3R19A

Chicken sulfite oxidase triple mutant with altered activity and substrate affinity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGMLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite oxidase
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
total genus 95
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r19A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r19A01
1XDYA 2C9XA 2A99A 3HC2A 3HBQA 4PW3A 2A9AA 2BIHA 4PW9A 2BIIA 2CA4A 3R19A 3R18A 2CA3A 3HBGA 2BLFA 2A9DA 1XDQA 3HBPA 2A9CA 2BPBA 1SOXA 2XTSA 2A9BA 1OGPA
chains in the Genus database with same CATH superfamily
4XP9H 2X4UA 4XCEA 1EEYB 4DTGL 1YPZB 1HILA 5JHDD 4LO9A 5DK2A 1N4XL 1RXLA 1S9VA 4W4NA 2NY1B 3O6FA 2DLFL 4NKQB 3VXUA 1XGUB 2J1YA 3AS1A 4JKMA 2FX7H 2ZUQB 5HI3C 4Z7QE 4KZDL 2EZ0D 5E9DD 1FG2B 4CC0A 1E4XI 3DJRA 2BCKB 2HFGH 4PHZA 5JO5A 2W59A 1HZLA 2X4PB 4U0RB 4ZD3H 1OAZL 1H3WM 3EJZD 3ZKQD 3ILPB 3W56A 4MNQE 2L7EA 1AQ8A 1GYWA 1EAPA 4PJ8D 4PRID 4FRWA 1DSYA 3O9WA 4YK4C 4XVUD 3LRLA 1U8HB 1YEKL 3JZYA 4TSAL 4OH2A 2P8PB 2VW6A 3QIUA 4NKDA 2N59A 3SJVB 2FCBA 3QYMA 2ISDA 3CC5A 3QK0A 4I1RA 1WGVA 3UJIL 1N6QL 5F93C 1IQWL 2O6CA 3HUJB 4JQXC 1QUNB 3EKCA 3O4LB 1A4JB 1BIIB 3PXLA 4OZFB 4BGLA 2XWTA 3A4FA 1NGWB 4Y4KD 4X7SL 3WAJA 2VRKA 3MLWH 3GSWA 2WXFA 3DUSA 4NO0D 5KSBA 1HYSD 3MX0A 5LAXB 5C0GB 3LEYL 4UT9L 3M88A 5GJTL 3DOSB 1CGVA 4QF1B 1F6FB 2A9ML 3X3GL 5D71L 5CWSA 1H19A 3OKEA 3RYMA 2ZSVA 4AEHL 3R4DA 4AYFA 4B7LA 3RAJH 3P2BA 3VRJB 2OZ4A 4FABL 1S3RA 3DTDA 2GHZA 5C0CD 3GYRA 3IM1A 3QDGD 4MS6A 2BS8A 2FSDA 4QOKB 1GOFA 4ERSL 4DOHB 1CFMA 3OPUA 1RZ8B 3QHFL 2IDSA 4POZC 3OWRA 2PYEE 1BP3B 1KXVC 2PW1B 3MV9A 5D1QC 5CEXB 3F8UB 1HINH 4AX3A 2P5EB 3ZR5A 4JPKH 1DR9A 1I7TA 2GTWA 1E9PB 2ZPKH 4KMLB 4JFFB 3TZVA 5J6GA 1EO8H 4X6CF 3AUWB 1M53A 1BBJA 5BZDB 1SLWA 1J1OH 2ZYSA 4Q9BA 1U8MA 3MC0A 5TJWK 4FCAA 3CVHA 2JQZA 1QO3A 2D3VA 2SEBA 2XKNA 1M1SA 4LK4A 3EXJA 1YAZA 3FFCB 2L7JA 4QXUL 1I1YB 2IH9A 1YEIL 1DBML 4KHTL 4AYBA 4R96A 4XPAH 4ZTOL 1OSPL 5GS2D 2NNAA 3HE6A 3S98A 2EILB 3KPLB 1H3VA 4AYEC 2GIXA 2IG2H 2IQ9H 2Y5QA 2APXA 5FYKL 4R5TA 2BY2A 1AYOA 1UVQA 2P3YA 3D3VE 3I9PA 2OP4H 3K4ZA 4OZFH 3FUNA 2MQ0A 4NXSA 4S1RH 2VN7A 4HJGA 3REVB 5DMKA 1FF5A 1MCKA 4E9TA 5AD0A 1AZRA 2IPTH 4TL5A 3V9CA 2B0SH 4TTGA 5LNDA 3O3BB 3N9GH 3X2QB 4CC4A 3B6SB 1A9VA 4TS6A 3GSOB 1CICB 4ABUA 2BXYA 2OMBA 1E4HA 1NPJA 1MW2A 1CE1L 1U93B 2KS0A 5D7IA 1G94A 4XNAA 2H4EA 1XTMA 1BQRA 3MBXL 4WO4D 4L4VD 2X2IA 1G0XA 3CN3A 4FXLA 1GOHA 4XP4H 4NQCA 3V5DA 1TTBA 5CSBA 2AS5M 2BY1A 3DHPA 3T0EB 1XDQA 5IGXL 5HVGB 4ZFGL 5T1JA 5EDSA 5JIQA 4HIIA 1RUAH 2XUWA 4MD5B 3QPQC 3Q1SL 4Q2ZA 2XTLA 2AQNA 3F7VA 3GSWB 2ZCHL 3CFKB 3LS5L 2WZAA 3UEZA 1NCCH 3N40F 1AIFA 1BM3L 3QNYA 1I9JH 5FCUL 5AYTA 1XF3B 1ZPLA 1HNGA 4YAQB 4HGMA 2Y2WA 3LH2H 4LHQB 4WWKD 1EJOH 4ZFZA 5CWSB 1B4LA 2ZOLB 4WI3A 4ZMQA 2JMRA 3OKEB 4F91B 1PMYA 5EFIB 4G8GA 1V7ML 3O41B 5B4MC 3THMH 3MNDA 3QO1A 3QZWG 2NX5D 2J55A 4BQ8A 3VDCA 4MBOA 1Q9KB 4XVJH 4XN8A 1VFOA 4WK4B 3RWFB 1IC4L 4D8OA 2HT4C 4NKOA 4WEMB 3SB3A 2N1KA 2CDGA 1TZAA 1NIEA 2EH7H 1O6SB 3P30L 1R24A 1TIUA 3MV9B 2BP3A 4H1LA 3SZ6A 3NCEB 1ES0B 2CGYA 4UZUA 2R2EA 5DD0H 5EZIH 1FYTE 3TF7C 4XB8A 1WTGT 1KBPA 2WWKO 5DR5H 1M05B 4R7VA 4OJFL 3ARBC 4TQIA 4FP8L 43C9A 3EFDH 4JFQB 4XCFL 4LPTA 5KVEL 4UNUA 4ZAKA 3ZE0E 1TJGL 2XKNB 3OJ2C 4FNUA 4HCRL 1SHSA 3UZEC 3MUZ1 2B59A 2MCPL 5DC9B 4ZK8A 4KK8C 3O2WL 1RFDL 5I1KL 3UPCA 4L5FE 4GBXD 3FTYA 2JKTM 2WYIA 1NGZB 2NNAB 1BVKA 2KPWA 4NM8L 3H9SA 4JE0A 5D9SB 3NRQA 4XVOA 1ZANL 2VJXA 1S46A 3UTTE 4HJGB 4J7RA 4QJ5B 1TTCA 3KLAB 2NCMA 4RGMC 3IDNB 5DMKB 1AE6H 1BZ8A 2XYBA 3Q1EA 3N85L 4HWEH 2GYSA 4IJTA 2FR4B 4FF9A 1SEBB 4HAGA 1BJMA 3EYQC 3HVNA 1G7MB 4LF3B 1GR7A 1CI5A 1EH9A 2XWBA 2VDOH 4Q14A 5IHZA 4M8VA 9CGTA 4AIZB 2WQXA 5DURB 3T6VA 1U36A 4P9HC 5HHNA 3WFCH 3B3IA 5J13C 1OOAA 3MV7A 3FTZA 1R3IL 2YPLE 3LRGA 4ZOCA 4OIIH 4OY9A 3O4OC 5EHFA 5JIIA 5MHSE 1FIGL 3AY2A 2Q8AH 5JOPE 1A6WH 4NRYA 2QMKA 4DEPC 4O51A 2VIRA 5HYSA 5GRYA 5FW6A 2VLJE 4YC2C 2XKSA 3V0VA 3TN0C 5IHUH 3JWNC 1KDJA 1BQKA 1MCOH 1D5RA 1KCRL 1MCHA 3B2VH 4I4WA 2EDKA 1JBJA 2IPUG 4M1GH 1DSFH 4DO5A 3VCLA 3QNYB 5BRZE 5JW3H 1QEXA 1U8IB 1FVCA 4ZG1A 2IFFH 2IQAB 4ZS7L 2J43A 1CD1B 2HG5B 4R9HA 5D1ZA 4A7GF 1RZKH 1XD0A 3F7PC 4M1DH 1NUGA 2EYSB 3EDFA 1MREL 2AJYL 5KZCB 4RMQA 5K59F 1AFVH 5E6IA 4BWTA 1MIML 3K71B 4I0KA 1A22B 2CSPA 4IQHA 2DQCL 4X8CA 4TLKA 5AB1A 3TCTA 1E8WA 3FB8B 4NKOB 5MEQB 5JPNB 4L23A 1ZEAL 3T0BA 3S88L 4GP5B 3UAJA 1Q0XL 2CDGB 2PPFA 2XFXA 3IMRA 3VFGL 4KDVA 3C8DA 4FYQA 4XNBA 1EVUA 4XOAA 5BRPA 2JB5H 1KLGA 3T2NL 1MWAL 2R2EB 3F7YA 1CFNA 3CCHA 1M57B 1PIGA 1MQKL 4R7DB 2P5ED 3SDCC 1NSNH 4G70B 3U0TA 3UJJH 1HHJA 4ODUB 4Y16A 1BZ9A 4JFFD 3HHSA 1WAPA 3CFJB 4BFRA 2OZ4L 2BZ7A 2NXYB 1IAIM 3RUGF 3ARYA 2F7PA 2IANE 4Y4HC 2A9AA 4UDUA 3HFML 1E6JH 5KYYA 2G2NA 4XPTH 4LGRB 3UBGA 1R17A 2XQYK 3QZOA 1XH3B 4PV8A 3L3OC 4MJIA 1DL7H 3EFOB 1E5BA 5CINH 5IB2A 2NY4B 2HG0A 4A2GA 2NUPB 2J2ZB 5A7EA 5JHDE 2BCMA 4HEME 4NN5C 4PLJC 3EJJX 1UOVA 1X5HA 3KH3A 2R0WL 3QS3A 3A21A 4HWZA 1H8NA 4LL9A 5AVUB 1KB3A 4BSWA 1CF8H 4HHWA 