3R19A

Chicken sulfite oxidase triple mutant with altered activity and substrate affinity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGMLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite oxidase
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 95
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r19A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r19A01
3HBQA 4PW9A 2C9XA 2A9CA 3R19A 2BIIA 2A99A 2BLFA 3HBGA 2A9DA 1OGPA 2A9AA 2BPBA 3R18A 1SOXA 1XDYA 3HC2A 2CA3A 2XTSA 1XDQA 4PW3A 2CA4A 2BIHA 2A9BA 3HBPA
chains in the Genus database with same CATH superfamily
3FHEA 3UTQB 3Q8EA 3TBVB 4G8GE 5CEZH 5IUCA 1GYAA 4FCHA 1YAZA 2Z7ZA 4LIQL 1MAJA 4WHTB 4CUCA 1M7IB 1RZFL 5SV3A 3APNA 4YHPB 4AVJA 2V5SA 2XX1A 3IJ8A 2FQDA 4TSAH 3UADA 2ZCHH 4O2FB 5L2KD 4LIQH 4ELME 5I1AA 2VLKA 3DWTA 3RRQA 4NZFA 5C92A 2EDEA 4HHGA 1NCBL 4N2MA 3LS4L 1NDMB 1BVOA 2QJDA 2VSCA 3KPQB 1I7TA 1OGSA 3WEOA 4PMEA 3D0LB 3VXSE 4AQEB 1NCBH 4M4PA 3DA0A 3DJZA 3VFGL 4DUVA 4KK6C 2CHXA 3AABA 4G42A 4C59B 4NHCH 5LQBL 2V5RA 2BP3A 3X11B 4FFZH 4QT5B 3DHUA 3JYCA 3WJMA 3HB3B 3CFJA 2BSSB 2A9BA 2PR9A 1I3RB 3TN0C 4G1MA 4NO2A 4I2XA 1DJIA 3BLBA 3S3SA 3U36A 2W92A 3LEYH 3LZLA 3CQFA 1FHNA 3JTBA 4DKDC 3QJHA 4LP8A 2YA0A 4FQ1L 1F11A 5HYSG 3QISA 4PR5A 2WY3B 2F7IA 3KH4A 2RB8A 4M48H 4WI2A 1IAIM 2YMOA 1KCWA 3UERA 1T0MA 1FLTX 1MREL 4MZ2A 1IARB 4FFWD 4FQ1H 4GEIA 1XIWD 4FKEA 4N86A 4N24A 5EPMA 4NZUH 3G5ZA 3M8OH 7PCYA 5K9KB 4FZEL 1JNHA 3ULUH 5A16A 1EXHA 1MREH 1LEIB 2BLFA 4NKMA 4EXPX 1SBBA 5IF0A 4JM2F 4FZEH 3HLAA 3RKDC 4JVUA 2Z92A 3BEWA 4N0FB 5G2NA 4TVUA 4CN6A 2D03H 3B2UC 2DEYX 4NC1E 4KKCD 1A6UL 1YQVH 2LU4A 2ZKHL 3M17A 2G2RA 1B0GA 1IAKA 4NZRL 4XVOA 3K71B 4XPBH 2YGPA 4PU2A 3ULUC 4NCC2 1KTDA 4LFHG 1K5WA 1WFJA 4JQXA 5EIQA 1KYDA 4M93B 3BP4A 4PBWD 3EYSL 4U3XA 3ZL4L 4CU6A 3PABB 3KPLA 2YOCA 1LO0H 1NM4A 3G6JF 1F13A 1U8NA 2CM5A 3EYSH 4GSUA 3ZKND 2HPOA 3T0AA 1BVZA 1PFOA 3BUTA 3MA9H 1BMZA 3K2KA 4N85A 3RIFK 4Q6YA 3WFEL 1A5FL 1AJ7H 5B4MD 2XUWA 3G6JE 4K7PY 5DUML 5HGDA 1A7PL 2NY0C 3WFEH 3PNWB 3GSUB 1HIML 1KJ2H 2WUBH 3PY9A 1RUAH 3BH9B 3BT2L 3IRCA 5DUMH 3CFTA 2Y22A 3G3LA 3HC3L 3DSNB 2G4EA 3DIFB 1EO7A 5CSBA 5J1AA 2NY3B 5E6IB 3O0RL 2A0LD 4UNIA 1GCFA 3BT2H 1T0OA 4YEEA 2PTTB 4G7QB 1OO2A 1JG9A 2CCLA 1CLCA 1G9NH 4MS8C 2LABA 4I48B 5C0JA 2OW6A 3ARGA 1FL6B 5HI5D 3D25A 1KZYA 4QXGH 2XV3A 3IJYB 3HFFA 1SOSA 5I1JH 2EAEA 4ZO7A 3WAKA 2H6UA 1BQKA 3N0PB 5JZ7C 3EHBD 1F00I 2X4UA 3GLZA 4OZFA 2BIOA 2EZ0D 4MXQC 1UT9A 3RE0A 4BZ1A 1OB1B 2DQTH 4BUGA 4M6OH 4YHZH 4B53A 2CGZA 1BVNT 4XP5H 3QS3A 4BYHA 4Z7NF 3AXLB 3QZOA 1NMBL 4LSTH 4RFOH 3ESVF 4G80A 3QJFB 4TSBH 5DZOA 3TXAA 4NZ8A 5I0VA 1SVCP 4HOZA 4DPCX 4RMWA 4QGTA 1BD2A 1EX0A 1Q9LB 3LJ3A 3CXHJ 2BFVH 2QTVA 1YNTF 4P2QE 3UBHA 4F7PA 1Z2KA 2D0GA 2GI0A 2ZOOA 3MUHL 4PD4K 3L3IA 5AW4B 4MAYD 3SOBL 3UYRL 4IGBB 2VC2H 4QI3A 5JLZA 4EN3B 2IH1A 2R4SH 4KK9D 4JFFB 1W91A 4KDTA 5BQ7B 2CKBL 3GBML 1HSAA 5LAXB 4UOQA 3L3GA 1YPZF 2E7MA 5E1HB 2JI2A 2WQXA 4X5XA 5ID0B 5LN8A 2CKBH 3DECA 1I8LA 3BJLA 3ALXA 3AM8C 3EYVB 3O45A 5BOJA 5EEUA 3BISA 3MRNB 4WNQB 5E56A 3VI4B 4F7TA 1UUNA 2F5AL 4KZEL 1PGRB 1YPZE 1VEOA 3PJNA 1KCVH 1A6VH 5HYJB 1OCWL 4LLQA 3JV6A 4MCYA 3BZ4B 1PG7W 1BZOA 2R0ZH 3DOSB 2PP7A 3U1PA 3JZ7A 3LN9A 3JQOB 3VFUB 4XNYL 3U1SL 1VPOH 2IAMD 2XETA 1QD0A 4JRYD 4PJ8B 1HHIB 5B3SB 1OEZW 1N2RA 2CDFA 1WBZA 2WO3B 2BPBA 3TONA 5EORL 2F9BT 1WCBB 2X2HA 4IRJA 3SKOB 5JXED 1KPRA 2BSCA 3MTRA 1JUFB 3B56A 2AXWA 2WCGA 4LCCC 4GKLA 3DDFA 5DD6A 2BJML 2VXQA 1QLEL 3V6ZB 1BVLB 2OSLB 2WTOA 4KKBD 5CSZA 3ZL1A 4WTWA 2QGBA 1PZ2A 4FA7B 5GS2H 4Z7UA 1YECL 4YFDB 4P2OC 5HSFA 4X4ZA 1XAKA 4L29B 4L2LA 4JAMA 2MH4A 4DW2H 3IF1B 4KJWC 4Y89A 4RA0C 4W9KC 5IREA 1WK0A 1E65A 2B77A 1E27A 4H26B 3W37A 3EF4A 1U92B 4Y19B 4OGYH 4JGJA 4WWID 1MNNA 3PJSA 3D6GA 1MIEL 2GTWB 4UT9A 2GJ6B 4MAUH 1UJ3C 4OIAA 3PE9A 4TQEH 3QUXD 4KHXL 4U6YA 1E4KA 2Y6SD 3KLHC 4GRWH 4LLYB 1A6AB 1OAKL 4S1DC 4FAAB 3TZVC 2B1HH 1KB9K 1U58A 4PJAB 3IDMA 3M6DA 4Y4HA 4BA8A 2V5TA 4PYHA 2QVFB 4JJ5B 4NPYB 4MDJA 2R2EA 4X99A 4L3FA 4HJGA 3VFRA 4OZ4A 2V3EA 3MBXH 2NMSA 4C47A 4ABWA 2G60H 3SDAB 4PJHB 4D3CL 1ES0B 1CLYL 3LRSA 2M8XA 3Q6GL 1PZCA 4GQQA 5F88B 3E9UA 3AREB 4XCNB 4HZLB 4NBXB 5FHBH 4HKXA 4D7PA 2HUEA 2OA9A 4HUUA 1E3XA 4KKQA 3Q6GH 4MXWL 2X4TA 3K6IA 1N6QH 3X1NA 4N25A 4D9RD 2D3JA 3DO7B 4MMYB 3TPUA 3DXAD 4MXWH 1RJLB 3PCYA 1AXSA 5HHOE 4ZD3H 