1TO5A 3VCLA 1AH1A 4NJ9H 2HT3D 3KDMB 5DUPH 2JKSA 2G5UA 4LRNL 4PHZA 1MFEL 4PGCA 3MRJB 2Q8BL 5KANG 3NCJH 1H3TA 1OTSC 1AD9A 4M48L 1FZJB 4X6FB 3M7OA 4UNVA 1Z0NA 4WWKB 8CGTA 3VSUA 2IH3B 4LPXA 5KYWB 4Y2DC 5I1CH 2WZPD 1J9RA 1JHTA 4O2EB 3AU1B 1A5FH 2Y7OA 2XVGA 2AV1B 2R83A 4GMTH 4E42A 4GAJL 3BZEB 1EAQA 1T04A 1U8HA 2J43A 3MV9E 3TYGH 3MR9B 3O4OC 4BHUI 1TJHH 2CCVA 2O61A 4PS8A 4CMHC 3D87B 3TA3A 2MQ0A 2ODHA 5FECB 3H3KA 1JPSL 5HYSG 2A6IA 2VN7A 2AK1H 3K2UL 4LGPB 4J3OC 1A66A 1QBBA 4ZPVA 4NOBA 1AHWA 3VXME 1FYTB 5AUMB 3C9NB 3SQOL 4LCYA 2W88A 3A6CH 3W9EB 4EBQH 1JI2A 3PJSA 2W65B 3R06B 3CBRA 3T1WA 4P5TA 4L0ZA 1XIWB 3BQUB 4DKEH 5ITFB 4Z18A 2MCAA 1GOHA 2VM4A 4YHKL 2NXYC 2MHAA 1YECL 4LCWD 3C6LA 3QZBA 3GXPA 3OAUL 1T7VA 2PYEE 3FQUB 1QLEL 2VYRE 5F1IA 4WO4A 3S4SB 1AQDA 2OMBA 4NQEB 2G0LA 1EBAA 1QLEH 3E8VA 1P7QD 5FDYA 4BGLA 2VZVA 3T65A 3BWUC 4XHJC 4BHUA 1H3GA 3NP3A 4QRPA 3C8KB 5E1AB 5IEHA 2IPKB 5IROC 5HJDA 1RI8A 5C2UB 1OAXL 2FIKA 4PUBL 5TK4A 5K1NA 4ATTA 3WKNA 3GLEA 4ODWB 2E9BA 4UOW0 2PR9A 3KHQA 1NCGA 1U3HB 4B9JA 3IDNA 2E76C 1GS7A 2JF1A 1RUAH 4MQ7B 2MKWA 2O30A 4QRRB 3R19A 1YNKH 2FECI 3CVIH 1U3HA 4BSJA 4I2XE 2CO2A 2ZCLH 3QSKB 4AC4A 3GI9L 3I84A 1MCRA 2CR3A 4PQXA 5HVGB 5TQ0H 1A6TA 1PLBA 2C3HA 3CBJB 2IPKA 5IBTH 7FABH 3TJHC 2WIIB 4FQJL 2ICCA 2IWKA 2XN0A 2RQEA 4ABUA 4EZLA 2OR9H 2BOBA 1CICD 2XWDA 1FLRH 2AZUA 2IGTA 3A4DA 4ZFOA 1N10A 3WN5B 1XTLA 3HC4H 2CCWA 4ERSL 2OJEB 1M3JA 1JNHA 1SHMA 5DYOB 4QGYA 4IOIB 1OZUA 2QADC 3QQ4B 5ITFA 2BRQA 3F04A 5BO1H 3I85A 5I1KL 1EWHA 5IB2B 3SPVB 1WZKA 2XV6B 1A8JH 1S7SA 2MOGA 2GIYA 3WD5H 4DFHA 5GZOC 4NQEE 3GSRB 1UUSA 5HHNB 2ARJB 2CM6A 3QXTA 3AM8C 1QRND 1SUHA 3CMOL 1F0LA 4OF0A 1AHWC 5ALBL 3VG9B 4IW4C 1BZ8A 4ORZC 1XF2A 2CCLA 4KO9A 4GBXC 4MD0A 2H9GB 1WJ3A 4UNIA 1KYOJ 4JMXA 4F9LC 2UXVA 5C07B 4O2FA 