4R90L 3VXUD 5E9DE 1P7KB 1QFOA 5GISH 4Q0XH 3VFVB 4XPFH 2HKHH 3U2SB 1P5UB 2XWBB 2YBRB 3BDYH 4F33B 5IHZB 1T1XB 5IB3A 1JF1B 1T21B 1GGYA 2GK2A 2C9PA 2X4TB 4X6CE 5T33H 4Z0XA 2C3HA 3SGEH 5EUKA 1Q72L 2F53A 5CBEA 4XMKL 3KPNA 4GQ9L 3IDGB 4PRIE 4BFGA 3WKMH 4ETQA 5IF0B 2XG4B 4HC1L 3RBGA 2W65B 3OG4B 2CKNA 5JXEA 1W0VA 4N2IA 2ZNXA 4JFWA 3QIUD 4PGCB 4AQ1C 4FXKA 1IB5A 2VB5A 4NRYB 3T0ED 4XMLH 2VIRB 5HYSB 5KJ4A 3IJEA 2PCXA 4HV8A 3LS4L 1FSKC 1KJ2A 1OLZA 1WWBX 4BCXA 4Z23A 1T66C 2DH3A 4ACTA 3WTXA 3IJYB 1QBLL 3RB5A 1DUYA 4I4WB 2EACA 4JRLA 4LCCA 1CFBA 4OKDA 3ECVA 5IJVB 3VCLB 3PNWB 5FM5M 1F2XK 1I82A 1XIWC 3SO3B 1ZLWK 3PU7A 3MVSA 3P0YH 3MYZA 1FVCB 1F58H 2FAUA 3F62A 2H45A 4X4ME 3Q2LA 4W9HC 2ZCZA 3V0AC 4DFHA 3A4AA 4HHGA 5E8OB 5IB4A 4W9LC 3C9NA 3DRQA 3OB0K 1EA9C 4TRPL 4ZUWA 4BQBA 3KM2A 1RI8A 5E6IB 2CNZA 2ZF8A 3DIFA 5CXPA 4RFEB 2XT1B 3QDGE 2XWCA 1BREA 1XZ0B 4M5ZH 5A2JH 1SHMA 3HPJA 4GP8B 4GI9A 4M7JH 1V05A 1IKFL 4IDLA 2K9FB 5ID1A 1W0WB 2XFXB 4Z3FA 1A7OH 4YDJA 3WNMA 4U2YA 3T3MB 4V2BA 4FFYL 2DIAA 1QLEH 4KFMA 1B0IA 3F7YB 3H4FA 3MV9D 1COBA 4MMZC 3GS4A 2UZXB 5GHWH 4WQOA 4YSRA 3I50H 4MCMA 3U0TB 3P4NB 2F1BA 4MMXB 3MKGA 3GMLA 4Y8DC 1INEL 1BZ9B 3TZVD 1ZT1B 3HHSB 3WS6C 5I19L 2WLNA 4KPHL 1TPXC 2C9RA 4NNYA 1NEZG 1BCIA 4MZRA 5GS1B 1Q9LA 3VVWA 1MI5A 1T89A 2Q6WA 3BOVA 4XBMA 1VACB 1DQMH 4AJWA 4MJIB 3NCJH 2X1PA 3CIAA 3OL2A 4XNQB 5IB2B 3HE6D 1C7SA 2BOBA 1DHKA 2ZX5A 1H0DB 3OXSA 4QHLA 5LCVH 5IJCC 5IOPA 3RNKA 3KS0H 5I1CH 1U21A 3BCDA 4X4XB 3TBWA 3GQFA 4MDIB 1MLBB 12E8L 3DX7B 2P45B 5KSBF 3IGLA 1AGBB 3RRQA 3LN5A 4U33A 4XGZA 1O9ZA 2AEQH 2NZ9D 4ZOEA 2YWYA 1AJ7H 4KVCL 4Y2NA 5C0JB 4GT7A 2YJQA 2BMKA 2C1OA 1JXKA 4P99A 4OUUA 5EOTB 4AXWA 5AOMA 4QYAA 1BSIA 1EGJH 4JFPA 4CBPA 2XSKA 3KWXA 5ERWA 3RIKA 4Z0XB 5CBEB 4HOWA 5LGHL 4KKLD 4L4VE 3NDZE 1CYGA 4FQCH 2QQQA 4JX0A 3SGJA 3K2KA 3W9DA 2FATH 4NQCD 2N0MA 4XO8A 2NNRA 4RBPK 1W16A 3DX8B 1F13A 2AAVA 1S7XB 3Q9QA 4FGMA 1CS6A 2VMDA 3ZR6A 2P4AB 3QWQB 4NQEA 1A6TA 4AM0B 4EN2A 1J86A 2EZ0C 1F4WH 1KJ2B 2R29H 4PWIA 4NQUA 2KDYA 3NDYE 4B96A 1R3HB 4LARH 3QQXA 1DUYB 5DC2A 2I24N 4DP2X 1USQA 3EJZC 3QUGA 4Z77B 4J3SA 4Z7OB 3LJ3A 3BVUA 3ISWA 4QHUA 1FNEA 4WEBH 5MI0C 2D8KA 5EG6C 4YR6B 3OKOA 5HPMA 5IB4B 4Y19B 3Q6FA 4JHWH 1J8RA 1AXSA 1KTRL 3V4UH 1TQBC 2OMUB 2NX5E 1ZHNA 4G8GD 3FMGL 4KXZH 3DC0A 3RU8L 3EO9L 4M4RB 2Y2TA 5CP7A 2NSXA 3RTLA 5FHBL 3VGFA 4A38A 3TO2A 5C08A 1SQMA 5EU5A 3EH3B 2OSYA 3M8OL 1HSBA 4AW4A 1OSEA 4A04A 3JYCA 1X5AA 4M6OH 2YGQA 3VGAB 3OWEA 1WEJH 3PV7A 5JHBA 2WLZA 3UTZA 5LN4A 1WWCA 1C08B 3G6AA 2JK5B 1UWEL 2DLHA 2G2RB 1O0VA 3LIZL 4R4FL 1F4YL 5I6XB 3AWFA 4JO2L 3RY5A 2ZOUA 1XF5B 4FFZA 1JZEA 4ZUTA 3UADA 4NNYB 2PCPB 5FGCB 4LHUA 4OGYH 2IDQA 4ZAKD 4UTBL 4YL4A 4FDWA 1B90A 3ZBMA 5LUMA 4GEIA 5IBUG 6TAAA 5C0FB 2ZTBA 4WUKH 4BZ2A 5K59E 1RZGB 1S3KL 2YLHA 3DHJA 3T4AC 5A6IA 4A1RA 3T1FB 3R1GL 4HPHA 3H9SD 4P2OA 1JPFB 2DTMH 5T3XD 2NY4D 3AU1A 2B14A 2OFQA 3BHBA 3BWAA 3HNSL 2OTWA 4I2XE 1NA8A 5HBBA 4P0DA 1IFHH 3NJGA 4PCYA 4X99B 3Q06A 2MSPA 3MLZL 5H94B 2ARJQ 4LCIH 4PJXA 4AL8L 1IAOA 5K5YA 4UOW1 3DVGB 3BJLA 3TL5A 2X4QB 5GRJL 3U2IA 3T4YB 1LO3L 1J0YA 4ODHH 5TF1L 2NW3B 4HCFA 1ZGLA 4A2LA 1PEWA 3TWYA 3SGDI 3RL1B 1UXMA 1VFMA 3TJHD 4KY1L 3VVVA 4BQ9A 5I76A 2ZAIA 1BFOB 4PVMA 4JFHD 1FRGL 4G72B 4OLVL 3GM0A 4NAQA 1BXVA 3MR9A 4UUJA 3RUGE 1AHWC 3MV7D 4J1UB 1MFEL 1CDCA 4ZW5A 4Y5VB 2HH0H 4ALAL 2Z0UA 4Z0BL 1N59A 1KXTA 1T1WB 5EZPA 3VE0B 3GRBA 4IGBB 4BUQA 2EECA 3SJVE 4OM0L 4UYQA 2FJUB 5LKNA 1KPRA 1BM7A 4GEJA 1H3XA 1G9NC 4F2MA 3H3PH 3II3A 3MJ8A 1QSFB 4ADGA 3BEVA 3GLAA 2DQUL 1RZPA 3QZWB 4BFFA 4FXGC 1A6ZA 5C2UB 4P9MH 5AZEH 4F5CA 4G9FA 3K0YA 4HK3N 5HGBA 4H8WC 4QHUB 1FNEB 4TOYL 1QEWA 2GKIA 2F08A 3MSPA 2CA4A 4ZFOA 3A4DA 3WNIA 2YXMA 5D1ZD 3S3SA 5CGMA 4OD1L 3P4OA 1ZIBA 5HGDB 1WCQA 5E6ID 2LU5A 3NH7L 3FQRA 3RPKA 2D0HA 1MCPL 1NFIA 2NSQA 4APXA 1YA5A 1MNNA 4H8QA 4ZS6D 5EU5B 3DVNB 1Q90A 1RP9A 3F12A 4LP8A 4PWHA 3UAJD 4LASH 3QUML 1BZDA 5TDPA 3QDAA 3MKKA 4PV1C 2OYPA 1SN2A 2QV2A 5DCCA 3ZE2F 1I8MA 3G6AB 2P5EE 2P44B 2VUOA 1DBBL 3NCWA 4MD4A 5I16A 3BKCL 4JFFE 2J5LC 4BSVB 3MODH 3BPNB 2EDYA 3VFSB 4HFWA 5AKTA 3UMTA 4OLZH 3HA0A 3D0LA 1DVUA 3HS9A 5DYOB 2KERA 5E99L 1HIML 2B4CH 3TBTB 1HTYA 3LKQA 5ENWB 3SKOB 3ZGHA 4GKNA 3TIDA 1F3JA 2BP8A 3QJHA 3LDBB 4JG1L 5L4FA 4MJID 4HEPA 4ZXBB 4JW3A 2DD8L 4P2OB 3IMBA 3HAEA 3N5AA 1YEJL 1CWVA 2R0ZL 1BXXA 3AU1B 3EBHA 3BWAB 3FH7A 3D5OF 1T80A 3UGXA 1H15A 1MIEL 1M9WA 3KPOA 3IDMA 1ZLUH 5JPMB 3IKCB 1IAOB 2CCWA 2UY6B 1XTLA 2YFOA 5DXWA 3VXUE 4XI5D 2G75A 3QI9C 4UB0H 2OMZA 1PX4A 1OAYL 3HR5A 4DGYH 1E3XA 4JFOA 4HGKC 3A67H 5F6HI 3TPUA 3EAKA 2AQPA 4KJPD 2W9DH 4GBXC 4X5RA 1U33A 4E41A 3I2CH 2WBJA 5EEUA 4D3CH 5GGUA 1GCYA 1GZQA 2QELA 3PNRB 5E2WL 5IVXB 5LXGL 5ESAB 4N4YB 4Q6YA 3WFEL 4U6XA 2H32A 5IM7A 4UUJB 2FEEL 1J0KA 5IJDC 1HWWA 1J05A 1NEPA 2A9DA 1TUPA 1K3ZA 3VFPA 1KXTB 2RD0A 5CJOH 3R7RA 5JXED 3T0EE 3KPMB 3SKNA 2DQGH 3SKUD 2I25N 1S7WA 2NT0A 4J4PD 1DSWA 3BEVB 2F8OA 5KVGH 5MENA 5FIEA 4Z76A 4R2GB 5KSBE 2UZPA 5FW8A 4TVPH 4N2CA 3JV4A 2WXNA 3TBSA 3S3PA 5AVXB 5GGTH 1JRHH 1UOKA 4GH7B 4P3CH 4N26A 4PRNB 4PTUB 