1KXTA 1LJMA 1OAQL 5HDOA 5LDSA 3DJRA 4HIQA 5DHVA 3QULB 5C0CE 1OAQH 1XVSA 1RCYA 2B08A 1AD9A 5KBNC 3MGTB 3X14A 3P77B 5D7LB 2ZWLT 1KZQA 5IJDC 1JGDA 3K6FA 5KSUA 3LDBB 2X9XA 1L0QA 5EO0A 4J2QA 4D0BA 5ISZB 1YMME 3MRQB 2H3XC 1UT1A 2VDOL 3QR2A 3RNQA 1IBGL 3S3JA 2W07A 2Y5EA 3I6GA 5MEOA 1B90A 3HNSH 4PRAB 3RWEA 1TZHA 3ZE2B 4OV5B 2XWJA 3DROA 1WA1X 2YFOA 5IB4A 4R97B 3AUVA 4F8QA 4H25B 4FQ2H 3WKML 3MJ8B 5EZIH 3TASA 3MNVB 4LQFH 4UQDA 4D7BA 2H8PB 3Q0HA 4RMVA 4JFEE 2C9VA 4NN7C 5C0AD 4NHUB 4H5SA 1E6OL 3MRLA 3FT2A 2Z8WC 4RGMC 5EZLA 3MYZA 3OKEB 4E5XA 3TF4A 4MLSA 5IG7A 4KX9A 4F7MB 3CZSA 3BWUC 4P5MA 4AVIA 4IBYA 3QFJE 2ZSVB 4NAMA 2IDTA 3UJTL 2YBRA 4MJID 5FA3B 2W0KA 2N7SA 3ATDA 1TTGA 4U1MA 1RAMA 1Z5LA 2D2OA 3ARXA 5CWSB 1R3IH 1I9JH 3MV8E 1MCWM 1OTSD 3GS7A 1P1ZB 1NLDH 4LNVA 2JMRA 5D1ZI 5BRZA 1RXLA 3DTDA 3WXVH 2BVPA 3IN0A 4LRIC 5LNGA 1A3RL 5IIEB 5T3XE 5CLWA 3D2UD 4OCWL 4X6EA 2NR6C 4O02B 1FL5B 3QUYA 5EU4B 5J11B 1AHMA 1FBIL 4TQIA 3U4KA 2BZDA 3AG3B 1JL8A 4J27A 3TVMC 3NUKA 2NSQA 3N9GL 1TJMA 2VH5L 2UUDK 4ILDA 1MW0A 2PCFA 4WUKH 2WN2A 3GKZA 2Y7OA 4G59C 4MMZB 3OGCA 3N43F 4K3EH 3N9GH 5ITBL 2E8YA 2JE8A 3KWWB 4ENEC 2QDVA 4F3FB 1FVCB 4PRIB 1MUJA 1TJXA 3EGSB 4G1EA 3H42H 4MBOA 5AOZA 5HYIA 1Q4NX 3TN0A 4AZ8A 1WZKA 4IKNA 1DP0A 1KCUH 4P2CG 5IOPA 1CYGA 1MLCA 1A3LL 4G9DA 4N8UA 3V5HA 4DJMA 5FB8A 3WD5H 4XCEB 3FQTB 1SN2A 4L8SB 1FRGH 3BDXA 3AWFA 4RX4D 3M1BA 4J8RB 3WFHB 1D6EB 3CZEA 4FFZA 4BSWB 4F20A 2Z3FA 3GSXB 2P7TB 5E70A 2ZP9A 8FABB 1GS6X 1G7QA 3MJ7A 3QWNA 1X5LA 4LLUB 4QRPE 1EZVX 1TJGH 1FNFA 1KBBA 1T66C 3LEVL 5L88L 2ATKA 5DO8A 5IHWA 2G75B 5L8JB 3VX1A 4K94L 1OAUL 3GTVA 1FG2B 3WTXA 3ABZA 2QGCA 3NAAL 3CDCA 1U2HA 3ABGA 1BJ8A 5I0XA 2VUKA 1GTFA 2YXWA 3CZUB 5DLML 1CGYA 2ADGB 4TUOA 3NAAH 4WFGD 4B0MM 2ADFH 4OD2B 4HEME 4C56D 3RWGB 1N70A 3U7WH 3IMUA 1MCPH 2MQ0A 3LRHA 1JF5A 3KYNA 2WXKA 4KTDH 1JI1A 1ADQL 3HLKA 3NIGB 5IFAL 3QPQC 4WJKB 2EVJA 1RURH 2QQLH 2WD0A 3AROA 3WENA 5JW4Q 5CUSH 1S9WA 4ODTL 1BIHA 1TO4A 2J20A 4HF5L 4K94C 2QLYA 1X5IA 5IFAH 2ICWJ 2GCYA 3T0XA 1ZPUA 4H0GA 4E5XG 2VM3A 2PF6A 2VLKB 2AW2A 4HF5H 4QJ4B 2UWEF 4IEFA 2CPCA 4XP4L 4JFDE 2VXVH 4LMQI 3ECQA 4RAVA 3S37L 1JPTL 5JIHA 5IHBA 1I7TB 2WKLA 4XP4H 5CP3H 5DVKA 3VXRE 5D1XD 2AJYL 1YYCA 1MIML 3IGKA 4L5FH 2UWEE 3QDJE 5DU7A 1S2EA 3SQOL 4XPGL 4X83A 3UO1H 4G42B 1QRNA 3GXDA 1EFXA 3LKSA 2XZZA 2R51A 1SMAA 3OR7A 4HXBH 4JFSA 4XPGH 3UBFA 4JCMA 3BRGC 1C1EH 3WJMB 4JY5L 5C07E 2GY7B 4NI6A 1BZDA 3CFJB 3FSZA 4Z8FH 1HL9A 1D5ZA 2E4FA 5EA0H 5DS1A 4G1MB 4S11A 4ONHA 4NO2B 2YK1L 4I2XB 4YSAA 5I1HL 4AMXA 3RP1A 3BPOC 3N41B 3U36B 1W16A 1MKFA 2WNWA 1KJ2A 3CVBA 2W9LA 3I50H 2DTSA 1HESA 3ILEA 2Y1YA 1KGIA 3W9EA 4M3KB 1BQ5A 3QJHB 3KDMA 4P49A 1F11B 3FTSA 5MEQA 3KXFE 4PR5B 4F8PA 4A55A 4HLZG 2CR0A 2AQNA 2ROXA 4PY8J 3FB6A 1T0MB 3A24A 3GSWA 2XTJC 1I3VA 2WXOA 2N1KA 1VACA 5EPMB 4OFIA 1GYWA 4P57A 3G5ZB 5KVGE 1JNHB 1H8LA 5A16B 5F9AC 2YPLA 3LPPA 4NKMB 4LP5A 2CLVA 3JWDL 5IF0B 1E43A 2K8MA 4TXVB 3VXMD 3ARQA 5F7UA 3HLAB 2DWXA 2Z92B 3BEWB 4XPFH 2IWFA 4RA3A 3RURA 3OKLA 4PLJD 5DZAA 4GKSA 3VDBA 3M17B 2BH0A 4DF9A 2G2RB 1B0GB 1IAKB 2X2YA 3AM8A 3AG2B 4F2MA 1QPPA 4YHOL 4GSXA 4WU7A 5EO9A 5F96H 4BFFA 1KTDB 3ZMNA 2NXYB 5KYXA 1M3IA 5DHMC 4P04A 5FCSH 2PWEA 2X9ZA 3LKPA 1MZZA 1JGLH 3BP4B 3PAVA 1JZDC 4XGZA 1QZNA 4HUCA 2FX7H 4NAQA 1JGIA 5CLYA 2GB2A 3JVFC 1A6PA 2PYED 3JWDC 3O4LA 2GJJA 4YIQA 3BZFA 4E41D 3KPLB 1A65A 3C09C 3LNFA 1U8NB 2CKBA 5KYYA 2FR4A 1W8OA 2KMWA 3TF7C 1OGAE 3ZMEA 1TNMA 2N7AA 2I85A 3HS9A 3FN9A 1M3JA 2MKWA 1PZAA 1SUHA 4GUCA 1AIFA 3U2SA 1VGEL 1CXEA 3MTXA 4LCCA 5HHNA 5HGDB 1OP9A 3QZNA 3WNPA 2WCSA 5L4JA 4WDIA 4P2OA 2CIIA 1IGCL 4ONGH 1KBWA 1UEMA 1ZLSH 5J1AB 3BUQA 2VSMB 4FG2A 2QVKA 5C0BD 2D2CC 1YNKH 5C0JB 3ARGB 5F0LB 3MV9E 4WI8A 3EJCA 3D25B 5IFJA 4XP1H 1JXJA 1H3TA 1UJ3A 1BBJA 2SEBA 5HDBB 1A4BA 4WWKD 2A9MH 3WUWG 4ODVL 4DOHB 4YDVA 2HVKA 3TZVA 1PKOA 4OM1L 3RA7L 2X4UB 1A25A 4OZFB 1UACL 2E6PA 4RDBA 1N64H 4NM8L 4JPKH 1FZMA 2N0MA 4OJEH 4ALAH 4DN4L 1UA6H 3UG4A 4G80B 3W5NA 1QFUL 1UACH 3QPKA 1EJOH 3J8F7 4YDJA 5GSVA 3FXIC 1NBZA 2KDYA 2WAQA 4FNRA 4HT1H 1BD2B 1EERB 2ZCKL 1AOZA 1UM6L 2ZSWA 3WNKA 2VW7A 4BSJA 4PFEA 4JFTA 4F7PB 4QRUA 3L3IB 3C60C 3PWJA 5H37G 5I5IA 2ITEA 5J0BA 1CQKA 3CHRA 4MZ3A 1HL5A 2VN5A 5JLZB 2F8IA 2IH1B 4YWGL 3QQNA 2E27H 2IADA 3T3PF 4NI3A 3OC8A 3LPGA 3ZQXA 3EJSA 4CDHA 3RY4A 3L3GB 5FYJE 2J1YA 3GM0A 4X5XB 4UANA 3VTTA 