1IBYA 3GM8A 4G9DA 3X14A 1Q9WB 3ZKNC 1GZQA 3KPQB 1MWAA 1VB9A 2B1OA 3SGJA 2SEBA 3GBNH 1K4DA 1IEHA 3IU3B 4Y5YB 3N6YA 3RWFB 2ZTBA 1LO4H 3AB0B 2ZE0A 4KUCF 4QHPA 3MJ9A 4NZDA 3L3GA 3FCGA 5BZWA 3F6LA 1K5NA 3UTQB 1O7VA 4XOBA 3NAAL 5CEZD 1DTUA 5AL8A 3HZVA 4PJ5A 4DP2X 1SXCA 1IT9H 4AQZA 1UOKA 1JK8B 5JPNA 4ZMNA 5ECGA 2ZWSA 2V2TB 2IH8A 4C55A 1TFHA 2QSVA 5FPIA 5J1TC 1EXGA 1T1WB 1OP5K 1B3JA 5CWSB 4BUGA 5JOFA 4GKNB 1RZIB 1ZTXL 3VXTB 1OB1B 5C0CD 4N87A 3L13A 2GJ6A 2DQHH 2HJFA 3QFJE 4KTYA 2BM3A 1ZS2A 4ONHA 4QY8A 3ZL4L 4GW5B 2CBMA 2H47C 3EJSA 1DANU 4M3JA 4X99A 5D1ZC 1H0DB 2QSQA 4BQ9A 1HKFA 1Y07A 5GGVY 4N2NA 1GGBH 4P57B 2DQUH 2WQSA 2FX7L 3MJ7B 5IMLB 2DH2A 3O8XA 2OMYA 2W95A 4Y9FA 3GJFK 2V5MA 4W4OC 1OB0A 2WVUA 2MCMA 4HPHA 4Y16B 5BJTB 2D7OA 1AC0A 2Y72A 3VXSA 1P9MA 4X2UA 3T1FA 1J12A 2Z1PA 1J18A 4H0GA 4WI3A 3TZVA 1U0QA 1XIWD 1URZA 4MJHA 1BD2A 3DC0A 5IR1A 1CS6A 4LLQA 5CGMA 1KBBA 4GRLC 2H1LM 1MFAL 4AYBA 4BEIA 1T22A 4EI0A 3D18B 2BX5A 1XF1A 5KS9E 4WWKD 4OFIA 3QAQA 4YBQC 3TT1H 4M6ML 4YHPB 4QTIH 2MEJB 2EZ0C 2GSGA 5HGDB 4G6MH 1IKNC 1MFBL 3LQZA 5FFLA 4NP4H 2EECA 2GI0A 3VFNB 2W0KA 3RY4A 3OR7A 3O0RH 1U6AL 4XNUH 4OIFA 4CC4A 1RULH 4CNIA 4AW4A 3AY2A 3RTLA 1E4KA 4L2YA 5GGUA 4DCQA 1HFUA 2VLKD 4Z8FH 1T1YB 2JTYA 3LPWA 1RZFH 1FBIH 3FFCE 5CSZA 3SE8H 5C3IA 4F58L 1A6ZB 1V7ML 3K4AA 5HYFA 4PRHD 4XMUA 5FA4B 3PJSB 2JLLA 3ALPA 5D5MF 4MNHA 4QD2E 1DCLA 3H8NA 3C6SB 2Z31C 4M56A 3S9DB 4BM7A 1ZHBA 3ARBD 4IU2A 4MRBA 3MRRA 1EPFA 4QLRA 3I6KA 2XJKA 1JWUB 2DI9A 1L0PA 1XL6A 1E2VA 4TQ8A 3C5ZD 1P4IL 1C9SA 5F97E 3K91A 4N28A 4KK5D 4LKXB 1IUZA 3TO4D 1EHNA 2DB8A 2P5WD 3D85D 5IBLC 3VGAB 1WQVT 3IETA 4P23C 3F84A 2JK5B 3WLBB 2HJLB 3FTGA 4X6DA 5I18L 3NJNA 2C4XA 3Q9QA 3QIWB 2QLVB 4A7TA 2J25A 4GAYB 4PGCB 2WLHA 2G2RB 1P4UA 3MLTA 4L3FA 1Y0LA 4NM8H 1XZWA 4MZIA 