2MTAA 1UWYA 3BFQG 3US0A 5I5JA 2NMSA 4NQSB 1JGLL 3GMOA 2GITA 2QGBA 4M93B 3VTTA 2GPZA 1ILUA 2G3NA 5TFSH 5ICYB 2OXGA 2IF7A 5ADOL 1YRKA 3VX0A 4FAAB 5FF6A 4QRSB 1NBYA 3E2HC 1AR1B 4P3DB 5F9WC 1FFNB 3FPYA 4YSUA 3F12B 4WI7A 1FAIH 2R2CA 5I75B 3EH4B 2E7LC 3UZVB 5DLLA 3MV9E 3LX9A 1LO4L 4KC3B 4HUXA 5IMOA 1QBAA 4LCYA 1NBZA 4GXVL 3ZYIA 4UOZA 5C3LD 5KWYC 3LPFA 2EC9U 3GSVA 5KBKA 5L4MA 4JPIB 1QRNB 1UM6H 3CFIC 2VR3A 2HWZL 1KLFA 1U8NB 2AK4B 1ETB1 3WENA 2VH5H 3D0LB 3MRNB 2DTSA 1VZIA 3LKQB 4PW9A 1ESOA 1SLUA 1AS7A 1JNNH 2OI9C 1MI5D 4GKNB 4JRYA 5C3IA 1F3JB 3OC8A 2ARWA 3HNTH 3ZY7A 2VAAA 3DOIA 4N5EC 3E7JA 2WUBH 3G7TA 1CB4A 4AJ0A 2V9QA 1QAWA 4Z8FH 4MFHA 4N68A 4PWJA 2HA1A 5D7HA 1YEEH 3O6MH 4ECNA 3CDGA 2JKWA 3BFWA 5DS8A 3U9UA 1OP4A 4NPYA 5LG1A 3KPOB 3BMVA 4MVBD 1U3HB 1YQVH 1W91A 1IEBB 4E42A 2G75B 4UTAL 5BVJA 4I9WD 2RH0A 2R69H 5BZWB 3RI5K 5K9KA 3GS7A 4OCYH 4AVIA 3BFOA 1TZIB 5BO0D 1U8CB 5J6HB 4U1GC 3S2AA 3A22A 4E41B 2Y1AA 3HI5L 4YUEL 3DHMA 5E8DL 3N42B 2Y06L 2FGWL 3NJIA 3TT1H 1KN2H 2H32B 3T2QA 4NQDB 4ZX5A 3HTLX 5BV7B 5I1EL 1J05B 1E5CA 5BCAA 3NCFB 2RB8A 4NQCE 3IFLH 1JPSH 4FQ2H 3X1GA 4Z7WB 3GC3A 3B43A 5AW2B 3NGBB 2F18A 3GI8L 3O6FC 1RZIB 4XE0A 1S7WB 5G4MA 1PG7L 2XBZA 3RWEA 3V0JA 4D7BA 1OE2A 4NQED 1WZKA 3NSDA 3L7EA 2QT6A 2LAAA 4JG0L 1XH1A 3ZUNC 3KPTA 4EN3C 2AK1L 3HE7A 1XMEB 5SX4I 4LSUL 4K7PL 4MYWB 3FOMA 2YC1B 3NSYA 4EBQL 3O9WC 1MRCL 3FS9A 2GITB 1MH5B 3GMOB 2NNXA 3JVFC 3QIUC 1SMOA 3VGBA 4G8GE 3MRJB 3FFDB 3DXAA 3HMXL 2OTUB 2O5NA 2XDHA 4N1CA 4YPGB 5B1CA 1TITA 5AW9B 3RLSA 1DBAL 5D72H 2WXHA 3CVDA 3HS0A 5GGVY 3DOHA 4UZGA 4YZWA 2AJSL 4JZOA 1FV1A 2X6AA 3OAZK 1ZV5A 1NEZB 1F4AA 5C08D 4QRUA 3MXWL 2ADJB 4JANA 4NNXA 1H6EA 4IDJH 1EMTL 2GJ6B 3SGKA 2R4RH 4WO0A 3ROLB 1NBZB 3MNWA 4KNQA 3M7OA 1BVNT 4U1KB 2NYKA 4OZIA 2P5WB 2BWIA 2HAZA 3JT0A 5L88L 3FT3A 3EF4A 1ZDQA 4M7KH 4KITB 5F9DC 2R39A 2C9VA 1H9DA 3UERA 2LHAA 3K6NA 1AKPA 1K6QH 2ZG1A 3BLKA 3LTVA 2AABL 3DIDA 4LHUD 4PP1D 3D0VB 4O9HL 2Q86B 1X5XA 2X1WL 4FFWD 1KZQA 1F0LA 2J6EH 2XIDA 3PFUA 4J8RA 1GC1L 3H9SE 5SX4H 1O7SA 3VFWA 5T3XE 4QPEA 2ZAHA 3MXVH 3RG1C 4P2OD 3P3SA 5SV3A 4F9LA 5CP3A 1T5WA 3CDGB 1TTAA 5DS8B 3UBFA 8CGTA 4F8LA 1CXLA 3TZVC 3HIZA 4E0RB 1Q0YL 1MUJA 4DT2A 3FO0H 3NN8A 3QPXH 1QBML 3PGCA 1WBYA 5CU5A 2R9HD 1XGQB 5F7KC 3SD2A 3RDTC 4N8CL 1RJYA 1EIBA 5K9KB 4R4BB 2VDLL 3MJ9H 4KTDH 4ZODA 3G5YB 2H2PD 4UQ2A 5DRZA 3ZE2E 1BIHA 4IM8A 3MLUH 1KJ3H 3FU0A 2YGPA 1B9KA 3LPWA 4PCKA 5EF2A 4DK6A 2YO3A 3E80A 3KR3H 2BRRL 1WS8A 3LQAH 3QP3A 4JFHE 4RGNC 3HE6C 2DIBA 3WBDA 3LRMA 3OKKA 1QSEA 3MV7E 4KFZC 1HH6A 4YNYA 1EHLH 5DZNA 3LN4B 3O6LL 5DK0A 4OT1L 2E6PA 4ZTPH 1A7QL 4CU8A 1S9WB 3OX8A 4BFBD 1OP3K 1G7PB 1Z9NA 4PRBB 3V95A 1BBDH 3ULVL 3NA4A 4EEEA 2OMVA 1ZAGA 2HJLA 4ISVB 5GGQL 1CURA 2W0FA 3BD3A 5C0RL 3L7EB 2VC2L 5HJBA 4CC4C 2Y6SC 3DO7B 3JVGA 4KQ4H 1SUHA 1ID2A 3PWJB 3V6FA 4BH7B 1U4EA 2UZIL 7PCYA 1IV8A 1TVBB 3SQBA 4R2GD 4DZ8B 4G9FD 2OCCB 2V8LA 4F20A 2UUDK 5IQNA 2ZXWB 1RIHH 2DDQL 2PPDA 3CLFL 2WAQA 1UOLA 2WW8A 3D9AH 4J6RL 1BLNA 2C34A 3GZPA 5AW5B 2J1KA 2H1PH 1V3LA 3EG9B 5E00B 4P5TA 3V2AR 3VMPA 4G59C 1T0MA 5MEPA 4OW6A 4JM2C 4X8JB 1JNLH 1NCWH 1A3LL 3L6FA 2O5XL 4PVNA 1AR1D 3F7RA 4FQJL 2EDFA 1FV1B 2W8CA 1QFWL 1UM4H 1AD0B 3GK8L 5FYKU 4L2YA 3BSZH 1MJ8L 3PL6B 4QRUB 3KVDD 4N5UA 3DV4A 1MRDH 5IBUB 3U2JA 2BNRB 3D4GA 3SYCA 3FUJA 3KEHA 3VB9A 3VD4A 4OZIB 1U91A 1CXIA 4XNYL 1EXUA 4E5XG 5CEZL 1L7TL 3W39A 4ANKA 4P2QA 4YHLH 1ETJA 2P52A 4CNIA 4FFTA 5IVXF 1ZLVH 4P4RA 1RMFH 4BFNA 4XBEL 2BSSB 4S0SD 4QRQB 1NAMB 4U1SB 4WVRA 5J1SC 1CLCA 1JOIA 2AK4D 4YE4H 1XGPB 3D25A 2ICWB 1YEGH 2XZZA 3BKMH 4BK4A 4F7CA 4D0DB 2X3AA 3FF8A 1FNSH 5D4HA 2AI0H 2IXQA 4MJIE 4TQEL 3ETTA 2Y7OA 1P69B 4I3RL 1R19A 4ZDHB 1KV7A 2XCMC 2EAEA 4XXWA 3REWA 4OQTA 1GSMA 2AV1A 2ICWI 3BAEL 2BOCB 3FB6A 1UZ8B 3AZUA 4IRJB 4ZFQA 1PZUB 1JVKA 3WMSA 3IU3A 3PYCA 4HUCA 1JPGA 2NR6A 4XZ4A 2QQLH 3JWDH 2P5PA 3N50A 4XRCB 1Z9SB 1N67A 4JHBA 3FSZA 5J1AB 1T3FA 4ZAKC 2HTKD 2FX9L 2LQRA 2Y07H 2MTPA 4QXGL 3I85A 3JV5A 3MRCA 1W72H 3OGCB 3Q44A 5A16A 5I1LA 4DVBB 3WL9B 2NPLX 4E41D 1O7DE 1MFDH 1KY6A 2WO2B 3KJ4B 3TWCL 4NENA 2ED6A 1MHPL 3TBVA 2IGFH 4K07A 3GUTA 1RUML 1AP2A 3ASOB 2D7QA 3OX8B 3PHAA 1L9PA 3LQMA 4GSDL 4G1EA 5LLIC 1IU1A 2V0AA 2OMVB 4ABQA 1OE3A 2HJLB 2A9CA 1WBZA 4LVOC 2E27H 2VDMB 4AY0A 4MAYC 2W0FB 1Z0MA 2DQJL 1MCCA 2RA1A 3QCUL 5MEND 3TJHC 5KTEH 3IAPA 2YKKA 1WGOA 4M6NH 1NBVH 3SPGA 3SE4A 1KCSH 2XKUA 3MRLB 3CPLA 1PNCA 4K71B 4QTIH 1CT8B 1NAMH 4PRHA 3DO4A 4KO9A 4Y19E 3N0AA 2Y1YA 4GG8A 4O2FA 4FG4A 4P5TB 3QEUB 2NY0C 1T0MB 1UTDA 1QHOA 2QPFA 4PY7A 1BEYH 3FULA 3ZDZE 4G6JH 3VU2A 3L6FB 3MRBA 4H88H 4S0TD 3VXSB 4NHUA 3TFKD 1KZYA 3BD5A 2J44A 1ZV2A 1YEFL 4OSUL 1GZHA 3RWGA 5DD5L 5JOFA 2KMWA 5SWZA 4RESB 1FH5L 2FJGB 3ZK0A 3TNNB 3AW5A 4Z78B 5DUJA 3TFBA 1KIPB 4PR5A 4YHYB 3WN5B 1E6OH 1RP8A 3GPEA 3P2DA 1MNUL 2AANA 2IV9A 4KVNH 5K9JL 1U91B 3FQXA 4UM8B 1EXUB 5D1ZC 3W39B 5DZOA 4P2QB 3TASA 2LAGB 3ZTCC 3VD2A 3IGKA 3N42F 1CD0A 1W0YT 2VW7A 4L1DA 2D03L 5FM4A 5F1KC 1JGIA 4N28A 4M48L 3ULSA 5FGCE 1MI5E 2P24A 1MF2H 2FVNA 4P49A 3L2LA 4GQRA 5E8EB 3T8XA 2H6PA 3L08A 