3QRLA 3ARRA 1IAII 1WP6A 3BO8A 3OMIB 1GZPA 4NIKB 3RVXD 1MHEA 1SMDA 1NDGA 2JKIS 3DX7A 1TJHL 3T3PE 3O2VH 4NUJA 1H3WM 2GYSA 3OZKA 4F7TB 2XKSA 4GAFB 1QSFD 2EXSA 4OIIH 5CGYD 4H1LH 3B9VA 1TJHH 4K2UL 4NS0A 1U8QA 2PPAA 1EZUA 1NGQL 2QEJA 3GRWL 3JV6B 1T1ZA 4LLQB 3AUWB 4MCYB 4KKAC 1BM7A 1BHGA 1AQDA 4MTMA 3CCHA 3SPGA 2EECA 4O51A 4ZMOA 4LO9A 1KCKA 2FGWL 3VQMA 5B1BB 5GZOD 2LAAA 3B2MA 4FQJL 1N2RB 2CDFB 3NSDA 1WBZB 4N2IA 2OJZH 1ESOA 2FGWH 3RKPA 3QG6A 4J5VA 9CGTA 1JOIA 2UY6A 2WLKA 1UXLA 1KPRB 1OAXL 4LSUH 1ECYA 3OZ9H 5DD6B 4YQXH 4NKQB 1NAKL 2K0RA 5G4OA 1N7ML 5CSZB 5J12C 4Z7UB 3QRFM 1J0IA 2E47A 4HUVA 1Z9OA 3F7YA 3TPKA 4L4VA 3KYOA 2YC1A 4TVPD 4JAMB 2W95A 3ECWA 3QR0A 1MH5A 4XWOC 5EWIH 3MMEA 3FU7A 4QY8A 3FONA 2F61A 1R4XA 2AV7A 4CJ1A 3OD3A 1E27B 1EBPA 1IB5A 4W9FC 3BKJH 4WFED 3MGOA 5J3HD 1MRCL 1RZ7L 3PJSB 3Q2LA 4K3DL 4YUEH 1IEBA 4JG1L 1I7UA 1IM3A 3KGUA 3ZKQD 1GYUA 2P80D 2VXSH 4U6YB 4P2RE 5IVXF 1MCCA 3PGFH 4ES9A 3N42B 2BNRA 3B9KC 1U58B 3IDMB 2XNAA 1Q72L 4Y4HB 4LRIA 1U36A 2D7TH 3P30L 1W15A 2OYKA 3VW3L 2NR6A 4MDJB 5T3ZD 2R2EB 2K6ZA 4X99B 1DBML 1GW6A 5AW3B 1NL0H 1T80A 4HJGB 3VFRB 4TL4A 4HALA 5IVXE 4OZ4B 3MZTA 4TVSa 3TTYA 1Y6NR 3TVMA 5C09A 5MP6H 3PJLA 2A77L 1V3JA 3L4CA 3LRSB 2IF7A 5FFLA 4G2AA 4YDKL 2L7JA 5E51A 4H8UA 4K7PH 4GI9A 3QG7H 4LL9A 4HKXB 3BPLB 2E9BA 4HUUB 1ZVSA 4PBVC 4XCCL 4QRRD 5AALA 3QUML 2F7PA 5HBBA 2X4TB 2Q1EA 2XCMC 3R18A 4U1GB 3CPLA 3OM3B 4K71B 4PBDA 1UVQA 2DQUH 2AQ3A 4MVBC 5F1KC 2Z93A 3TPUB 4V2BA 1AXSB 1KXTB 2V37A 1UKSA 3QCVH 4OI7A 3MJ9L 2WLJA 2AEQL 1UYWH 2VJ8A 3AG1B 5DHVB 4N90D 3RWFB 5GRYA 1BOGA 2WBJD 3QDGE 3H54A 3MJ9H 1J8HE 1AD9B 3QWRD 3ZO9A 2V3DA 5I6LA 3NEXA 4LHUD 3WFCH 3X14B 5G4NA 1JGDB 1ORSB 4IRZH 3UPCA 5KSUB 1NBYA 3F83A 5EO0B 4D0BB 1EHXA 1ACYH 1G6RL 2V7HB 4GP5B 1BM3L 2QBWA 3FCTA 5GRJL 5FWQA 1INEL 4LDOB 3RNQB 2L7UA 2W07B 3I6GB 5EDXA 5MEOB 4PJFA 1G6RH 3HMXH 3RWEB 1TZHB 1AC6A 1P5VA 1GGBL 2XWJB 3DROB 1CDBA 4GMSL 5KOVC 5IB4B 3A5VA 4LARL 4A63A 4HJJH 5ACLA 4WNSA 5CO1A 2RTTA 2HLAA 5F7KC 2BNQD 3D3VE 2NX5E 4FOMA 4FNQA 3OMNB 3S9DB 1EV2E 4H5SB 3MRLB 3FT2B 3P0YH 4PUBH 4MQTB 5EZLB 3S36X 4E5XB 4UM9D 4P99A 4O2EA 1D5IL 5A40E 5IG7B 2JVUA 4XO9A 4KXDA 4P5MB 4CILA 2YBRB 4MJ5A 4U1MB 1M2OA 5SWZE 5F6IC 4QRSA 2EUVA 4XCFL 4LSPH 5EOTA 5DK0A 5KOMC 4TUKH 2FO8A 4LHUB 5DYOA 3L5XL 4Q14A 5D7JD 4HA1A 1I8MA 2Y0SA 5BRZB 1H6UA 2DD8H 4QHMA 5F9OH 2APTA 2BVPB 3TLRA 4KUZL 3DMMD 4X6EB 1YEWA 2BSDA 1F02I 3QUYB 1YEHL 3SKMA 4UBDD 2X7LA 1DJZA 4XT1C 3SZKC 2FATH 1JZ2A 3QB7C 1Y1DA 3LVEA 3RYMA 3NSCA 1ADQA 1E3ZA 1LD9A 1YEHH 2PCFB 4QHKI 3K46A 1NGXA 5TF0A 1YO4A 1F8TL 4Y4KD 5HP5A 1D9KD 3K74B 4DETA 2KDGA 3EJRA 3OGCB 4GMTL 3UTTE 5J06A 2YRPA 2P5WE 2EDYA 1M1XA 1PL3A 4TTDD 4XO5A 5IESH 3ARBC 2FLBT 1MUJB 1UD3A 1XO8A 4AYGA 5C97A 3LSOA 4G1EB 2CRZA 3TN0B 4AZ8B 4BXVA 4NO3A 4OJYA 5IOPB 3KBHE 3CFKA 1MLCB 2WGNB 1NIBA 3NCWA 4I0CC 4UCFA 3V5HB 5FB8B 1JJUA 2X6BA 2YLHA 3LPFA 3ULUD 2J8UF 4D0CA 3F84A 3JXAA 5HVFB 2ICWI 5I8OL 1INQA 3M1BB 1MPAL 3QT2A 4P5KA 3HNTL 5L6YH 4K9EL 1R3JA 4JG0H 1ITCA 2DQHL 1BGXH 1G7QB 2EE0A 3MJ7B 1GCYA 4XRCA 4A7VA 3ARUA 2EJ1A 3FO0L 2J8UE 4DPRA 1B3JA 4JFXA 2VWEE 2W0FA 4WTXA 2ATKB 1IBBA 1FGVL 1RUQH 3DRQA 4UILL 1KF9B 2FHBA 4J4PC 3ASNB 1XZWA 4CC0A 1CL7I 1HCFX 1GKOA 2GT9A 4WLCA 1FGVH 3MV7D 3K6DA 2ZCLL 4H8QA 4TUOB 1AFVL 2VABA 4NGHL 1G7JA 5J6HA 3GXNA 2YGQA 4BUHA 1XB6A 2B14A 5ESAA 4LLVA 2Y7NA 3GMNA 3KYNB 4WQOA 5EIIA 4KVNH 4S10A 1ZANL 3WTYA 3N85L 1N59A 1MOEA 3HE6D 2JJUA 3NACH 3AXHA 3D5OF 1S9WB 1DVFC 4FA8A 2HRGA 1ZANH 4ZYKA 2J2ZA 3N1MC 5KS9F 5DC9B 3PPEA 2K3TA 2GCYB 1P4LA 5C0IA 4YBLC 4PGDA 3SE9L 2I07A 4LSDA 1WAAF 1ZXKA 5JZ7D 1GY1A 4BZYA 1YJDH 3RIAF 4IEFB 3DUUA 4PY8I 4HW6A 4N6RA 4RAVB 2B4CH 5KS9E 2XXCB 3EYUL 3QUZC 1A21A 2APFA 1KGCD 2MOQA 3P69A 3QEUA 1EMTH 1PY0A 3GI9L 3ETBJ 1KBVA 3H2PA 4P0DA 5KWYC 5F7FA 4XBMA 1HAWA 2PXYC 2NY0B 1NCWH 1CLZL 4DKAA 5IY5B 1QRNB 2WOBA 4W4NA 1X5GA 1EFXB 4FERA 3LKSB 4WO4C 4FQLL 3OR7B 3W82A 4LCWA 3ZQ9A 5DJXA 1PIFA 4DEWA 4F2EA 2Y5TA 5F9DC 3UIZA 4OZIB 4FMFA 2B4CC 1D5ZB 1E6JH 4Q8BA 2P26A 2P8MA 1VFAA 2XG5A 3NSJA 3I3BA 3PWPD 1MHPL 5EEZA 4ONHB 4P4KC 3QDMA 4HCRH 2R9HC 3VXUD 1RPKA 2QT6A 3R4RA 4FTVE 1JZ8A 3K3QA 4M3HA 4QTFA 4XNAA 4F2FA 1KJ2B 1MCBA 5GJTL 1B9KA 1M9WA 4UT7H 3HC4L 5CCKH 3W9EB 3KDMB 3VSQA 1L9OA 5ELIA 3EH1A 2QZQA 5MEQB 4NQCA 3OAYK 4O9HL 2LAGB 1AO7E 1MJUL 3FB6B 4WJ5A 2OTWA 3GSWB 3QJVB 4QRQA 5BCAA 1U6AL 5FUZL 