1WITA 1RLBA 4JPSA 1SXAA 4ZX3A 3SPJA 4QNPF 2RGSA 2JJWA 3BGFC 4YHLH 3ZO9A 3UJTL 1I9IH 4A2EA 5DJZA 2QKIA 4DPAX 4IRJD 4GG6B 2YGNA 5CBAB 2OULB 3BW9B 1KELL 1KDIA 2J5WA 4L1SA 5BOPA 1I7UB 3FT2A 4OQTA 4XN7A 5K9KB 2XV0A 2MQGA 3EFDL 5I1DB 4PY7B 1S7RA 2HFTA 4EKJA 3E6HA 3TO2B 1BD2E 2VERA 4AXWB 3NEEA 1KEGH 3LPFA 4Z0XA 3MA9H 4MCZA 4M61A 2FJGA 4OBRA 4QRPD 3BDYL 3GXIA 4FQCL 5JTWA 1U92A 3JWDC 3MLVH 3MRPB 4GUPA 3PIQB 3L6FA 1S7WA 2ICES 3JTSB 3P77B 3QCTH 5FKAB 3RVTC 5KVGH 4XP4L 1JGVH 2K70A 4AIOA 3QCTL 1UWEH 3C2AL 4RDQF 5C8JB 1BQKA 1QFUH 4ENED 5I6XC 2PXYD 2ERJC 3UTOA 1FV1B 3G5VB 2EVHA 2DMGA 1OL0A 3VWKB 3HZ3A 4XHQA 4CA4A 2E5EA 5J12C 4PIRF 5HVFB 5JW4R 4JM2D 2AV7A 1FZMA 1YEHH 2ZKHL 4ZAKD 4P9HL 3TASA 1ROCA 4G7RB 1BZOA 2ZOTA 1OWRM 2HKHL 1T4KA 2YUXA 1CLCA 3K72B 4ILDA 5J1AA 4Z3IA 1DVYA 5CN3A 5FF6A 5FYLH 2ICWB 2HN7A 2PYFA 3L54A 4DAGH 5KS9A 1FNSL 3IGLA 1J11A 3NTCL 1AG6A 2APWA 2F15A 4FXGC 5EIIG 4Z7QB 4APQC 3MLUL 3QIBD 4OD3L 5DJYA 4N0UB 4ODVL 1KEMH 3IAQA 2DH3A 5HHMB 2COQA 4X6DE 3VQLA 2R23B 3TBSB 3QO1A 1BECA 4KVPA 4ZRGA 2ENSA 3W3BA 2I5YH 4FMVA 3MNMA 4ZJ9A 4D2NA 4DOHE 5GS0L 2BIMA 8FABA 1HIMH 5HY9B 2BXYA 5T1KA 3PWVA 3RWIA 2VE6B 5C0RL 1QSEB 1UXWA 1MI5B 1IBZA 4YO0B 1HXYB 3A23A 2H1PH 5T33H 3KJ6L 3WUWA 3O3AA 1WEJL 3T6XA 1FVEB 3OXRA 1DFBL 1MFDL 3VXPB 2JQMA 4Y16D 3K6NA 3VH8A 3K6OA 4JFEE 1KJ2H 1EIBA 1PX8A 4ANKA 2UVFA 4PEEA 4IBLT 2OR7A 5HYJA 4JZJB 4NJAL 3Q8AA 1NGQL 4XAWH 2AJ3B 4LMQI 1P7QA 1EZLA 4YXHL 5IVZB 2J6EL 3DRTA 4JZOB 3WEBA 2OMUB 2K6WA 4OCMC 1CPUA 5D93C 4NKDB 3WEAA 1IGYA 2I25N 3N42F 1XXFC 4QRAA 2E46A 4WWNA 5IB3A 1DEEB 4EUPB 3TJEH 4JFDA 4WO0A 1ACYL 3I3EA 4N20A 1DSYA 2GC7C 2P5WB 3DA0A 4HXBL 3GJEB 1WBZB 1EHLH 1YVLA 2QKIC 5EUOB 1JGVL 3ARFB 2FLMA 3NCXA 3BVDB 1JFQL 4KKBC 3SJVA 1GXEA 4N2GA 1K9TA 1OF2A 2FLRT 4HIJA 3FRPB 