3HMWH 3MRMB 4LT7A 2WCSA 3UAJC 2FO4A 4NP4H 1OWWA 2BIIA 3BE1L 1N10A 3MMEA 1TZHA 1CCZA 2X0VA 3REWB 3UG4A 4XODA 2FJHB 3ESMA 5JIHA 3EHBD 3SPVA 1BXAA 4QNPF 1ZXKA 5DMIH 2E7BA 1TLMA 3IU3B 4Y16C 4I9WE 3MLSL 3MLTB 2AKRA 1PJ9A 1T3FB 3GT6A 4ODXA 3UJTH 1T4KA 4B9IA 4KKRA 5GIRB 1UB5A 2WLJA 5A16B 5I1LB 1LE9A 1F97A 1WA2X 3GS0A 3KBEA 1AYRA 5FUOH 4X4ZA 2XRAL 5CNHA 3BPCB 4PPTA 4QXWA 5IT2L 3OKDA 1CVRA 1IGMH 2VLKB 2V7NA 5H2BA 4BCYA 1P5VA 1H8LA 1KB5B 4YHPB 1BMWA 4LPYA 4R26L 1G9ML 4I85A 3GXMA 4ALAC 4PLNC 3PDOA 4F8QA 2V2XA 1IGTA 1AI1L 1YY8A 4XI5C 5HJGA 2ZWNA 4M7ZB 4XBPA 1S7VA 1MFNA 4NQEE 4ODSH 3HI1A 1NCAH 1CDIA 3AITA 3HRZA 4PSPA 4XBGB 1TETH 4OI9A 5SV4A 2WCGA 4DW2L 1KGXA 2BW4A 4MTMA 4X9BA 5CJ5A 2BZCA 4QRBA 4RFOL 4H8VA 1PEZA 1IAMA 1KBGH 2V9TA 3LQZA 3FB7A 1JMXA 1DVSA 3WJJA 4IRZL 1CZ8L 1VFAA 2BDNL 2JE8A 2QGDA 5D8JL 4L0ZA 4BE6A 1C12A 3CPLB 4QGTA 2Y3NA 1EAQA 2XPYA 5DVNA 4HLJA 4UQ9A 1VGEH 3E6FA 3VQLA 2D7TL 2GHWB 5JXEC 1G6RH 3VRLF 2CR6A 5DFVD 2QVKA 1NCDH 3VGDA 4K3EH 4F9PA 2X41A 4FXKC 5IY5B 4PVLA 3IBEA 2XZCH 2AXGA 3DXAD 3JUZA 3L5XH 3T8VA 2FX7L 1CFSB 4UT6H 4GAYB 4B95C 1EEUA 2K70A 3O0LA 2HFGL 4W9DC 5C08E 5HHPA 5SWZB 5D1XB 3NIFF 4LCCC 1BZ7A 4NQXA 5B8CB 3B7UX 3P9MA 2R1WA 1A6AB 4IKNA 1XEUA 1IM3A 4FZEH 3OJDA 3MRFB 5EC2B 1U8JA 1HXYA 2YXVA 2PETA 4YSDA 3L3DA 4JGMA 4NQQA 4Z1PA 2BHYA 1D5ZB 1PZBA 1UCBH 2VM9A 5CLWA 4DP7X 3V0WH 1OSZB 2DLGA 5IW1A 3ULSB 2K3HA 2H8PB 5HHVH 3BZFA 5BXFB 1QMUA 2XWJA 2G3XA 1ZPUA 3DX3A 4F8OA 3MLWL 4JDEB 1AQDA 5KVFE 1KB5H 3J2PA 5JOEA 5TDOA 2NTFA 3RVTC 3QARA 5MERA 3QQ3A 4WTQA 2CR0A 3KPSB 3ZTDC 2XX1A 5E94A 5D93B 5JUEH 4WHYG 3HG1A 3MRRA 4NJ9H 1J9TA 3KXFB 5IHWA 3FYEB 1KNOB 2ZSWA 2DL2A 2XQBH 5LBVA 3OLIA 3MLRH 5EOCJ 3TF4A 3P54A 1WS7A 1RH8A 2R2BA 3JUYA 3WNLA 1EJFA 4PJXE 4HP5A 4IRJD 3MNZB 2ZXDA 3AB0C 3KLSA 4P46B 5FGRA 3RAJL 2B7DT 4M6MH 4ODXB 1T4KB 2VDNH 1FNGB 1PLCA 4YHZL 3B5GA 5E6RB 3W11D 4R7XA 4Y5XA 2QFRA 5TTRA 3E1ZA 4N2LA 5IVXE 4RAVB 2YA0A 3DUUA 4GSQA 2I9LA 3S0PA 2DM3A 2V7NB 1QSED 3WHXA 1U3JA 3CHOA 3QWRA 4UU9B 3VSUA 2EICA 4AK1A 4JPKL 3LEXB 4MVBC 2ZPKL 3PDOB 5DQJA 1J10A 2V2XB 1EO8L 1YY8B 2IC2A 3FRPA 1M7DB 1YYCA 1J1OL 3IAGC 2QVMA 3HRZB 1LVEA 1SJXA 4F2ME 5SWQA 3C87A 4LPCA 3L1GA 2IH3A 2DH2A 4OZIF 1UC6A 2DF3A 5JIMA 5EU7C 3QSKB 4F5CE 1QPXA 2LABA 1WG3A 4XPAL 2WKOA 4G9FE 5LBSH 5I17B 5PAZA 1I8UA 1UKSA 2IG2L 2IQ9L 3A6CH 3CFBA 3FB7B 5IMMA 5B22A 2D4FA 1RU9H 1C12B 3FTGA 4LIQE 1WT5A 2XZAH 1KGUA 1SMDA 2YR3A 4D94A 2JB6A 4N2DA 2X88A 1TZ8A 5FA3B 3L3HB 2AXGB 3BWUC 4P5TD 2IPTL 2QR0A 3AMKA 4OBRA 4WHTA 2B0SL 3N9GL 3CX5J 5KANG 1N3NB 3CH1B 5HHPB 2XETA 4XZUA 1WD8A 4GUPA 3NJJA 4S1QH 4NQXB 4GO9A 1XBDA 1UADC 4IK7A 3U36B 1ZS8A 3MREB 4L37B 3VFRB 3TBBA 2R1WB 5HVHC 5IMKA 4TMPA 1KEMH 1IM3B 1VZHA 2EXYD 2D7OA 3G5WA 4OF5A 3T3PF 2EVHA 4RDQF 3PP4H 5E8NB 1HXYB 5F44A 5F8RC 1K85A 3N04A 4DVRL 1CDHA 4KJYA 4XP4L 3U1SH 2W60B 3OMZA 3WIIH 2G0LA 2OKMA 1YZZA 1JZ4A 2YRLA 4P2QD 4N0FB 3EIFA 2CHWA 2PCFA 5CEYB 2AK4E 2O26U 2IH1B 4G1MB 4HJSA 2EXWD 5ISZA 1RUAL 5E1AA 1AZNA 5E7FA 2XWJB 1T2JA 2X05A 5J12B 3O45A 3WG7B 4UV4H 5LJYH 1OGSA 5IJKA 1Y0LA 3L95A 2P7TB 4Y9EA 3ABLB 2HPTA 5DMYA 4UOQA 1HCZA 1NCCL 1OAJA 1QFUH 2OCJA 3AABA 4P5KA 3L3KB 5GSVA 3F04A 1I9JL 4NZTH 1HEZA 3U7WL 1KYOK 4OV5B 3HG1B 3ARXA 3GMNA 5I71C 1BAGA 2FWUA 1QSVA 1NJ9B 3BP5A 1KG0A 2PMZA 3LH2L 1EJOL 1KTDB 3OV6A 1ED3B 1XO8A 2ENPA 3NZHH 2FIKA 1FGNH 2CDFA 4FQHA 1T1YB 3THML 4I18A 4EI0A 3TU6A 1L0PA 2NR6D 4WTZG 4XO3A 2K4WA 4DIXA 1N0LB 3C5ZA 3WO4B 4PP1C 5FO8A 2MEJB 4GS7C 4BFIA 4E41E 1BQHA 2AEPL 1ACCA 4FMFA 2WTRB 1GS6X 5DHXB 1WO2A 2A74A 2HP4A 4MB1A 4G83A 2VDKB 4K0OA 2EH7L 5DK3A 3L13A 2APSA 3JXAA 4HDIA 4YDIL 5DD0L 5EZIL 1PY9A 4G43A 3WJLA 5KVDE 2DQMA 1FLTX 1VEOA 2R9HC 2V8MA 1L9MA 3D4YA 2HSIA 3T04D 3JQOB 4L9LB 2ZOWA 3EFDL 4HA1A 2H2PC 3QH3B 4AKPA 1UH4A 4IEFB 1RV6X 4MJ2A 5D5MB 1I8LA 5MENE 1P7HL 1S7SA 4U4BA 4OI7A 5AYUH 1RJZA 3D18B 5IFJA 3TPKA 3IDJA 1VADB 2A4EA 5KSAB 3HLAB 5DGRA 4HIEA 5HXMA 1KTKE 3TYFB 3FTGB 2GQHA 2HVJA 4XCYA 3LD8C 2ETWA 1P84J 5E51A 3MACH 2CUAA 3P3YA 4CMMA 2JB6B 4PRHD 1NDGB 2H6UA 3QHZH 1OWRM 4GRLB 1OANA 3WXVH 3SPCA 1AE6L 3QB7C 4HWEL 1LK3H 2ZUXA 5FV2A 1JGUH 2QR0B 5C0ND 1PZDA 4P2RB 4F15C 5I30L 3FRUA 2R29A 4XZUB 2VDOL 4GUPB 3BPLB 5SWZD 1EEZA 1TVHA 1U2YA 1BX2A 3LKSA 3WFCL 1HVXA 3AT8A 2A6DA 4KJYB 4OIIL 3X12B 5FOJA 4CMHC 1G1CA 1WHOA 3PCYA 4PJ5A 2OMXA 2Q8AL 5DJZB 2PCFB 2XA3A 2CIIB 2WNWA 4O02H 4NN7C 4Y9BA 5E1AB 3LHPH 4RAUA 3T6QC 5AW6B 5IKCB 1HL5A 2F74B 2K7QA 1SYSA 3KGRA 5IHUL 3RHWK 3VRLE 1MCOL 4OZGA 2CRZA 3B2VL 3LNIA 4BA8A 4M1GL 1YLBB 3IS1X 3QJVB 1HEZB 1GW6A 2GC4C 3ZHLA 3DETD 2FECI 3GMRA 3KPSD 3HZMB 2HLAB 1DJGA 2YQ2A 2DI7A 1I85A 1RZKL 1GMIA 3PPSA 3OJVC 4OCMC 5J8OA 4M1DL 4KXCA 1QA9B 1G1OA 2CDFB 3NIFE 4FQIH 4G42A 3GMPB 5AEAA 2A6KB 3D69B 3RZCA 4O00A 1FL3A 3WKPA 3MAWA 3LZNA 1M9SA 1MJJB 3PQYB 5E5UB 2Y22A 4LDCA 2I69A 4V11A 1YEDA 3H4HA 5AW3B 3FUMA 5BOJA 5DVKA 1K2DB 1PZ5A 2QTVA 2BVUA 1UASA 3FQWA 2LW3A 2BVPA 2JB5L 4JHAH 1IC7H 4O5LH 1F5WA 4G43B 2BP0B 3WUWG 2NY2C 5JQHC 4FFVC 3UJJL 1NSNL 3L9EA 1TVDA 2APWA 3C09B 3RZWA 5C0IA 5DT1H 1I9RL 1JGVH 3SY0B 3ULVC 