3V6OC 1VACB 4RMBA 4DP6X 4KH2A 3MOAL 4P57B 2EACA 1SBSL 3C60A 2YPLB 5HDLA 1UXSA 3SYPA 2CLVB 3TJPA 3VACA 5IFHH 2ZT9C 1UATA 1SBSH 1CICD 4DEPC 1U3HD 4AZUA 4Q0XH 2ZKMX 3I9GH 5PAZA 5LUMA 3OKLB 2YQ2A 3MOBH 4J3SA 3VQ2C 4PJGA 2FYVA 4GKSB 2ENSA 1U8MA 3VB8A 4ZMTA 1J9SA 1YN6A 2MPAH 3EZ8A 2XFGB 4DKEL 4F2MB 5EO9B 3V79C 4WU7B 4HYTB 4MYPA 2YMXH 3QXVA 4FXKC 5KYXB 2DQJL 3LKPB 4NYLA 5F7YC 4XGZB 1JI2A 2GI7A 2EDBA 2JQAA 4RETB 4D94A 5GS2D 1QEWA 2LVCA 4LCUA 5K1VA 4AQAA 3O4LB 4YIQB 4WF7A 1JSYA 2VN7A 3BZFB 4UUJA 4W6WB 1BFTA 2CKBB 3R1GL 4KPHL 5TFSL 1IGYA 4L3ED 5SWQA 3WIFA 4F1ZA 5KYYB 2FR4B 3WBDA 2NY4C 4JO8A 4KPHH 4IW4C 1AIFB 3ZDZB 3U2SB 1JPGA 1YEIL 4D9LH 4EDXB 2W94A 4LCCB 1NC2D 4RZKA 5HHNB 3K8KA 1AXIB 3BD5A 1IFRA 4KAQH 5DC2A 3RJQB 3VVVA 3KMDA 4KQ4H 2YO3A 4WHDA 4M7ZC 4WDIB 1BOYA 1SQMA 4P2OB 1DBKH 2CIIB 3GRWA 5M95B 2V9UA 2VJ0A 4U1IA 3T0ED 1NCJA 4A7TA 3TH3T 3QXTA 4OM0L 4FXGC 2H32H 4HGKC 2IH9A 3HR5A 3KPRE 4N2NA 5CCJA 4IBQA 5IFJB 1JHKL 5T1LA 1O6TA 1UJ3B 4KXAA 1BBJB 2SEBB 4HVBA 1J1XL 2DMCA 3D39A 2JKRM 4GXUM 2EDLA 3WDIA 4YDVB 2HVKB 5C08A 4JM2C 3TZVB 1NCTA 3ZZLA 3B9KA 4V1DD 1Q9KA 1QLEB 3PGCA 5DGQA 2WWNA 4GJTB 1DSFH 1YEDA 2VSKB 1MCQA 2UUDH 1FZMB 1GH7A 3P73A 5AOKA 4XHQA 2JKNA 2FYYA 1DLFL 4PB0H 4HJ0C 1MFDH 5GSVB 3ESNA 4YDJB 1YEFH 3ZU8A 1KDJA 3DC0A 4NNYA 1NBZB 3TM6A 1QUNA 4ZX5A 3BQUC 6CGTA 2ZSWB 4MA1C 2F5BL 1WWWX 4QRUB 4N6QA 3PWJB 2IANA 3IXAA 2WWOA 3LB6D 5IOKA 1EXGA 3L7FA 4X7TA 5E7FA 2IADB 5HDWA 3KL3A 4M5ZH 1SEBA 4ZG1A 1WSST 3IK2A 4HGWA 1C5DA 3QAZC 4MCNA 3BO8B 3BUYA 1GZPB 5AL8A 1MHEB 5H4ZA 1G0YR 1NDGB 3DX7B 4NUJB 4DK6A 3NFPA 1V8HA 3DX0A 1M6OA 4LZKA 4XMKH 5BNXD 3N1GC 1T0PB 2VDPH 4IK6A 5K9JH 3I85A 1U8QB 3MACH 4EEEA 5L9DL 1T1ZB 2HT2D 1FN4A 5DJ2A 1AQDB 3CCHB 4JHAH 4O51B 1T1YA 2XBZA 3CSGA 3MLUL 1UWGL 4R8WL 2VITA 4CNIA 3AADB 3QUMA 3HG2A 3FFCE 4P59L 1KEGH 5ITFA 2F19H 4POZC 3MLUH 4R8WH 3QG6B 4WCYL 5FV2A 1S78C 1AZVA 1B4JL 2UY6B 2WV3A 1PTZA 2YARA 1KFGA 3HI6L 5EF1A 3MJ9A 3IWVA 1XBRA 1B4JH 5LBGA 1J9RA 4UV4H 4GUQA 5D1QC 3L4XA 4I9XA 1JXDA 5IUSA 3MUUA 4ATTA 2VM4A 4NN7B 4HUVB 3F7YB 3AB0C 5JA9A 5CILH 1I7RA 4L4VB 3KYOB 2YC1B 4RGMB 3CLFH 3MMEB 3FU7B 4QY8B 1SY6L 3FONB 1NINA 4R83A 4HIHA 1RFDH 2AV7B 2NY5H 3LZOA 2IDSA 1G6RA 4L05A 5ADPL 2VR5A 3HMXA 3MGOB 4FQCL 2DLHA 2VDOB 2DH3A 4AGQA 1IEBB 1QBMH 5AVWB 3TESA 1IM3B 1A66A 4D9QE 2KBGA 1WIPA 4Q89A 3CZGA 4NEHB 1AHWC 2A4EA 1XGUA 4BE6A 2BNRB 1J87A 3MV01 1MF2L 4OF7A 2J6WA 2XNAB 2WB1A 1J8RA 5T1JA 1OGTA 3OVUB 3B8YA 1PJ9A 3DK2A 3MCYA 3GGWA 4IDLA 4MFHA 2NY5C 4JPQA 2FBOJ 3BLPX 4N0CC 3TVMB 5C09B 5F8RC 4FI6A 4UTBL 1AP2A 1KIPA 3VWKD 1OSPL 2B5IC 3QO1A 2BDNH 2GUOA 3RIAK 3WMQA 1DL7L 4JKKA 1ZVSB 1QATA 2Z4QA 3QARA 4P5RA 3VXPA 2VDLL 3P9LA 5J57B 3ARBA 4X0NA 3CPLB 2CM6A 4FI8A 5I8CA 1UVQB 2Z93B 2OAAA 1DEDA 4L1HA 4IOIA 4ZFGH 1OF0A 1KYOJ 2HTKC 2VLJA 1TZAA 4FFVD 1QG3A 2FBJL 3AT9A 3QPQD 1BOGB 2ZG2A 3MUGA 2NZ9C 4YDMA 2E9JA 3JV5A 4J3OF 3RVWC 1A4AA 2FBJH 1FJ1A 1FP5A 5AW8B 3UJIH 5I1KH 2R83A 2EQDA 3ARDD 3MLWH 3SDDD 4QDGA 1NBYB 2J57A 2Y36L 5TGBA 3QQ9D 5LHDA 1A7QL 2YD4A 4JCWA 3ZT5A 2X89D 2XWEA 3FSWA 5EG6C 3DI2B 3FCTB 1DUZA 1L6XA 5FYKL 1J0HA 3LZFH 4J4PA 4PJFB 5KJRL 1P5VB 5E24E 1IAMA 4IRSA 3WS3A 5AKTA 2ENPA 1RZKH 4WY7L 3MBED 4PWJA 1UENA 4LPTA 2HLAB 1MCRA 2FT6A 2EH8H 3MV11 4RDQF 4WY7H 3TCXA 5I17A 5DMYA 3IMVA 5D7KD 2WGXA 2AI0H 4Q6KA 4O2EB 5HHMB 3S8WA 3IMRA 1PZ5A 5L8LB 4P8QA 4P46D 2AERT 2PUQT 4X6CA 1GS8A 3GZKA 4LF3A 1Z0MA 4MJ5B 3LXCA 3QXUA 3HCVA 3Q44A 4NUMA 4QRSB 2WVUA 4JRXE 5EOTB 1RZKC 4PRPE 3HG0A 5DK0B 4ZTPL 5DYOB 3GJFA 4K07A 2DBLH 4ICXA 5JXAH 2AJVH 1SXCA 1I8MB 1A9VA 1TJIL 3TA3D 4EF3A 4QHMB 4B9IA 2Q20A 1IC5H 4OZHE 3G08A 3OPZL 2ZONA 3OTTA 3QUZA 5K39A 1BMGA 2WZPA 3SKMB 2WOYA 1HX0A 2X7LB 4YMPA 3QIWC 3I6LD 2PXYA 5K9OA 4ZNEE 1X5HA 1LD9B 5ANMA 1MCHA 4MNQA 1NGXB 4X8CA 3HG1A 2VJXA 5C0NC 2J6EH 4WO4A 1M1XB 1BEXA 2H7WA 4JGNA 4M4RA 1L9QA 1GTNA 5ALBH 2YMTA 3UJJL 1E2VA 4U3SA 3LSOB 1XD1A 3FKUS 1XDTT 2WKOF 4MA8L 1ETB1 5E1GA 1BLNA 3VXOA 2M26A 4HIJA 4NO3B 1IVTA 1CFMA 4P4KA 3CFKB 4RISL 2VRQA 3HPJA 1E5ZA 4G5AA 3BPOB 4HMEA 3F7KA 3IGFA 1V5JA 3I2CH 4MKTA 5GS0D 2AQTA 4D0CB 5AVRB 1JGVL 3SDCD 5MI0C 2MNWA 1INQB 4X4ME 5T3XH 4P5KB 2X6VA 1KJ3L 5E6RB 3IEAA 1H19A 1FFRA 4KI5D 1SN0A 1MFUA 2KQMA 1R3JB 2Z6FA 4G8GA 1JGVH 4XRCB 3Q2NA 5DFWH 1ASQA 4N5UA 2NCEA 5IROD 3BAKA 4B9FA 1IGIL 3NDZE 3W2DH 4JFXB 2W0FB 3MRKA 2XTJB 3N50A 3IMTA 4HCRA 3V6OA 