3SY6A 1FGNL 5F3FA 4Z77A 3BIAX 3FUEA 3DGGB 4PD4K 1U8LA 4Z3FA 1INDL 2VLKB 1CLZH 1IRAY 1SBBA 3MZGB 3LV3A 4HZAA 1PDKA 1S5HB 3HC2A 3S4SG 4PWGA 1A6UL 4QI3A 1I1CA 4PWFA 1JZJA 4LT7A 5I16B 1WAAF 4P49A 4PS7A 4O4YH 4Y2DD 2CRIA 1NFDA 3QQNA 2OX5B 2QQKH 4YSAA 2X6BA 1XSIA 2YPVL 5AG9A 3VXRB 2A3TA 4FS0A 4OFPA 2ITFA 4AY0A 5JDJA 3O8XD 4FFYL 1UFUA 3IWUA 1V55B 3IJ8A 3IMTA 4KV5E 3I9GH 2GTQA 5C0EA 1U8KB 3O3UN 3HRZC 4PBDA 3ZX1A 5DJAB 4A7SA 3O4LB 4D0CB 1XV8A 4Y1SA 5FR3A 3S6CA 4NZTL 5AAMC 1PX3A 4HIEA 4MMXB 3WBDA 3X2QB 3PHOA 3FQWA 1P6FA 1AO7B 4QNPE 3IFLH 5J6HA 4PGDB 3PGFH 3D0VA 1LO2L 1PCSA 5JHBA 4F9PC 2E7HA 1A6WL 1BXAA 1FFPA 4LVHC 1XCQB 4M7ZC 3AG4B 3FU0A 3BP4B 1HKLH 4KXAA 4OD1H 3TBVB 5J12B 1Z3GH 1CBVH 3EXJA 4BCXA 1GZHA 4ZW3A 2WAQA 4G8FA 3QUYA 2VN5A 3V9FA 4LQFL 1JFHA 2IWGA 3NG5A 5EOTB 3H85A 4KZEL 3GINA 2AJUL 4WKXA 4JQIA 4R7NA 3DHMA 1W0YT 4MJ4A 5T5FH 1QKZH 5E5LA 2P8LB 2Y7LA 4GNKB 5IJDC 3X12A 5BMFL 1G9NC 3OGOE 2CO6A 3FKUS 1NPUA 2CA3A 1AIFB 5CLWA 4JO8A 3P11H 2YRPA 4HUVB 3FQRA 3T8XA 4Z7WF 5D5ME 4UINH 1IM9B 3X13A 3L3KA 5K1VA 1JYNA 4ETQA 3E1ZA 1A4CA 4IGBB 1KENL 1QFPA 4P5KB 3JV6A 4FFWC 3FXIC 4XBEL 3H53A 5CXPA 3AS2A 5TE6H 1H3WM 1QR1B 4FP8L 3WHXB 2ESVE 3AFLA 4HAFA 3GSOB 4M5ZL 5CZXC 4UQAA 4FFWD 1OGAE 4J1UB 1AO7E 2CHNA 4UM9B 1BZQK 3RL2B 4OT1L 4PM1A 3B9KA 1BBDL 5EOCL 3WDJA 5I5IA 2ENPA 5I66A 4DFIA 3ZHLA 5B1BB 1TETL 1MFUA 4LCCB 4HJEA 1XD1A 3SBRA 2VZOA 2XUWA 4OLXL 3B83A 5HHXH 3MUGA 1IFGA 1E6OH 1FYTD 1R5WB 3LEXB 3WFZA 2X9YA 2XWRA 4XB3A 3RX8A 3HLKA 3M88A 1Q4NX 2C9XA 3IMRA 5FYJD 3S97C 2A74C 3HMXH 4WW2C 5B3NA 2HJKB 3K6SA 4MA1C 2E6PA 1DVZA 3ZGHA 4HS8H 1NWOA 4K7FB 4ZUWB 3HFMH 4H13C 2VABB 5E8OA 2F1EA 1P7QB 4YPJA 2P5EA 2VKWA 3U4KA 4AZUA 2F18A 1XAUA 3N1GC 4POZC 2GJRA 3SCMB 1X9LA 4FXKB 3DIFA 2L7QA 2VQTA 4KKNA 5F9OL 5KG9B 3NESA 3O6FA 