1F4XH 4JGNA 4FQXA 2CCLA 5BZXA 3AU0A 2HTKC 2Y0SA 2C3VB 4ANVA 4W9KC 4C54A 5T3ZH 2FJFA 5DDHA 5DJ8A 1E6JL 5J6SA 2D31A 1TKWB 3ZHFA 4OTXH 4YBLB 2WBJC 4Z3IA 4BV1A 4HIEB 1UKQA 5CINL 1JNHB 1CLZH 2VQTA 1ZE3H 4BGDA 3HRPA 1EHNA 2BSRB 2HKAA 2IBZY 4AYSA 5F0LB 4G7VL 3HBGA 4HW6A 3ABGA 4DP8X 3VSTA 4ELKA 3DXAE 4ELMA 2WMPB 4Z9KB 5F9OH 4G11A 1ADQA 3V4PA 2ADGA 1QWNA 3BN3B 3ECWA 3NCBB 4G8FA 4Q0XL 3FT4B 2HKHL 3NQIA 4XPFL 5C6TH 3PP3K 3FOLB 2JCCA 3BDYL 1CD9B 1NUFA 4FLQA 4PGDA 4W68A 5BQDA 2E76C 3DX4A 1IIIA 4MDJB 2VXUH 3TYGH 5T33L 1TVHB 2MHAA 4NKMA 3HBQA 3LKSB 3C5JA 1A5FL 4OIFA 1TLKA 3WKML 3SHSA 2Y25A 5ABAA 3V0EA 4GMTH 1IEAB 1IM3D 5FO7A 2JKNA 3STBA 4C83B 4OZIE 3AS2A 3Q6GH 3QW9A 1T7WA 3ILQD 3GSRA 4PJ5B 4YHIA 2OMXB 1SYVB 2XV3A 1SM3H 2PTUA 1X5GA 3NJNA 1DE4B 4XMLL 4WDIB 2G0KA 3GJFA 2FO1A 4JN1H 4M8QB 4U7SA 3QDHA 1A9BA 1JV2B 1EUTA 1KGCD 2YPVH 3I6GA 4HZAA 3UC0H 4UF7C 1MCNA 4ZBJA 3ZOAA 1A1NA 5I1IH 3TBCA 2K45A 3B9KC 3P0YL 4KK9C 4RIRA 2AAAA 2VXVL 4Y8AA 1MFCH 3RVUC 1F58L 5EBLA 2X9YA 3ZQ9A 2DLTA 2G60L 2QVTA 3HG1D 1KJVA 3ZTNH 4IIQA 3UTOA 4EDXB 2ZCKH 5T5FA 2WQUA 4MA7H 2RIKA 4ILDA 5HYEA 1ZVNA 3T3PE 1URIA 4N6RB 1FL3B 1Q1PA 3UROR 4ZQTA 4XXDB 4JG5A 3PLYA 1H3UA 4FNRA 1HSAB 3WTTA 4M5ZL 4M7JL 3OHXA 2J12B 4URKA 3BLBA 4G8EB 3U4EA 1PZ5B 5DZLA 1A7OL 4WJ5A 1QSEE 5ETUB 4IBLT 2QBWA 1J88A 1WUZA 2BVPB 4BFOA 4E2OA 5JW4N 5KG9B 1LE5A 1LK2B 3QA3A 5IV2A 2P46B 3ZKNC 3QWRD 5FO2A 3I50L 4PY8J 5F89B 4CVZA 2Y9RT 5BNXD 3UIYA 2QHLA 2OJ1A 2KZWA 2JVUA 5J4MA 3SQOL 4F8NA 1KDIA 2FJFB 4K5MA 2VITA 4YDVA 5DJ8B 3LH9A 3SYQA 4JB9H 3O3UN 3IGFA 3QQDB 1U42A 1DQML 3NCJL 1OGTA 3T65B 2V9RA 5KSAD 5LCVL 2R4SH 2YARA 3BI9X 4B53A 3BVWA 2YPKB 3LPPA 4OZ4B 2XN0A 4HIPA 5CKGA 4Z3GA 2OR9H 5TD4A 3RL2A 4ZUVB 1OGAB 4HJTA 4ELMB 4R6UA 1YN6A 2ZP9A 1A1MB 3DV6A 4XHQA 1UACH 3K7UA 2AEQL 32C2B 2ADGB 3FUIA 1AJ7L 1JXDA 3MA7A 2PWGA 2D7PA 3VA2C 1JVOA 3SKJH 9PCYA 4OKVB 4GAAA 4LSQH 1EGJL 1ET5A 3TA3A 1GTNA 2L0DA 3HE7C 2ZJSH 2BVQA 3SODB 3LXUX 1G7IA 5HYJA 4BFJA 2WUCH 1IGJA 3W5MA 5A2LH 1KIRA 4XWGH 4FQCL 3VM7A 4DKEH 1K4CB 4LKXA 3L4XA 5AOIA 1JFHA 3QYNA 3GSRB 3P77B 1IC5L 2VXTH 5DFVC 2FATL 4P2QE 5LBGA 2FB4L 4DGVH 4KZDH 1NLBL 4LCWA 2EDLA 5E03A 4M9OA 1MAJA 1MLCB 2WVUA 4J3BA 5ISZD 1F4WL 1QP1A 2R29L 3HS0C 3PY9A 4G9DB 4WNQB 4XNZB 2WVSA 4HWBH 4TQPA 1FVDB 1W6LA 4LARL 5I0ZA 4GUQA 1A1NB 3FCSA 3CH8A 1JWUA 2E46A 1RURH 2FSEA 1YEKH 3HN8A 3KYNA 5HGHB 4LLMA 3LKNA 3FKUS 4WEBL 4LVHB 3SGKC 3MCKA 4ZYKB 4WU7A 1ZY9A 2YKLH 1RZ7H 1PLGH 4IRSA 1IQWH 1K5NA 1LJMA 1QR1A 3AQDA 3G9VA 3V4UL 2WKOF 5HDLA 3EFFA 2H2SC 2J3SA 1J11A 2ZKHH 3ARVA 3QRLA 2DM2A 1XB8A 1ZHLB 4U7KA 3C5SB 3GPSA 2UXVA 4MA1C 4DETA 1BOGA 1XF4B 3C5ZD 3LEYH 4RMSA 4GKZB 4WW2A 4KTGA 1X5JA 1FC2D 1N68A 1S9XA 3FSAA 2VRQA 1Z9PA 2GJPA 4FKHA 1M71A 4M6OL 4WJ5B 2I7OA 4DERA 5GS0H 2A9MH 5T8IA 2ARJA 2E59A 3QUZB 1WEJL 3QA3B 2ATPB 5IV2B 3M1OA 4F9LC 3O2DA 1QX1A 3G04B 3ZN6A 2Z35A 5CR8A 1J1PH 2GK0B 5FYJD 4BRVA 4ZZKA 3OLGA 1TQTA 1OT4A 4HSQA 4FTDA 1ZVSA 1DYZA 2GBTA 3FFOA 4YDVB 4OGYL 3W11C 3ECQA 2AQ2A 5BZZA 1KELH 3LNHA 5EEWA 5AAWC 1YECH 4H40A 4HAFA 4QHKJ 4KTYA 3WTYA 2AC0A 4WUKL 5GGRB 4IU3A 4WV1A 2HJFB 4WHYH 5AOKA 2OR8A 3SY6A 2DTML 2VJ8A 4PRHE 3D34A 3II2A 3L9RA 4JKPH 4KRPB 3RL2B 1IFHL 1QFHA 1MEXH 1BJ1J 4LCIL 4X5LA 4WI9A 5HDWA 1KV3A 4TN9A 1CGYA 5FYLD 4ODHL 3VXTA 1DBMH 3BVXA 1KIUA 2GFBA 1OSPH 1B88A 3JVGC 3SOTA 3W0WA 5SWZE 5FK9A 1D2PA 1IGJB 4OCSH 4DEWA 3C2SA 3SE3C 3DK0A 3DSNA 1HESA 3V5HB 3VQMA 4QWWC 4JFXB 4YHNA 2HH0L 1PS3A 5EO1B 4N2EA 5D7JA 1AQKH 1HQRA 1VEMA 3BPOB 4PJ5D 3UBXG 2P1YA 5CO1A 4I0CC 3CXHK 3N1QC 3TS8A 1HAWA 1N8ZA 1ORSB 2X40A 3H3PL 4R84A 1OB1A 3HZ3A 5BQ7A 3KJ6H 5I74B 1MG2C 5TH2A 2CDEB 3IKKA 4P9ML 2RCSH 3UP1A 1JWUB 2HVBA 5CHNA 3VG0H 1UB6A 2EXYC 5IQ7H 3KPSE 3MN8A 1NMCC 2Z31B 4OAWA 5EULV 3RBSA 4NNPH 1QRKA 4ORGB 3HJEA 5IGXH 3NIGF 3ZMRA 1YMMA 4MZ2A 3V52H 5EZJB 4L8BB 4D0BB 3VXQA 5EOQH 1OCZB 4NRXA 1HH9A 3Q1SH 5DJDA 3C6SA 5LAPA 1PVHA 3OXRA 2EXWC 2Z93B 4G5ZH 3RZCD 3X1NA 4GAFB 4GRWE 3GRWH 3QFGA 4TTDD 6CGTA 1UHVA 3A4EA 1I9EA 3QUHA 1DQJB 4JL1A 1TMCB 3ZXAC 2FUQA 3MCG1 5A1AA 3R4RA 1BPLB 1AXTH 3ABZA 4GT0A 4LASL 2X2UA 4IBQA 1FVEB 1L6ZA 3EH5B 2F61A 3V6OA 3CSPA 5BJTB 4K5OA 4EIUA 1CGUA 3INOA 3L3GB 1MCJA 3D39A 1AANA 1FCGA 3MODL 3WCYA 1F11A 3FQ1A 4N8VA 1WPCA 1ZVSB 2VWEE 4OLZL 3VWJA 2ERJC 2Q7YB 4FQXD 2K7PA 3ZU8A 5DD1H 4KUZH 2O6DA 2B4CL 5G5DA 2MMXA 3P30H 5G55A 3PWPA 2GC7C 4EI6B 5JW4R 1UFGA 5E4IA 2FZ3B 3S3DB 2P80A 2PTTB 3TNMB 3B7YA 4RMVA 3TBYA 3FTSA 3C6LA 3BGFB 4YPJA 3ZRCC 1GGCL 2ICEA 1I7ZB 4LKCB 4TUOB 1M6OA 1QTPA 5DQ9A 1QTSA 4NWUH 3QULB 4HCRH 3S8GB 2A4ZA 3P73B 2KLRA 2WNXA 2ZKYA 4BUGA 1RERA 4JFDA 1CL7I 1VENA 4WEEA 3A67L 2TSBA 1V10A 5D7EA 3EOBA 2PXYB 3I2CL 2VLLB 2JKRM 3OZKA 4FG0A 3ARDA 4RETB 3U79A 3BIKA 3CZLA 3SE4C 5FW7A 4A55A 2IDTA 3DBXB 4K8RD 3OZLA 4YHNB 3N85H 4PIBA 1P2CA 5CJOL 1HQRB 3TH3T 1Y07A 1M42A 3AREB 4ZT1A 5EA0H 2DQGL 1HHIA 3KGUA 5C0NC 3X1EA 1N8ZB 2LTQB 3QZBA 1A8JH 1KGCE 2YSSA 4FA8A 1AGEA 5KVGL 1VFUA 2G3ZA 5AOLA 2ZUWA 4CU7A 1GZHC 3OQRA 3MTXA 2L04A 1JV5A 3KLHD 3B7SA 5JDJA 4Q89A 2BS9A 5GGTL 4PJCA 2F5AH 4YIQB 4P3CL 4OAWB 3HG1E 