4JFFE 3DRQB 1XGTA 4ELMA 3KWVA 2MJWA 5A6MA 2XIDA 5E8DL 1WZMA 1JPST 4QXUL 3O3EA 3QORD 2GT9B 4PJ9D 4BZ2H 1NPUA 5ADOL 1PX4A 2CGRL 3FTYA 1PBYA 4XO3A 3QPXL 2R29L 1WICA 2VABB 1V05A 3RGBA 1I1AC 1KLGB 1G7JB 1KCRH 5J6HB 4XBEL 3V4VH 3QPXH 1WS8A 5ESAB 2EXYD 3BN9D 4MA7L 4LLVB 3C5ZD 3BVWA 3GMNB 5EIIB 3WTSA 1GY2A 1J7VR 3FQNA 4PLKC 2ATAA 1N59B 1AXTH 3G04A 3GSNL 3EFOA 3MN8A 4FXKA 1CXLA 1KFAL 1NH6A 3X12A 2MNUA 4KMTL 4ZYKB 2J2ZB 4N3TA 1M57B 3RTQC 4PP1C 3BUDA 4NWTH 1P4LB 5C0IB 2HJKA 4PGDB 2I07B 4KMQA 4JHWH 2UX6A 3EIFA 1E4JA 1IAIH 3DUUB 3OAUH 2IAAC 4N6RB 3VG9C 1ZSHA 4KNSA 2XTLA 5HJDA 3TFBA 3VFNA 5IR1A 1J5IA 3TO4C 5LDUA 3QEUB 2G5UA 4QOKE 1O6SA 4NN5C 4NT6A 1TEFA 3VGAC 5J6GA 3O6FA 3RB5A 4PVLA 4HEPA 3SSGA 3K6NA 4WEUD 3UDWC 4A2LA 1DANT 4LCWB 4R26L 5IJKC 4Y19E 4PJAF 5DJXB 4MAZA 2Y5TB 1H3UA 4I3SH 4EOWH 3QXAB 3DPBA 2P8MB 4FXGA 1J9QA 1VFAB 4YDZA 2XG5B 1BF8A 1J8SA 2CBPA 1DBAL 3QDMB 1NAML 4FNLL 3BPCA 4PJAE 3GXMA 4LASL 2GIYA 3AS2A 4IOFC 3L5IA 1GVIA 5TE4H 4AVKA 1DQLL 1JCKA 4M03A 1WFUA 1ED3A 4XOCA 1OPGH 4LASH 2OK0H 3RQ3A 5E03A 2HWZH 2JWYA 4JDEA 1OQOA 2NY1C 4FRWA 2X0UA 4JMNA 1E5BA 5ILTH 4NQCB 1OV8A 5LNDA 2FZ3A 5JQIB 4WJ5B 4LSSH 3WFBH 2OTWB 4QRQB 3GUTA 3BQUA 4KY1H 3BE1L 5GXBB 3BAJA 3DJSA 4J23A 4ZMAT 3C60B 3MRFA 3GRBA 4HC1H 1E28A 1UXSB 5IMOA 3ZJAA 1D2PA 4UQIM 4L4TD 5T1DL 3CSBA 2LQRA 3WUZA 3JV4A 1WQVT 1EHLL 4AIOA 2CK0H 5DLLA 3QH3A 4G6FD 4PJGB 4F57H 1WD9A 1U8MB 3FN3A 3TWYA 1FUNA 3UTSA 1K5NA 1YN6B 1HEZA 4CGTA 1RUML 2EC8A 4CVZA 1PZ3A 4Y4FC 3FOMA 3MLZH 4JG5A 5D7LE 3VFOA 1QLRA 2XQYK 3ZE2F 3GS4A 3U4BH 1XSKA 5DMKA 1RUMH 4NYLB 3NJFA 4M8UA 1MI5D 4BRVA 3ARVA 2XIBA 4WUUD 1QEWB 3EO1A 4LCUB 4JL2A 3SPHA 3UOAB 2BCKA 5JMRA 1KENL 5CZKA 4UUJB 4WI3A 2KL6A 2IC2A 1MQKL 3S4SA 4HIEA 3ZE2E 1IGYB 3WIFB 5KVGH 3MNZA 3UTOA 3EJZD 4IOSA 4OU3A 4GG6E 1KENH 4JB9L 1NBCA 1MQKH 1PZUB 3CBJB 4JM4H 1IKNC 2Y1VA 1JPGB 3MRPA 4H1LB 5MEPA 3A47A 4IU3A 4XPAH 5D1QA 1BXXA 4AC4A 5J12B 1MXGA 3LH9A 3QNXA 4OFDA 2VXTH 1I8IA 4W9CC 4AT6A 4DH2A 1L9SA 1EK3A 3OSKA 3VFPA 4DP2X 4U1IB 2ALWA 2DQIH 2W59A 5I6MA 3Q9PA 3V0HA 5DVOA 1NOFA 3BZDA 3VG0H 3HR5B 2WYIA 4XP6L 3ULVE 1AH1A 4HEPG 2FJHA 2Y06L 5T1LB 5GZOA 3L3JA 4LAQH 2Y7SA 4GLRH 1G1OA 3D39B 2A2QT 4HCIA 5LXVA 5C08B 3RVTC 3B9KB 1Q9KB 3PGCB 1F3DH 2N0KA 3DUHA 3V9FA 3WU1A 2ZAGA 1YEDB 4IS6A 3P73B 2J88L 2B9AA 1CI5A 1OTTC 2FYYB 2CALA 1JF6A 2EIZA 1E4XL 4NNYB 1MCFA 3OHMB 5H4YA 1QUNB 3QZWA 1SY6A 5FCUL 4UQBA 1TTCA 2A73A 1FZKA 2P5PA 2BWIA 5H2BA 2IANB 3IXAB 3DJ9A 3L7FB 1RUKL 4OLUL 4X7TB 2GHZA 1SEBB 1MW1A 1CE1H 4YSEA 1DLHA 2XICA 5LKNA 3KS0J 1E4HA 3VJ6A 4EQ3A 1LILA 1V3KA 1C5DB 4B3EA 1AAJA 3BUYB 4KRLB 3O9WC 4BINA 2IMMA 3NFPB 4NBYB 4LSVH 4M7LL 1JFHA 3KD4A 3N40F 2DS4A 3SPIA 1W8EA 1Q0XH 4G83A 3GJEA 2DDQH 4XMLH 4UTBA 4ZMQA 2NOYA 1FN4B 5DJ2B 3GXIA 1T1YB 2Z91A 5DA4A 2VITB 4CNIB 3ILQD 2H5UA 5DMIH 3C8HA 3G5VA 3QUMB 2QV2A 3L4YA 3SJVD 5ITFB 3WE6A 5B1CA 3QIBC 1O7DC 3MNWA 4ETQA 2IDUA 4HCGA 1SXAA 1W0YT 5IW1A 2IPTL 5FYJH 3BEVA 3IXTA 4TSCH 3CSFA 5E23A 2O6PA 1ETJA 2FD6H 2WVTA 1CPUA 2DJMA 4N2CA 3RFRA 1DBBL 1N3NA 3BIBX 4RWYL 1I7RB 4JFUA 3NCYS 4XH2A 5EOQH 1YYMH 1TITA 3V5DA 5B3JF 4UQEA 1DBBH 4HIHB 4JEGB 4RWYH 1G6RB 4GSDH 4OLVH 5GGTL 3QK0A 2DM7A 4LHQB 1NCAH 5F6IB 2VLKE 4RBPK 1A6WL 1YSOA 1WZ1H 4M6NH 4PP2A 2YAHA 3IDNA 1D7BA 4NQXA 1S7QA 3BKCH 1XGUB 3L1FA 1ZIBA 1FIGH 5FGCB 1SDAB 4FQXC 5AKRA 1OGTB 3CDZA 1IQWL 4Y2DC 1MWAL 3BXNA 5ICXA 1ZSDA 2XJLA 2VB5A 2F54D 3F7RA 3GGWB 2ICEC 3L16A 3LNIA 3KJ6H 1IQWH 3S8FB 5AAMC 5E2VH 2OL3H 4KTGA 3QIWA 3TCTA 1ZDSA 1ZGLP 1AP2B 1KIPB 5TPWL 2JTYA 3N41F 2FB4L 3QO1B 2ORBL 2GUOB 4Q74A 3BP7A 1YMMA 3P3TA 2DWDA 5DURB 5MENE 1F42A 2Z4QB 3VXPB 3LN5A 3P9LB 3ARBB 2D3LA 4I2XE 4L9DA 2JB5L 3DURA 1TVHA 3T0WA 3FDWA 4KX7A 4KGLA 5I8CB 5DO2C 3S88L 3QZWG 1E90A 2JH2A 4OLWL 2V5MA 1CZ8L 2JB5H 5F9WC 2RMNA 4IOIB 3W0WE 2FT8A 3VO0A 2VLJB 4RSVA 5ECJE 3A4DA 3OAYH 2LHAA 1RU9L 4N8CH 5FR3A 1CD8A 4JFVA 2J6EA 4JQIL 3P4LA 2CDEA 2FAUA 1UFUA 2ILLA 1DVFD 2YAOA 2HTLC 3MUGB 4NQTA 4HPOL 5JO5A 5GS0L 2EDWA 2AV1A 2F0CA 1FJ1B 3MLRH 1UB6A 5F2FA 1BVNP 1BAFL 1ZHKA 3BYYA 4UB0L 4LEXL 3SPVA 3MV8A 5TGBB 1RZ8A 5DK3A 4BQCA 2ZP8A 1M42A 1FNSH 1FFOA 3ALWA 2WLLA 4ACPA 5SX5K 3VE0A 3VRIA 5TDOA 4IRSB 5EFIA 3OAZK 3SY6A 3WS3B 5HGBA 3N6YA 1NUFA 4BFJA 3LKOA 3VI3E 3FUIA 1I1AA 4TYUA 4J8QA 1AGEA 2VR3A 3MRRA 5D71L 5I75C 4YVNA 4NWUL 5I17B 2IBGA 3ATEA 3EO0A 1RKRA 4LGPB 4AJVA 4GAGH 2F15A 