1QR1A 4GEJA 4MMYB 4U1MA 5T3ZL 3QWQB 1U8OB 3WEXB 1HAUA 1ZDQA 4K55A 5HDOA 3RVUD 3KWTA 4ZSOB 1MRCL 3U7YH 3VUAA 1A6WH 2C1PA 4I3RH 3S96B 1YNKL 2AVGA 3APNA 4LCUA 2EVJA 4PJXA 2EIBA 3EOBA 4YE4H 4GQ9H 1AS6A 4XPBH 1IGCH 5E70A 3A5VA 5BRZD 4DKFL 1A7RH 1BQUA 5CILL 1XX9C 3U7WH 4JBSA 3MV8A 1LILA 5E1GA 5BOZG 5I6NA 3EF4A 2NRDA 4U3XA 4WW2F 4KVNH 4XXWC 3S3JA 4IOFD 4OFYD 4PYGA 5HI5C 4PJ8A 5BO0D 2RBLA 3CH1B 1IM3A 2NY5H 3ECQA 3K5SA 3F65A 4L29B 5F6IB 3WTWA 2A5UA 4NENA 5I82A 2P24B 2VO5A 1C08A 2WP3T 1G6RB 1YJDC 5IM7A 3ARED 1SY6H 1BA9A 4F27A 5DDHA 1UURA 3VDCA 4ODUB 2UZYA 4DP4X 2RFXB 5GISH 3FT0A 5BXFB 5DVPA 4PY8I 5AYUH 4NC1C 3FO1A 1NWPA 1W72A 3ULVL 1QFWL 1KACB 4HIPA 4XE0A 5GRVK 4AM0Q 4KROB 1LD9A 3QHZH 1D7BA 4DSYA 2VLLB 2Q0ZX 4P4KD 1QFWH 5DLML 2MNWA 4D9QE 1NDGB 4Z7WA 3KPPB 4FLOA 4DO4A 1E4KC 2Y7MA 4RZCA 2DTMH 5TE7L 2VRAA 4EO5A 4TPRH 4HF5L 4NOFA 1I8MB 1MCDA 3TU6A 4GMSH 4TF4A 3F7LA 3MRPA 2XZAH 2V17H 4WFEE 2XN2A 4O02H 3V6FB 4OZ4B 2OI9B 4MNQA 1Z9MA 2F54E 4RZKA 1U4EA 3PFQA 1EHXA 3CFBA 5DVKA 3QIBA 2F9BT 5ID1B 1ZIAA 2A73B 2VXUH 3MACL 4X98B 1MCPH 5E00B 2JJUA 3VE0B 5ADOH 4QJ3B 4QHLA 3TS8A 1MRFL 4KAQH 4KQ4H 2CRZA 4AQAA 2I60L 4Y2OA 1BF5A 5F9OH 2J8UB 3D4ZA 3BUYB 3CZFA 2UWEB 3S37X 4A7UA 4GSRA 3CDFA 4ZQTA 5IKCA 4XCYA 5GSRA 1KJMB 2AC0A 4WHTB 2ZUQB 4W9DC 5FHBL 1NPJA 1ZV9A 5EMYA 5F72S 3EO9L 2L7UA 3F85A 1L9NA 1W91A 3FULA 1X4ZA 3CCHA 4GAYA 3FB7B 1D9KA 2VR8A 3TCLA 2B3RA 2W94A 3F05A 4DUWA 3L5WA 2R51A 1XCTA 5BW7A 1JZ3A 4ZW8A 4PWKA 3DX6A 1PLGH 4H40A 3STLB 2TRYA 1OW0A 1SGKA 4XMLH 2DQJL 3LS4L 1G9EA 4QRQB 4KXBA 3L4ZA 1TTFA 5DHYB 1IE4A 5DR5L 3S35L 3WDIA 1AVAA 2EDDA 2YD2A 3I6KB 1DR9A 4L4TE 1LDSA 2EXTA 4TLTA 3BMVA 1ODAA 2E6QA 5KSAA 1UM6L 2XIDA 3FN9A 3IDMA 4GAFB 1X5HA 1YJDL 1LEKB 3NUKA 4X5WA 4F1ZA 2WXHA 4JPVH 4P48A 4XVSH 4A2GA 2JJVA 4FQLH</