3APNA 4MB5A 1FIGH 5DEGA 3PHQA 3F5WA 2X1QA 5J11C 4RFNB 1FNLA 1PU0A 4NRXB 2XTJD 2DLEA 4JBSA 5TFSL 1NBQA 3M1BA 2BVEA 4NFCA 2WNKA 4JY6A 4KH2A 3EBAA 4QRRB 4M02A 3WUWB 3TJPA 5KN5A 4K5LA 4JFSA 2QTEA 1DUZA 4QLWA 5CN3A 3IGUA 1VGKA 2GT9B 1E0OB 3LV3B 5AVWB 2E6JA 2GY7B 4WFFD 1C16B 1CL7H 2VN6A 3NK4A 2VL5A 1SVZA 2C26A 4YFLI 1DLFH 5AZUA 1XCQB 4WWID 5C0AA 4ELMF 3K3QA 1PCXA 3OQ3B 3DETC 3AG4B 4P5SA 5KYWA 1NC2A 3MBEA 2XVBA 2JCCF 4U3XA 4BZ1H 3F85A 3VD5A 3V79C 1NOFA 4CDGC 1U4FA 3D39B 1UM6L 4OZHB 3H7LA 2WWMD 3EJPA 2DQCH 1XXDC 5DZPA 4ZMZA 2VH5L 2V37A 1D5BB 5EH1A 4F7PB 1L5GB 2XNAB 5L8KB 2CLRA 5CFHA 3M86A 1NL0H 1I1CA 5G5DB 4P2CG 2OV0A 1JNNL 4LOEA 3O11A 5CJBA 1W72A 4K7FA 4Y2DA 3PHOA 2WLIA 2X70B 2YD8A 2AVGA 4QDGA 3VXOA 1WH0A 4DUVA 4F80A 5FB8A 2D0FA 1J7VR 2CCVA 5E4EC 5F71A 2WUBL 4G6AD 2MJWA 3TBYB 2DWEA 4Z8FL 3C6LB 4P8QA 1H3GA 3D7PA 2ICEB 2ZAGA 1YEEL 3O6ML 4HIHA 4C4UA 4EJ1C 3CK0H 1KTCA 3FCTB 4M5YL 4N9GA 3FUHA 5B3JF 2E47A 4KRPD 1YQVL 4EZKA 4K5PA 3B8YA 3CVIH 3O2VH 3BH9A 2R69L 4BA0A 1ZK9A 2VWEC 4KH9A 4ODTH 1Z3RA 4N0UA 1JZDC 4OCYL 4C55A 5TDNA 3GSNA 5FKPA 1INDH 4JS7A 2V2WA 5FPIA 3G5ZA 3EOBB 3K6IA 4LBEB 1TTRA 1B3IA 3TA3D 3VWKB 4NJAH 1KN2L 4OFVA 4X0KA 5HDOA 3ARDB 1DZBA 4URTB 5HYJD 3WJJC 4TVPD 2IO5A 4JQIA 5I8CA 4BXSV 2G4GA 2XN2A 4X5XA 1TFHA 2R0WH 2V5MA 3IFLL 4I1PA 4PRPB 3UMNA 5L2JB 1JPSL 1P2CB 4FQ2L 4HU2A 4IYKA 1NCBL 4RSYA 3IVKB 4N2MA 1NKRA 1DFBH 4GNKB 5DJ6A 4F9PC 1Q4NX 1HHIB 1Z66A 4N25A 4LCWD 1G0DA 2LV4A 4HKXA 3QJQB 5ISZE 4Q4EA 1AGEB 1UJ3B 2Z91A 1ASPA 3OR7A 4KGJA 4XMPH 1P53A 4QTHA 4U1HB 4ZO7A 3E9TA 5FUCE 4HC1H 2FT7A 1OAXH 1LDSA 2KPNA 1JK8B 2P8LA 3NT0A 4PJCB 4HJJH 3TO4C 3U48A 3QFDA 5CUSH 4ZW3A 1WAEA 3Q01A 5B1AB 3PHQB 3OLDA 3ILQC 3SD5A 3JTSB 1OY3B 5C8JB 4L2LA 2CIKA 5D6CB 4DP6X 5IHHA 2HN7A 1J48A 2X44D 5FOBB 4IRSD 3BP4A 3OR6A 4E9VA 4GW5A 4KNTA 4P57A 1GPOL 1MFBH 3LS4H 5GRUL 4F7TB 3WSQH 1OT1A 1KFAL 4F37K 1XGTB 1DUZB 3V0HA 1Q9WB 1ACZA 3OBAA 3U6RB 3K6OA 1BD2A 3BP7B 2BVOA 1QACA 2VL5B 3D85B 5F0PB 1WDAA 2PPCA 4IBYA 3MROB 5C0AB 2XN9A 4NZUH 4DZBB 4N2OA 1ZA3B 2B3IA 1I3RB 4IDJL 1I7UA 3T2LA 3DX6A 1NC2B 3T0VA 5LGKA 2OMYA 3B9EA 2R4RL 3CWGA 4TRPH 1QVOB 5FYJE 3Q2VA 3H53A 4NQTA 4JQXA 3V4VH 4GRMB 5I73C 4M7KL 1AOHA 4C58B 1G7LA 1ZMYA 1ADWA 3JV0A 3SE8H 3L17A 2CKBB 2WLLB 3HN3A 3H8NA 2AQSA 3WFZA 3EJUA 4GG6A 2VZVA 1G43A 3BGMA 3O11B 4EI5C 3NIGE 3GIVA 4K7FB 4Y2DB 3PHOB 4Y5XC 4L1BA 5LXVA 5IUSA 1AO7A 4QKTA 2J6EL 3N40P 5FECA 3SCMC 3NMEA 4N0RA 1INEH 3ESOA 3NFNA 3NRPA 3IS0X 1UCTA 1CGWA 4N9GB 5IROA 2EEFA 3QEHA 3FO0L 3QPXL 4MJHA 2JI2A 3D07A 3ULUF 2UY7A 2XVLA 4MCZA 5HJDA 5FYLE 3VJ6A 2GTQA 1SY6H 2LLLA 1VCBC 3IF1B 5B3NA 3MJ9L 4JPQA 4KTDL 4N0UB 8FABB 3GSNB 5FKPB 2EEBA 1KJ3L 1ZDSA 2V2WB 2DICA 1UYWH 1BZQK 4ONFH 2YUVA 5KOVC 3KGTA 3CFDA 3KR3L 3W0WD 1R0AH 3LQAL 4XH2A 5T1MB 5BS0A 2AMGA 4GKSA 2UXGA 5I8CB 5ABDE 5EO9B 1EHLL 1XR8B 4X5XB 3T5WA 2V17H 1CR9H 4ONHA 2ZYHA 4F7MB 2P49B 4ZTPL 1GY1A 1M2OA 1ZTXE 4PJ5E 4WW2F 2BSDA 1G6RA 3ZDXB 4TNGA 5D7JD 1BBDL 3S9DB 5ECGA 4KRLB 2XQYG 1DQQA 3K0WA 4JRXB 3GZKA 2WXRA 1MVUA 4XX1G 3LHAA 5EU3A 2JKSA 4KQ4L 2BIHA 4OZGE 3B8SA 2O5ZH 2VT0A 1A6PA 4AZUA 3N43B 4OF6A 4UYPA 1N70A 4H2CA 2CO7B 1LD9B 5AW0B 1RIHL 3LIUA 2X4SB 2CKBH 5JW4M 3NCXA 3D9AL 5B39G 1HEJC 1YMMD 4NAJA 3OR6B 4GUOA 1QLRB 2H1PL 4PLKD 3VYPA 1P4LA 1U8QB 4NI6A 1TG8A 4DP0X 3P40A 1U95A 1JNLL 3QNXA 4FA7B 1LNUB 1NCWL 5HI4D 6FABL 5K39A 5J56B 2L8AA 1NBCA 3BIBX 5IJKC 2G30A 1E28B 1I9IH 2PYFB 2OSWA 2GUOA 3VTMA 2QDVA 1UM4L 3W82A 1IGFH 1U3NA 3HBZA 3BSZL 4YK4B 3DVIA 2EKSB 4R7LA 3HPLA 2M26A 1OW0A 1MRDL 4MX7A 5DS1A 1X9QA 1NKOA 1I4FB 1P7QB 4H25A 1ONQA 1ZT7A 3MRQB 3FN3A 3CUPA 3W81A 4YL9A 2FEDC 2PWFA 2QV4A 1G7LB 2A9BA 4PSRA 3D39D 3EXLA 3L45A 4I18C 4WSJA 1RMFL 4QXTB 5FHBH 1GVIA 2Z8SA 2WV3A 2IWEA 5DHDA 3WS3A 3VWJD 3VXNA 4YE4L 2EUWA 3C5ZC 3AAZA 1A4BA 4PJGA 1YEGL 2XBDA 3IMTA 4JFEA 3BKML 1S5HB 2VGLM 5HY9B 2YUWA 1UM5H 4ZUSA 4BH8A 1Q1JH 5I24A 1AO7B 2A74C 1FNSL 3PWPD 2AI0L 2DOCA 2IADB 3FSWA 4X6EB 2YMOA 1UWEH 1DANT 4Z5RA 4R4FH 3FPXA 3V8OA 2Y1VA 3C6LD 3P11H 1FL5A 4JPSA 4HUUA 3NAAH 4WAFA 3WJLC 3K6SB 1E2ZA 1OF2A 3HKZA 3P9WB 1G5AA 4PIRF 5F0MB 4ELME 3GI9H 3D2UB 5EIQA 4MCZB 3WAKA 3VJ6B 3KG5A 3M1CA 1FZKB 5IEKA 3VYNA 1KT2B 3IDIA 3H56A 3UTQA 2Y07L 2I26N 2JCCE 4NBXB 3H9HA 3E3QC 1I8LC 1W72L 4LOUD 3QR1A 1MJUL 3U6XS 3CFDB 2H0EA 5D1QB 5JLZB 4XH2B 3ZO9A 1N19A 1HI6B 1MFDL 5C9KA 5CN1A 4X4KA 3RY6C 4HJ1A 3ARDD 5ID0B 2IGFL 3KPRB 4HG4J 2CMRH 4XC3H 3P4MA 4AVJA 5T1LB 4CSZA 1WLHA 4J3OH 1FO0H 1QW8A 2AJ3B 4PRPD 2J8UB 4YEEA 5GRJH 4WI0B 4QRTA 1GGBL 1ML0A 4NFBA 3GXDA 1DQQB 2E27L 2FH8A 2X12A 4ZPTA 3I9AA 4MXQC 4L29B 3UOAB 4L8SA 3CDZA 4B97A 4WNSA 4HJ0D 2DZEA 3CLWA 5KTEL 4B9KC 4I48A 3QXTA 1AD9B 1YY9C 3BP6A 3VXMB 4M6NL 3QEQB 1NBVL 2PLTA 1KCSL 1BAWA 2C9AA 3CU1A 1H3PH 1FFQA 4QTIL 5KBLA 1NAML 5CD5D 1I1RA 2XTJE 4XAKD 1FGVH 2GIMA 4QHPA 3FONB 5KYXB 1P4LB 2WXLA 4AENA 2WAHA 1BEYL 3LRKA 3ZKXC 4JFVA 1CUOA 4G6JL 4MAUL 3UZQA 4A7SA 1TYRA 4H88L 4IKLA 2OX5B 4WFFE 4ZMOA 2ZF9A 3G6JA 4TOYH 5ICUA 3B7TA 4XR8C 3B9AA 5C0AD 3MFFA 2W1NA 2YD9A 3S36L 4X6BB 1E6OL 1NC2D 4H25B 4MB3A 4KVNL 