4Y2LA 4AMKL 4F58L 4HQQL 4ECNA 3PAUA 1PZ5B 3L5HA 4N2AA 2ZUSA 1URZA 4X6CB 4NWUH 2EDMA 4LF3B 3KWXA 1DFBL 4LVOB 3HCVB 5EU6D 4OCSH 4ACTA 3ARSA 1WBXA 3RTQA 3GJFB 2HFFA 4YBLB 2C4FT 5CM1A 1ASPA 1O7VA 2YN3A 3CXFA 5KVFE 2VL5A 1U3ZA 4QAMB 3NH7H 2R29A 2VO5A 1EHNA 3BVNA 2X4SA 2CR6A 6TAAA 3RBSA 3G08B 1MJ8H 3QUZB 3TO4A 5K39B 3ZL2A 3IFLH 2CRYA 5FV1L 4XAKD 1S3KL 3S5LG 2YAFA 2PXYB 2X0WA 4OCXH 3V9CA 3VGDA 5K9OB 1HYSC 4DGYH 5ANMB 3GSNA 4MNQB 1H6FA 3HG1B 5E2TL 1RQ5A 2C3XA 1EPFA 1S3KH 1DUYA 3UDWA 5J1SC 2QADC 4WO4B 3UBGA 1QSZA 3IPBA 4HS6A 5I1CH 3NEOA 5KVMC 3OV6A 4AQ1C 5IJKA 4M4RB 2W38A 4M7JL 3LV3A 4U3SB 3VXSD 3RX7A 1KT2A 1JNLL 2PPDA 1EFQA 1WISA 5ICYA 2GSGA 2LV4A 1BLNB 1C7TA 1KB5H 2DAVA 3QZBA 4HIJB 3VXOB 2ZX9A 4P4KB 2XN9E 4N2KA 4PLNC 4Z95L 1I75A 3LIUA 1NPNA 1L5GA 2FH8A 5LNEA 3DGCR 2O6CA 2O5YL 1CXIA 3DYPA 5JW4R 1BIIA 2I60H 3FL7A 3PQYA 2BVYA 5FKAA 4G8GB 2KYIA 1IC4L 4W70A 9PCYA 4G6JL 3UC2A 1RPUA 4EDWH 3B7TA 2P45B 5FOBA 1A14H 3VM7A 5LO7A 3MRKB 1HNYA 3QE5A 3HI1A 5CD5C 2NY4D 5FC9A 4DVRL 3GSVA 4WEEA 1XGTB 4ELMB 4LPWA 1IC7L 4ZS7H 4PHXA 3MKGA 4JFDA 1R6VA 1NAMA 3O3EB 4GSQA 5C70A 2OMXA 4M1CC 3T2QA 1ZK5A 2R4RL 5B7MA 4DEPB 4HJSA 3K1DA 4YHML 4UOJA 3WOVA 3LRKA 5C3IA 3G7TA 4JUTA 2B8OT 3MRMB 4NPKA 1HINH 1EANA 2YQBA 2ZUTA 2BSRA 4PYGA 2XWCA 1X4ZA 2HFTA 3FQNB 2C9UA 1UG9A 3G04B 4Y4FA 3JSSA 2XRAL 3EFOB 4FXKB 4F37F 4HC1A 3O2WH 1JXKA 4KO7A 5EOCH 1JPSH 1M05A 1TLKA 2YD1A 3X12B 5KSVA 4U7MA 3VFWA 4Q9RL 3NK3A 4DNLA 4X7CC 2WUCH 4JFYA 3K0YA 1SEQH 2HJKB 4OH2A 3IAGC 2XLLA 4JM2D 4Z7UF 2FH6A 2FEEI 5DWUL 4HHAA 4MS6A 4NM4L 1MXDA 3QRGL 3DJTA 1D3CA 1O9WA 4Y9CA 2NY4B 4KROC 3OLDA 3ZKSD 3VFNB 5IR1B 4X9BA 4N2EA 1LNUA 5EEVA 4ODHH 3SYQA 1IKNA 4Z7UE 3QNZA 4FLQA 5E9NA 1O6SB 3WAJA 3NTCH 4NT6B 5J6GB 3O6FB 1G1CA 2C1OA 4HUMB 2EIEA 1MJ7H 1L0XA 4NJ9L 3ZOAA 1KACB 4LPCA 3KL5A 4M7ZB 1MLBA 3B5GA 3N42F 5MERA 4JFWA 1CDHA 1IE4A 5F7EH 1ETZA 1QI4A 2GFBA 3G5YA 5DEFA 3C8DA 1SDDA 5CKAA 4FXGB 3AS3A 4TUJA 1P7QD 2X1WL 4FP8H 5BVPL 4OI8A 2RFXA 1V3LA 3BPCB 3OWEA 4EI5D 2NXZB 4N9OB 4S1SL 3T77A 1GPOL 1XF3A 1AKJD 3PYCA 1OY3B 4X50A 2CA3A 5IJCC 1WA2X 4G6ML 4JM2B 5CJQH 1ED3B 2Q3AA 5D1ZD 1HYRC 2O61A 3RX8A 4JDEB 1EHKB 4OJAA 4TLSA 3TJHD 2FZ3B 4CVXA 2GBTA 4H88L 1OWWA 1B2WH 1DDHA 2N3JA 5KYUA 5CZRA 1O9VA 1J5HA 4HK0A 3GUTB 4UNUA 1NCDL 3BQUB 2YEQA 3S35H 5GJSH 4MA1B 5TQ2L 2XV0A 2G3NA 2BK8A 4K5OA 1O0VA 1QASA 1S5HA 2VCOA 5E6YA 5CJOL 3MRFB 4WJG3 1QHOA 2C3VA 1YEEL 3F01A 4JFQA 1E28B 1NCDH 4NCC1 5IMOB 5DK2A 1G9ML 4HX1A 2PNDA 2Y24A 2ENYA 3NJMA 3QRBA 4I5BA 2NY7L 3ILDA 3JV4B 3NJGA 1MFBL 1F41A 2B1AL 3D07A 3V8OA 3QH3B 4P2QD 1NPJA 1SJEA 5TDNA 1F97A 2D9QB 3QAZB 4LOVA 5DD0L 3BVTA 3UTSB 1GYCA 1C9SA 3EJYC 3BVVA 1HEZB 2XZAL 3O9WA 2NY7H 4G6KH 5AFAA 2B1AH 1XTLA 4I3RL 3AVEA 5FUOL 4PJCA 2A9AA 3FOMB 3VFOB 4KKLC 1QLRB 2F53A 4NX0A 5DMKB 4C4KO 2DV6A 3EO1B 3MRIA 4NLHA 3CVHH 2EE3A 3SO3C 3MV9A 2BCKB 4G5ZL 3VA2C 1G9MC 4MSWA 3R7RA 1ZT1A 3FF8A 3S4SB 1NMCC 4HIEB 2IV9A 4MZIA 3MNZB 5EC2A 4PJEF 3X17A 4FEMA 4P9HH 3IMSA 4LVEA 1A3ZA 5DQDH 5L7XH 5LWYL 1AY1L 3QIBA 1TPXC 2E75C 2HZHA 3CHPA 3M86A 3RPIA 2OCCB 1ETA1 2DLFL 3L2NA 3MRPB 5MEPB 1AZUA 1V7NL 5GGVY 3CVIH 4IU3B 4PJEE 1PMYA 3MGAA 3BKML 1P4IL 3VWJC 5D1QB 4O5LL 3QNXB 4FYTA 3WEMA 2B1OA 2N1TE 1I8IB 3AB0B 4P2QB 4AT6B 2AC0A 2ZD0A 1UZ6E 2X09A 4C58B 3VFPB 1I1CA 4PPTA 3B1TA 2UYLA 4NKIH 3WE1A 3RY5A 5DJZA 1M4KA 5BRZE 1JV2A 1HILA 1YNTB 2FJHB 2G2PA 5EBLA 4H20L 3L3JB 3H56A 1T7XA 2HA1A 1FGNL 4OAWA 4Z0XA 3KBPA 5DD1H 4R3SA 1OT2A 4GXVL 4ICWA 3GXUB 3IJ7A 3GSRA 4Y2OA 3HG3A 2ODHA 5IQ9A 4FQXA 4PQXA 3F58L 4PS4H 5D72L 5K5YA 4Y2DA 5SWSE 3BSHA 5TH2A 4GXVH 3B8SA 5DRZA 1WPCA 1WEJH 2YEZA 4I13B 2EIZB 4I1NB 3RB7A 3LRMA 5C0RL 3ATBA 3QZWB 1RIVH 1SHSA 1FZKB 2A73B 2B5IB 2Q7YA 2VDRL 5HDQL 1CD0A 4A7SA 1G43A 3IFOA 5H2BB 3NRFA 1X9QA 2BSBA 3H3BC 4RMQA 3NPSC 5I23A 4HFUH 1KYAA 2CJUL 4CC1A 1DLHB 2XYBA 3DVGA 3EYFA 3H3PL 5BS0A 3VJ6B 5HI4D 1ZVNA 1YLBB 1YEKL 5E2UL 4DO5A 3V4UH 4U6TA 1MWAA 2EEAA 2X1OA 3LMJH 4Y0GA 4KDVA 4WEBL 4OD1L 1RLWA 3NJVA 5DVMA 2EEBA 1LO4L 1YEKH 2VMDA 4J39A 4XMPL 3GJEB 3NA9L 2MCPL 3L1OL 4H40A 2ZOKA 1RUPH 3ALPA 2DQGH 1F4WL 1KBGH 5FYJU 1C5CL 2A4CA 2F08A 4FX5A 2HFGL 3CLEL 2ZWSA 3MJGX 7TAAA 5E08H 2Z91B 1GW0A 5HHOD 4X9GA 2OSYA 1F4WH 2VDLB 3ISWA 3G5VB 1C5CH 1J1PL 2O72A 2DYPD 1IC0A 1DJHA 4I1PA 3WE6B 2VZTA 4P2RA 1VSCA 5C0CD 5ESQA 3PXLA 3HNVH 5DXWA 4KX8A 2VZSA 2ZG3A 3MNWB 2YD5A 5IW1B 1IKFH 5I73C 2ARJQ 2ZXEB 4LU5L 3BEVB 3IXTB 2FWOA 4EZKA 4JQIA 5DGRA 5C0ND 4J1UA 1N3NB 1GS7A 3MXWL 4LQ1A 3CFEA 4MB3A 1YY9D 1MCNA 3HMWH 3MFFA 4XH2B 4X2UA 3V5DB 3NZ8A 2GJRA 1EO8L 4DGIH 1OE1A 5A3IC 2MNJB 4FQHA 2Y7LA 5KW9H 3THML 2CHDA 3OKYA 4OJFL 5I76A 5G55A 5B3NA 4XX1G 1I8KA 4JFED 1R3LA 2AEOA 1WZLA 4KXCA 4PP2B 1WT5C 2K1MA 2VISA 3IDNB 3LPWA 1S7QB 4NQXB 4UV7H 2X12A 5F7MC 3V0AC 1NWPA 2QPUA 4KOBA 3CDZB 3QFJD 1JXGA 4YX2L 3MLVH 3BXNB 5ICXB 1ZSDB 4GBXC 4AWJC 4UMSA 3CGTA 4JANA 3RGVD 3QDGA 2YQGA 1QRNE 1QNIA 1YEGL 4H8VA 1AQMA 1JGEA 3NCBB 1UD5A 2VM9A 3QIWB 1SPDA 4K8RH 1MEXH 3BP7B 1YMMB 1V7MH 2DWDB 4UZGA 4M1DH 2PWGA 5T3XD 4Y1AA 3LN5B 4AQ1A 2OR9L 3MUZ1 2VR9A 3I74A 3VD9A 4D8PA 3DURB 1TVHB 1CXFA 1E50A 4P5TD 5ETUA 3HFMH 4K5LA 3HZ3A 3H4FA 1AS8A 4RH4A 3CU1A 2Z7WA 1MFNA 1LO2L 3SE3C 2FJGA 4Y9GA 1LHZA 4JM0A 2J25A 5D93C 1FF5A 2DWSA 1LO2H 5MI0B 1IAOA 2CDEB 3L9YA 1MVUA 2CXGA 5HYEA 5JO5B 2GJZA 1IGTA 25C8L 2AV1B 1AZZC 1UB6B 3Q2CA 1JZ3A 1ZHKB 1CTMA 1VFMA 3SPVB 3MV8B 2YPLE 3O3DA 1RZ8B 5KEZA 1J8KA 2LVEA 4JRLA 4OT1L 1YY8A 3BKYH 1OP3K 5IQMA 1FFOB 2WLLB 4UINH 3VE0B 3T6XA 3VRIB 2OR7A 1WC7A 1ACZA 5TDOB 5EFIB 2VDML 5HGBB 1S7XA 1QHPA 4EBQH 3LKOB 5HGAA 1RHFA 1BFOA 4QRPD 4X0KA 4UYPA 1TEYA 1I1AB 5E6ZA 4F2ME 1AGEB 3BD3A 3MRRB 3UIYA 2K9UA 4Z7QB 2R56L 3EO0B 4Y5YC 2OFQA 4DN3L 1G1KA 1MCOL 2OSWA 2NY6D 4H0IA 1TNNA 4L1TA 1MRFL 3H9SA 3KPOA 5KAQG 4OD3L 3ZDZF 5TD4A 5I26A 4PAZA 1VAHA 3LPOA 4X4YA 1WBXB 2J4WL 1T6BX 3RTQB 3QCTL 2HFFB 1QTYT 3N5AA 3RX9A 3OKOA 4J3OH 4AH2A 2VL5B 3NP4A 1HWWA 3VG9B 5ABDE 2W1NA 3VTAA 3EDFA 3BVNB 2X4SB 3KCPB 4HUNB 2F6AA 2MPVA 1W0WA 2FX9H 3TO4B 3KPSE 4MMXC 2YZ8A 2AK4D 1NSNL 5TJWK 2JIXD 3K72A 3MCLH 2YRBA 4DGUA 4W81A 1B0IA 2MQ3A 4G7VL 3VGAB 3B9AA 2HMIC 3GSNB 1BFVL 1NSNH 2D3VA 1SM3H 2HT4C 4JFDD 1DUYB 2AVFA 4J3OC 4QJ3B 4HS6B 1A47A 1HKLH 4I8DA 3TWCH 1NC4D 2QLVB 3I9AA 5JIQA 2HCZX 1GMIA 3VXRD 3LV3B 2F74A 2FDBP 4RFNC 1KT2B 1F56A 5ICYB 3PWNA 3D0AA 4I1RA 2GSGB 3HJEA 3QDJD 3ZRFC 5I19H 4M5TA 4M6ML 1K2DA 3P3RA 3ILPA 2DB8A 1LO3L 2AXFA 4NO0A 3SO5A 3GRGA 3K4DA 4U6XA 4EIZC 3TNMA 1L5GB 4N20A 1U4FA 1BIIB 2BVOA 5C07D 3ESUF 1ZK9A 4B9KC 1ULVA 3PQYB 1Q94A 1SNRA 5FKAB 2NY1B 2PCPA 3QWOA 3T4YA 1HFUA 1NMAH 1UOWA 2UXVA 4I87A 1EUUA 4KJPD 3E2HC 5FOBB 4N2DA 4HWBL 3KEDA 4QF1A 1I31A 3U6XS 3NZHL 3EBAA 3HI1B 5C7XL 5F1OB 2UZPA 3GSVB 2HG5A 4OFVA 2V6HA 3CFUA 5CR8A 3QI9D 4JFHE 2EDTA 4JFDB 4ZQTA 4AUJA 2OMXB 3KXFD 5BVJA 1I9EA 3ZW3A 1JPEA 1CFQA 2VL4A 1CG9A 3SY0A 1X44A 1R75A 4AJWA 4WWPA 3FTWA 3QZLA 1XAUA 2BSRB 5IBLC 4JFZL 5I1EH 5I9QC 4W9LC 5HY9A 2IPUG 4Y4FB 1PYWA 35C8H 5D4QA 5FOJA 5IMKA 3BFOA 4HSAC 4H2CA 1M05B 4JFZH 5KSVB 1E9PA 4FQIL 2CH8A 3VFWB 2IMNA 1Q1JL 4LSQH 3S36H 1JZFA 2QQNH 4JFYB 4AXWA 1I1FA 2NYYC 2ZYHA 4GIOA 1YQ2A 1X5FA 1CGSL 2H2SD 4HHAB 4FTVA 4K55A 1RK1A 3NSXA 3G9VA 2CHWA 4WTQA 4K9JA 3BWUF 1LNUB 5AWNH 4PW4A 5M94B 1E5AA 3GHEL 4APQC 3TA4D 2DQDH 2XYCA 3IETA 3QNZB 1R47A 2H1LM 4BA0A 4HIIA 5FO7A 4M9PA 2C1OB 3VWJA 1SHMA 1JD7A 1MLBB 1OGAD 5K93A 1HVXA 2OKMA 4AG4H 1NFIA 4RBPH 5ICUA 5MERB 3M88A 3S3CB 1DANU 1VGKA 1TQCC 1Q90A 4TNGA 1G6VK 1HT6A 1ETZB 2GFBB 3G5YB 3FCUB 5DEFB 1FO0L 1SDDB 4TQ8A 4XWGL 1XT5A 3ZIMA 3RFZC 4TUJB 1Y7VA 2Y7QA 1UGNA 1X4YA 2IVFC 1YYLH 2RFXB 2ENQA 2WSPA 3SDYH 3T77B 4XWGH 1XF3B 3LH2L 3FQUA 3OF6D 2DKSA 1FYTE 1S7UA 3HHSA 2Y69B 1G9HA 1XSOA 1V27A 3LH2H 3VFSA 2O61B 4GW5A 1TZGH 5EEXA 2IG2L 2VDQL 2R69H 1S5IL 3UPAA 4HWEH 4CVXB 3DHJA 3VQ1C 4Y16C 1DDHB 1VERA 5KYUB 4HK0B 2IG2H 2MOVA 1MSPA 4L0ZA 1F4HA 3FU3A 4YSUA 1R9FA 5DD3L 3P54A 1AG0A 4DQOH 1S5HB 4OVVA 2V7NA 1JF1A 2C3VB 3DX1A 3X1FA 4JFQB 4KRNA 3IU4L 2EE6A 2R0WH 5DK2B 4HX1B 1S7VA 4YSOA 4WNJA 2DQEH 1HHGA 3LZRA 4Q4IA 1EUTA 4I5BB 4KJQC 3HE7C 1Q9WA 1HAUA 3UEZA 1T4KA 1SJEB 4K23L 5TDNB 1FZOA 1H5BC 3O9WB 4U2YA 4QTIL 4P23D 3TT3H 4Z0BL 2F58H 2LFEA 3CFCH 5LGJA 3MLYL 2EXWD 4BEIA 4PJFF 4PJCB 2JI3A 3GBNL 4K73A 3VU1A 2F53B 4G3YL 4QHUA 4HS8L 1BF2A 1X6NA 5E7BA 1IV8A 3QSKB 5FYJD 4LE8A 2PYFA 1OZUA 3W56A 1WRFA 3P3SA 3MRIB 3NJIA 4OCRH 5FKPA 6PAZA 3MV9B 5SX5H 1MNUH 1CF8L 2HLEB 3C6LA 1ZT1B 4MSWB 5I1GL 3OAZH 3Q13A 1H8NA 3DVNA 1T5KA 5EC2B 3M46A 4FXLA 1NIFA 1WFMA 2L7QA 1FL3A 3QIBB 1JVOA 3RPIB 1HXKA 1J5OH 4GO9A 4X80L 4Y7OC 1AZNA 1IEAA 5F3FA 2AJXH 3U7YL 4ZMZA 5HHME 2CZNA 3IDXH 4JO4H 3ZKXC 5E6UB 1YC8A 3WJLA 2LLNA 2ED9A 3GYRA 4N68A 5AAPA 4JKPH 4W1TA 3S34L 2AJUH 4ZS6C 4F9PC 1S7RA 2UYLB 2WXMA 1D5BA 5DJZB 3S34H 