1BQUA 1SQ2N 1I85C 2RACA 3IFOA 1KYUA 3DBSA 4XXCC 5DMJB 2XV6B 3KCPB 1PD1A 4LAQH 4BSJA 1TO4A 3GJFK 3FO2A 1Z5HA 3VFTB 1J8HA 3RZCC 4AQZA 4ZI8A 4OFQA 1BW8A 1K8DA 2K8QA 2VE6A 2IMNA 4TTDC 4H8UA 4PJGB 1VFBB 3C75A 1MF2L 3T0XA 1JZFA 2VOTA 3DPBB 2F54A 3PV6B 4BH8B 3ZTEA 3HMWL 4U6HA 4Y2DD 4NP4L 1YJDH 3ES6B 5C71A 2TSAA 1ZHBA 2W9EH 3BKCH 4OQ1A 1TQCC 3RX7A 2C1PB 4BD4A 3EOAB 2WM0A 3CTTA 2EINB 2EO9A 4ONGH 1T22B 3P4LA 3GD1C 4J27A 5DMIL 3RILA 5AAPA 1A25A 1UD8A 2YAHA 2WXIA 5IB5A 5IR1A 3KVPA 4PJCF 1K3IA 4FQXC 4LLQA 4RGOH 3UJTL 1E8XA 4NYLB 1OZUA 1PZ2A 3NJVA 5LDUA 4ZQKA 5CJQH 5TF0A 5FUOL 2DD8H 1MJ7L 4PBWD 1PKQA 1LWJA 4BQCA 4MDRA 5C7XH 1RIVH 3TLRA 2R0ZH 4TVPE 5HYJE 4B7IA 2XICA 4ZMAT 3ROOA 1IGML 1B9ZA 1E3ZA 4Y5YC 1M1XB 4A6YH 1U30A 3WHE1 1K4DA 1USZA 2AJZB 3ARBB 4NO2A 4APQC 4PJIA 5E08H 3DYMA 1OAYH 1TSRA 3CXFA 3ATFA 4LCWE 4Y4HA 5AL8A 2XC8A 4MCYA 4ODSL 2R59A 1S8DB 1NCAL 5HHXH 5H35B 1UXSB 1TETL 4F24A 4JRXD 4IJ3C 4OFYA 5HD8D 2WC7A 2DAVA 2BXZA 4KI1A 2PYEB 3X3FL 1MOEA 1OCWH 3ALXA 1KBGL 1W6WA 2WZ0A 3CV5A 4K8RC 1VF5C 4N2GA 3C60C 2QVIA 1HOCB 4RGMB 2WO3B 3QUYC 1Z1WA 5D2NA 3AG2B 3LKRB 2CBTA 2GAZA 4EUPA 3APDA 2D9QB 5HI3D 1C5CH 2Q2EB 2XZCL 3L5XL 5EC1A 1IFRA 5HVFB 1ACYL 4NUGL 4UT6L 5LNGA 1X7QB 3PFQA 1BD2D 5J13B 4MJ6A 4TUJA 3KLHC 5D7SH 1R5VA 5B38A 3WTWA 2XN9D 5I1JH 4C4BA 4WI6A 3O4OB 1JGLH 3RJDA 4FZEL 5FDWA 2LVCA 2D7NA 4BCZA 5DHEA 1FFOA 4AQ1A 2XPGB 4G80A 4HISA 4IIQC 4DEPB 4Z3TA 5KYUA 2XTJC 4FX5A 3O3DA 4HS8H 1UCBL 4WI2A 3G5XB 5I6OA 3FO2B 4WCYH 4YC2B 2ZKWA 1ZXQA 3TN0B 1K8DB 1ZHKA 2VE6B 4YGAB 4HJEA 5HHVL 3EYSH 3NACH 3ZL1A 5KSUA 3PWVB 2F54B 1XIWA 3NCCB 5CGYC 1KB5L 3OHXC 2XWRA 1NOAA 3E9UA 5LGYA 3VH8A 3ZDXF 3CXDL 3UPRA 2KT6A 1AO7D 4CA4A 4YDZA 1ZHBB 5FA4B 4LLWA 1DEDA 4Q52A 4F8PA 4OFIA 5C86A 4KWUA 1ASQA 4A2EA 1DVTA 5GSRA 1E27A 3ZT5A 3D09A 2WVVA 2XQBL 5HHMB 3MLRL 2V3DA 1LO5A 5IB5B 5IROD 4ZSOA 4IBUA 3N43F 2WSDA 1HZHL 3SBWA 3UTSA 3D2UD 1HWGB 4H5SB 1AG6A 2VDNL 2Y5TA 2KZ1B 3IJ7A 3B56A 4ZQKB 1WISA 1MAMH 2W07A 1OV8A 3L5JA 4AH2A 3W0WE 1FFPA 3CSGA 2ADFH 3EF7A 3UYRH 1PKQB 2V2TB 4MA8H 4POZD 4BELD 3V9FA 4G6AC 1R33A 4MMZA 3ROOB 5JIDA 4NUQA 1VSCA 4PH8A 5BS0D 3SDCB 3IXAA 2W38A 2FLMA 4K7PY 3KDMB 3RNQB 1K4DB 3FQ2A 1E9OB 2E74C 1OEZW 2DQDH 1GYAA 3QORA 4JCWA 5DJAB 2O5YL 3GSUB 4KO6A 4Y4HB 3MUJA 4P9HH 1IX2A 4P4KA 1GGTA 1JG9A 5AB0A 3NCMA 4JE4B 2FRGP 4YDNA 5JHLA 5AVQB 2G9KA 2GW5A 2GG1A 3L3OB 1OAKH 4DP5X 3KYAA 3TA3C 1OQOA 3GSQA 3SDXA 4HSAC 1F90H 5I1EH 5LBSL 2HTLD 2VYRE 4AZ8A 3A6CL 4NN5B 1FYTB 1FJ1B 1ETA1 3VXMD 1RU9L 2XZAL 3BPNC 2Y24A 1XMWA 5CF3A 3P2TA 3IB4A 1YMME 3GI8H 1KXQA 4P48A 3RJQB 2GAZB 1QZ1A 2VNCA 3VXRA 3ZE0B 1DQVA 5EC1B 1M7IA 2WCPA 3I6KB 4WGWB 5C0BA 4L3CB 3IXTA 1G7HB 1NFAA 2B08A 3NRFA 5DJXA 1HNFA 4B9YA 3LRSA 1OVZA 4K7PH 4PG9A 1JWMB 4S1QL 5B38B 1FH2A 3EO0A 4EBQH 5K9QG 2ATKA 4PW3A 4MZIA 4NZ8A 2BO0A 1KEML 5FDWB 3UTTB 3PP4L 5DA0B 4AYID 1T04A 3TM6A 4PRAB 4AQ1B 2VTFA 3U1SL 5KYUB 1AMXA 4IRSC 3WIIL 4NRZB 4O58H 4HLEA 3AMLA 1PFCA 3U46A 4H8HA 1LL1A 3D39E 5JORB 1X3DA 3LKPB 3OTTA 1FSKB 4WW1A 1LEGA 2VSKB 2AJSH 4FCHA 4XAWH 3T0AA 4A2DA 3FQTB 4XP5H 1XIWB 2AXJA 4UV4L 5DJ2A 2YEZA 3PWPE 4WW2C 2YGOA 3MI6A 1H8OA 1XSOA 2CM6A 2EIZA 4P59H 4DN3H 3UPRB 1QFUL 3DRTB 3ARZA 5HJ3B 4NZTL 4GIPD 4LP4A 3WFDH 1DZ0A 1SF3A 1Y1DA 3VSVA 1P6AB 3GMMA 3GBDA 1AGFB 3ZDYF 4N2HA 3O81A 5B4MD 5ICXA 2A73A 1WJ3A 3NZHL 4CKQA 1FGNL 4ZSOB 2RFXB 4U1NB 5K93A 2EIBA 2VLJB 3UTSB 3BCFA 3MHZA 2E8YA 2XV2A 3ARFA 3NEOA 3DX0A 4MCNA 4HKZB 4NZRH 4PJ7A 2ODIA 2HUHA 2UWEA 1FFPB 3IRZA 1D9KA 1GC1H 1IM9B 3JTTA 3HG2A 2IAMA 2Y3AA 3QUXA 4U3HA 4G8AC 4WV1C 3KLKA 4MMZB 4BIKA 1WBXA 4FHJA 2YQBA 3TVMA 5EOCH 2BNQA 1SJVA 2HJKA 2W91A 3BVNB 1WQVT 5E1QA 4XP6H 3PG2A 5HDRA 1NDMB 2Y2YA 1PD0A 5CIPA 4G7RB 1KGWA 2OQJB 4PRPE 1TPXB 1FNHA 3CDFA 4L5FH 5F7FA 1YN7A 3LNEA 1JDAA 4B9CA 1KULA 3HG4A 3RVXD 4OR1A 2WJ7A 2HPOA 3J07A 3X14B 5B39B 2BC4B 1S5IH 3UAEA 4ANXA 2ALAA 3QAZC 4QI3A 4MRBA 1RCYA 5AYUL 2XYCA 3RWDA 1OAQH 3B9DA 3SDXB 1XCTB 4GW4A 4KO5A 1TSHA 3ZKSD 4PJCE 2OL3A 4HT1H 3WTSA 35C8H 2Z6FA 3L54A 1LMIA 4TSCH 1D3CA 2CBOA 5IEHA 4PJGF 4U6VL 3JYBA 4XAKE 2L7QA 5AKVA 1Y7VA 3MACL 3U7YH 5ICZB 1B4RA 5D7JC 4JDVA 4K94H 3QHZL 3WXVL 3FU3A 4KKZA 2IANB 1BPVA 4ZFFB 1LK3L 1JGUL 1H6UA 2NYYD 3QQ4A 5C0BB 2WQVA 4X98A 2UZIH 4H0HB 5DJXB 1NGYA 2ZXCA 4G71B 3PGDB 5IW3A 1KF9B 5DJCB 3QIWA 5C0AE 5AKSA 4B0MB 1AHWA 2ZG2A 1NPUA 2QADC 4UNTA 4K73A 5F97E 2EIDA 5JHDB 3S96B 1ZVYA 2QEJA 1EBPA 2IH8A 3FO9B 4X80H 1CVSC 1W2KT 1RHHB 1D6VH 1IBDA 3FQYA 3KWWA 3SDYL 2DQEH 2IWKA 4YGVB 3U46B 4WWNA 2VJ0A 3BVVA 4O2EB 5E2UH 1JCVA 3BLPX 3VFMA 4UIMA 1SN5A 3UP6A 4O02L 3Q05A 1ERNA 4L1SA 5HI4C 1U8LB 3LHPL 3TN0D 3Q8EA 4X6CB 1JZJA 2FTAA 2EVIA 3HZVA 2C7UA 2VUYA 4U2ZA 4NCDA 5MI0B 4PRIB 2F54D 2FWOB 3VSQA 4MMYA 2ZWKA 1DEEA 2Q20A 3AROA 4UT9A 5IHBA 1VLXA 4P2AA 5CEZH 3V6OC 4X6DA 4RMBA 3CHRA 5FWRA 3BYYA 1TQBB 3GMMB 3PABA 1GGIH 4YHOH 5AYQA 4ENED 3ZUCA 5C70A 3H9ZA 3GXTA 5ICXB 4XBEH 5SX5K 3S37X 4D0CB 4FQIL 5HHMD 4AYDC 5JMOC 3DX1A 3QDJA 3QFJA 3RPBA 4EVNB 1X9LA 3VWJC 5INDB 1HDMB 4NO0B 2Q0ZX 3QJFB 4JMNA 4N0UE 4UM9A 1T20A 3ALWA 5IBTH 1R5WA 3RIFF 3ARQA 3MYJB 2Z92A 1U58A 1WBXB 3LQAC 3EW3B 3L1FA 2O61A 2BNQB 2ODHA 5ACLA 1Z6JT 1IC7L 3Q3GB 2YN3A 4JHAL 3SDCD 4O5LL 3FC8A 4KTEH 5M7QA 3G6JF 3E6HB 1YN7B 4MA3B 4UNVA 3ZDXE 5C0CB 1X5YA 5DT1L 1JGVL 3KAAA 4Y4HD 2MNUA 3AS0A 4YXHH 4JRXE 5M94B 3D0AA 3V9EA 3PJSA 1SJEB 1KWKA 4LOUC 5T3ZL 1XSIA 2QZ5A 4FQPA 4OFYD 2ADYA 2WINA 3T4AB 4O2CB 3V6ZB 3RWDB 5DC4B 4OTXL 2LT9A 1RJLA 4FMKA 3L7FA 4LB8A 5IMLB 4HGWA 4YH6A 5H4ZA 3AXHA 4Q6IC 5FFOA 4IMLA 1FIEA 1L9RA 2EYRA 5TGBB 1CLZL 1KPVA 4MD0B 4GSDH 2FDBP 4PLJD 5KSVB 3GJEB 1D5IL 3MRKA 2W81C 3UG3A 1U8PA 2X4OB 4PJHA 3QI9A 4BWWA 4Y1AA 3APCA 5IB1B 3VO0A 5KEZA 2NY6D 1K8IB 1QLFB 5F9OL 2N7AA 4OU3A 5C6TL 2NDFA 1DVQA 1NGYB 3EUUA 1BD2E 4HJ0C 5JDSB 4E9QA 1C1EH 3BT0A 3TIEA 1X5MA 1WTLA 2VXUL 3TYGL 2XN9E 1AHWB 3MLVH 3WEMA 5EWIH 2HRLA 3BH8B 3P9LB 1OSYA 3F2LA 3WIHH 1EFXA 4XNUH 5I1HH 5DD6B 4HIJB 1EEQA 1J9CT 1DJHA 5EN2A 4C56A 2J57A 4R7NA 3IDYC 4UIMB 2DJUA 1QI4A 2VR5A 4FXGB 2FQDA 3N2JA 2JF1A 4JN1L 1MXDA 2X4NA 3FQNA 2YPVL 1OHZA 3UC0L 2ZXGA 2VSDA 3MRIA 4L4VB 1UEYA 1XIWD 4MMYB 4PJ6A 2PWDA 1AO7E 1NOLA 5I1IL 5K9JH 2I9TA 1PX8A 5I8EB 2C3GA 3WY1A 4N24A 3KNBA 1N2RB 3INUL 4QXVA 1O7VA 3FU5A 4OLEA 2J21A 2C5DC 3MBEC 4PWFA 5EBGA 2GSGA 4I9XA 2WQSA 3ZTNL 2D03H 4GQQA 4QLRA 2ZCKL 3FL7A 4GQPH 2WZPA 2H3KA 4MA7L 3BZEA 4J8QA 4HBQA 5IVOA 1LP9B 3OSKA 3QFJB 4AK2A 3JWDC 2GJRA 2WLHA 3UTSD 4Y9CA 2WWKT 3J7HA 1P0SE 1X4ZA 3EDDA 5IW6A 3BE1H 3T71A 2A6JA 2FWLB 2MOQA 1BZEA 1QNZH 1GSKA 1U58B 2ENQA 2X3BA 4FN0A 4RBPH 3S5YA 5BS0E 2O61B 5J0BA 5HYSG 1QHQA 2J5LB 5IVZA 2DEWX 3GDBA 5ES4B 4YHKH 2NX5B 3O3AB 2JCWA 4LSRH 2E4FA 5GS2H 2HT3C 2M83A 3QORD 4P23C 3C8KB 3G9AB 3K72B 1EJ8A 2EDEA 3STZA 1JZ2A 1HHKA 4HCRA 2YMTA 4HXAL 3PJSB 4P4KD 3W5NA 4IHOB 3L9BA 2WQWA 4ES8A 2XN1A 2N7BA 2WINB 4KKAC 3N91A 4JB9L 3ZDYE 3L7FB 3R06B 2AJXH 4KXAA 4X4YA 3KM1A 2EDTA 4JKLA 3TURA 3BUTA 1BWWA 3VXME 4IMLB 4HKBB 1K5WA 3UYPB 1LMKA 3WLWD 1UKTA 2OR7A 3FUFA 4HZLA 1WCBA 4HIXL 2JTYA 2WWNA 3CN2A 3KDPB 4OD2A 3WFHA 4CVXA 2JTDA 3QI9B 2OR9L 4PTTB 4R83A 3A6BH 1QFWM 1QWHA 3PF2A 2VDQH 3FHAA 1IBBA 4H8WH 3VXRD 4DW2H 1UACL 2TAAA 3MJGX 4YLCA 4FTVA 5JYLA 4GBXB 3UIZA 4DUXA 5AFAA 1EZVY 2WXGA 1HT6A 5ECJE 5C0BD 3WIFA 3SKJL 5JQ6H 3GGWB 4IRZH 5D8JH 1D5XA 4QHNA 1VJSA 1FL6A 2PR9A 3DUHA 3PJLA 3VACA 5J1TC 2WUCL 1FDLH 4BXVA 3U30C 2D7TH 4XWGL 3EGDA 4I2XB 5LGJB 3U4KA 4DKEL 3OC5A 4WSGA 2VZTA 1ETZA 2C9QA 3DKHA 2VXTL 2W88A 1QWUA 3BAKA 5EN2B 3S37H 4CW1A 2YUZA 1XXFC 4DGVL 2QJDA 3ZZSA 4ZMLA 2WQ8A 1I8IB 2DQ6A 2NTSP 4AGOA 5CAYB 1JYNA 4EN3A 4MXVF 4PJGE 3E0GA 3LVEA 1UOWA 4HWBL 3MRIB 3KJ4C 1GGUA 4JY4B 1CXHA 5DWPA 3P02A 4I77H 1M2VB 3RUGB 4PY8I 1RURL 1RUQH 1U92A 1XZWA 1NGXA 2QGEA 5I1DA 3QIBA 3JV6B 5AVZB 1RPKA 2GSGB 1RZJH 2P9RA 4KO7A 4AC2A 1YCSA 2YKLL 1RZ7L 1PLGL 2E56A 3H2PA 4LLUA 4PB0H 5DHYA 2Z9TA 5E1GA 1DQLL 4M62H 1XF2B 3SDXF 2B9BA 3BZEB 3Q5TA 1RSFA 3E2HB 3CDCA 4ONOA 3NP4A 2E86A 3IJSA 2ZKHL 4KU1A 2WB7A 4OM1H 2P8MA 3ARFD 3MLXH 5FEBA 3DIVA 1IC0A 1TNNA 2OMTA 4DKTA 2IIJA 2F1AA 3GSXB 1D9KD 1Q9OB 3ESPA 3UH8A 2OBGA 3QUXD 3ET9F 5GS0L 5CJ8A 1MWAA 3NUKA 3U4AA 3MCLL 3TVMD 1SZNA 4MSWA 2BNQD 5IVZB 4JCMA 1LGVA 5FGBA 3QG6B 1J1PL 4ZPVB 2JH2A 3DWTA 3V7AE 5IROC 4QRPA 3FU7A 4YHZH 2OI9B 2FYYA 4FQQB 1E4XH 5I66A 2HFFA 5E5RB 2AQRA 4U1JA 2PP8A 1KELL 3MV01 3K5SA 4L8DB 1YECL 3H3BC 1JGEA 3HB3C 3RA7H 2FLBT 4Z18A 2J5WA 3VD7A 3SDAC 4D8PA 2Z4QA 3OKNB 4JM0A 1JXJA 2XZQL 4IKJA 3RY4A 5JYMA 1UG9A 4FJZA 1SLVA 4LNRA 3MUGA 3BUBA 3BW9B 4OD2B 3BT2H 3WFHB 3RDTA 4JKPL 1WC7B 4M1CC 4NUPA 2MFNA 2ZWLT 4PD4K 5DUML 3BQVA 1MEXL 1RUPH 4U1GB 2ADIA 2J1XA 3PUCA 2V7HB 4OLXH 1KTLB 5GGSY 3CFUA 7TAAA 2CK0H 2FYVA 3G6JE 2IOIA 5CZXD 2I60H 1AQMA 1OF0A 3AJ7A 4IMKA 4PQXA 5K9QI 4LRNH 5T1DH 4HIQA 2FQFA 2HTLC 3CN4A 3C08H 3QIWD 2X4UB 4HC1A 4XCEB 1UZGA 1HILB 3EGDB 3G08A 4MASA 4OCSL 2YQGA 5C9JA 2R56H 5CBAA 3RFZA 4PMFA 3EJTA 5DK2B 1KBVA 1HYRC 1S9VB 4P3WA 3O6FB 4L3EA 1OT2A 2UWEF 3VXUB 3H85A 4TV3A 4DKAA 1AQKL 1T0NA 1DLHA 4K2UH 1XB6A 4U0QB 2Y4SA 5JO5B 1AZUA 3JWNE 3BD4A 4EN3B 3DROA 3RB7A 2XBTA 3KJ6L 5EN3A 1CU4H 4FERA 5L4IA 2F54E 4HK0A 4X7CC 2RCSL 5FO9A 1E9QA 2JJUA 1C7TA 1EAPB 2OXHA 2WO4A 2YAMA 2QPUA 3D87B 3O9WB 3VG0L 5ABZA 1RK0A 4OF8A 4PREA 4DVRH 1OW0C 5IQ7L 4C4KO 4QAWA 3QIUB 1ZWIA 1ZCRA 3MV8A 3Q5OA 4NKDB 1L9TA 1OZTG 4NNPL 3CC5B 5CCJA 3L4CA 1A7RH 5CGBA 2FIRT 3D50A 1TJHH 3V52L 5HHME 1BVLA 4JM2A 5EOQL 4QHKI 2XWTB 1QUPA 3IJSB 3IFPA 4B9JA 4ENZA 1ILSA 3QDJD 3QFJD 4G5ZL 3OSVA 3DUSB 5B21A 3RWIA 3GRWL 4LLDA 5KSBB 2DIEA 3MX0B 4UM9D 2OMTB 4L48A 4G6FB 3N06B 4L0PB 1TJXA 3U7WH 5LHDA 5FAAA 1PKQE 1AXTL 1Z32X 3RIAK 1ZSHA 4CILA 4FFYA 4XMVA 2QLYA 3R19A 1MWAB 4NN6C 1F6AA 1NCJA 2XXMB 1X6NA 3WEXA 3AADB 3F6LA 3MRHA 2ZSVB 2X10A 4AYFB 1GTFA 2CJ3A 3MRDA 3X13A 1YG9A 1YYMH 1SHXA 3FU7B 3B34A 4QRPB 2A38A 2FYYB 4Z7AA 2HFFB 3T2OA 2QSCH 5E95B 2DW5A 2AEPH 5DD1L 4KUZL 4M56A 5B8CC 4FOMA 5IVNA 1FFTB 1OPGH 4I8DA 4WU5A 4AVKA 4YDIH 5FYKD 5C6PB 3M17A 1I7TB 2GTWB 3TZVB 4LNRB 1VIWA 4YLQT 5J6GB 1R4XA 2CO4A 3QRGH 3HI6H 4YLBA 4BE5A 1BBJB 2FGZA 2A6IA 3ZQWA 5D2NE 3RDTB 1U8MB 4JJ5A 3V7MA 3CVHB 1IKNC 1QO3B 3RVXC 3QI9D 3P0VH 1CXEA 2SEBB 4Y1AD