2WXHA 3GZQA 5FGBC 5D6DC 3QJUB 3OMZA 1D6VH 1JV2B 1KY7A 1HILB 5EBLB 3TIEA 1LM8V 1QBLH 2GIMA 3BVUA 4LDEB 3IAQA 4OAWB 4Z0XB 2X2JA 4R3SB 5TE7L 3ZVVA 4BHUI 4YXLL 4JO3H 1AI1L 3GSRB 2JJWA 3PHOA 3D4ZA 4Y2OB 3T3PB 1LE9A 3CK0L 5IQ9B 4XPHL 4K15A 4FQXB 1CN4A 4UMGA 3RDJA 5JHLH 4Y2DB 5KYWA 5TH2B 4GBXA 5DRZB 1TCMA 3FZUC 4Q97A 1HHJA 1X6LA 1AI1H 2YEZB 3LDBC 3CK0H 3LHAA 4JO1H 3KG5A 4JPVH 2IOIA 5BZWB 4DP5X 1KNOA 4Z7WA 3QIUA 2Q7YB 2XKUA 1A1NA 2A6JA 2X6UA 2FWSA 1E7UA 3PAZA 1NCCL 3Q1SL 4WTZA 5EO1A 3L4VA 3P4MA 3RAJL 1NM9A 1LDPL 4B3VA 4E0RA 3DVGB 3EYFB 3FUNA 5BS0B 5JHBA 3ULVH 4FFYH 1DBJL 3FT0A 5C2BH 1MWAB 1LDPH 1ZIAA 3D06A 5F9WB 3GK8L 3SE3A 4CN1A 4DESA 1PDKA 3EUUA 2VDKH 2EDDA 4GI8A 2B2XL 2CKNA 4DAGH 4H0LC 4HXAL 1GGYA 2W9EH 4ONOA 2ZOKB 5DJ8A 2AP2A 5DZJA 5JYMA 2R23A 2XTJE 3LQMA 3N04A 4G71B 3NJLA 4HXAH 1KTKE 5FM5O 4AEIL 1U3JA 1IFGA 3T1WA 1XF1A 4QJ5B 1H3XA 3OPUA 3ULVC 4TKWA 5E0QA 2E9GA 2X70A 1NGWA 2YPKA 5LLIC 1DJSA 4M62L 1XV8A 3HBGA 3MA7A 4UIKH 4EUPA 1VZGA 3IDIA 4AEIH 4P2RB 4HLJA 5ESQB 3T6QC 4IBWA 4NUGH 3E1ZA 4TM9A 2KH2B 4X4XA 1J8HD 5TF1H 1QUPA 2DYRB 2BNUA 4DPAX 1KN4L 43C9A 1HYSD 3D9AH 5KVDL 2FWOB 1EEYA 1WZAA 3WHE1 2H0FA 5I75B 1A9BA 4J1UB 2X42A 4OF6A 2GJPA 1LVEA 1S6NA 3CFEB 4Y5YA 1THAA 3MFFB 4YXHH 2QSCL 1XF5A 5A1AA 5FLVA 3NZ8B 4KFZC 4RMUA 1AZCA 5DR5L 3MLSL 2BW5A 4FQHB 1OSYA 4FABL 4W9EC 3RU8H 4MQXD 3AU1A 5I76B 2JKTM 5ACMA 3T1FA 2NNCA 2HX8A 2OCJA 1I8KB 3QJZA 3D3VD 2NX5D 4PY7A 5D4IA 1R3LB 3LQZA 2VISB 2MWCA 1IFHL 4KK5C 4NQDD 2XQYA 3CQPA 1S3RA 1ZA6A 2YUWA 5I30L 5SWZD 2COQA 1L3WA 2Y7MA 4JANB 2V17H 3QDGB 2OJEA 3KR3L 4NXKA 4ZO9A 1CBJA 4MMXA 1JGEB 5AKSA 3N0AA 2NYKA 1YNLL 2GTZA 2ZUVA 1T03H 2BRQA 5FLUA 3BYTA 2WQSA 1J11A 1VFOA 4U1HA 2HRPL 4CBZA 2VOTA 4V11A 1GGUA 4B9CA 2QADB 1UJTA 2NZ1A 4Y1AB 1YUHA 5EU5A 5JHAA 4AQ1B 5F7DA 3ZKMD 3QDME 3QW9A 2IFFH 1QSEA 4D8PB 2HRPH 5ETUB 3PHQA 3APCA 1BCIA 3QHZH 1P4BH 2FJGB 1J1OH 2AMUA 4D8OA 3UTTD 3W11D 2P5WD 4A37A 1OANA 1IAOB 4XODA 1A7BA 1MVUB 1JRHH 2X4QA 5FHAL 2GITA 4G8AC 1NUDA 4CA4A 3TC9A 1BZ7A 1IGTB 2GJZB 3SGEH 3FBKA 4OGXL 5FK9A 4PVNA 4A1RA 5T33H 4IJ3C 2VAAA 1ZLEA 3NCJH 3GFUA 4JRXA 3O3DB 4XP9L 5E1IA 4PJGF 4PRPA 4BFBD 3Q01A 3TT1H 2VQ4A 3VMOA 4JKLA 2X4OB 5I1AB 1UZ8A 1YY8B 2WLIA 4KGJA 3WXWL 5E1AA 3L3OA 1WC7B 4G9FA 1F6AA 1SVZA 3CX2A 4ZFOL 4R4FL 4PJGE 1LMIA 1S7XB 1SHXA 4NRXA 3IPEA 4OZHA 4Y9EA 5DRXA 4CJ0A 5HGAB 4LPYA 4XZ4A 1BFOB 4X0KB 5EU3A 3BESR 3ZX1A 1UH3A 3B7SA 4EUPG 1KELH 4ERSL 4DZBA 3UPRA 2W9DH 2CQVA 1X5XA 4G6AC 4MJ6A 1GAFL 3NABL 1HOEA 2BIHA 1KSRA 3B9DA 1MAKA 4P3DA 5HGGS 5EEWA 4HWBA 1QFWL 1X4XA 3H9SB 3KPOB 2AJ3B 3NABH 5I16A 4I0PD 3P2DA 3CHXA 1L9PA 4NOFA 2JQMA 3GB7A 5KSAD 4X4YB 3TFKC 4J6RH 4NFDA 4OLZH 2VKXA 4LEBA 5EUOF 2WLHA 3OKOB 4AH2B 1RZJH 4M8QA 5K1JA 1L0YA 4U4BA 4GNKB 1DO5A 4PH8A 4KROB 3T2LA 4N8PA 4GRLC 4OBSA 3CN3A 4QTHA 4YLCA 1YVLA 1W0WB 2R0KL 1QTSA 2YD2A 3DXAE 4POYA 2KC0A 3U0PA 3I3EA 5EUOE 4APQA 4K7FA 3K72B 1NANH 1EXUA 1U8IB 3GXPA 2J8UB 1PX3A 2OYPA 4WRLA 5GISH 3WG7B 3JWOL 1RZJC 1OT1A 4XNDA 4M43H 2HVBA 1Z5HA 5A2FA 2F74B 3PWNB 3RFZA 4KHTL 4Z78A 2YUVA 1K2DB 2XIIA 2HXAA 3J07A 4PD4J 3ILPB 5I18H 1K8IA 1UWYA 2AXFB 2WYTA 4U6XB 2X2UA 3H1ZA 3LNDA 4DGVH 2CBMA 3NSYA 5EB9A 4KHTH 2OMTA 3TNMB 1B0WA 2R0LH 1CVSC 5KVFH 4RRPA 2RALA 2BVOB 3GHBL 1M7UA 4MZRA 4KV5F 2F1EA 1Q94B 4W6YB 4YBQD 4KXZH 3ZTEA 2V9TA 1ZRUA 1U95A 2EO9A 5EN2A 3ZTNL 2PCPB 3P02A 3QWOB 1CU4H 5GHWH 3T4YB 2JCCA 2QQKH 5E2WH 3LZPA 4K4KA 4Y16A 3TO2A 2ZYIA 4UM8A 2B0SL 2IANE 3OGOE 4QF1B 4XNUH 3FFDA 4LVNC 1K6QL 5LCVL 3QJXA 2EP6A 1DCLA 2R1XB 5C6TL 2HG5B 3TNNA 4KZDL 1SXNA 4GT7A 4MJIE 3F8UB 5LBSL 1ZA3A 2CGYA 4R9HA 5HTSA 1S7WA 5CINL 5BVJB 2ITCA 2J12B 1CFQB 3EFDH 1AO7D 3L81A 1CG9B 1KPVA 1NGYA 5LBSH 3SY0B 4HLEA 1VHPA 4QOKA 4DKFH 2R1YA 4BWUA 3HE7A 1DSYA 3B5HA 2ADIA 2JJSC 3WO4B 2IDCA 3DUSA 1JTOA 5TK4A 1H5BA 2FEDC 3RG1C 2CK2A 4YE4H 3BN3B 5HY9B 5JR1H 1UM5L 3O11A 3LIZL 4N2FA 1PYWB 5IMKB 3NIFB 1H3PL 1BPVA 2VR4A 2BVEA 5CJXC 5I1DA 1E9PB 1S9KC 2EO7A 1N4XL 1UM5H 3LIZH 5GRVK 4AXWB 1H3PH 1I1FB 4A39A 1X5ZA 3SO3B 3BGMA 3HPLA 2Z31D 3I6KA 1AS6A 5DWPA 4HG4K 5GS1A 1NMCB 4FTVB 3VRLF 1RK1B 3WHE0 4ESKA 2Y3AA 2A4ZA 1KV3A 3CX5J 4GXFA 5C0FA 1OM9A 2E56A 2X5PA 1T83C 2JELL 4MBRA 4XNXL 1A7OL 1TPXB 2C3HA 3TV3H 5HHQA 3FO1B 3ORJA 3EYQD 4EIGB 1XH3A 3AC0A 3IETB 2MMXA 3NCMA 4JPWL 4X9HA 5D70L 4AYFA 4HIIB 2RR3A 3STBA 2EDFA 1PW3A 2JELH 5FO7B 3VRLE 4B7IA 4BH7A 4MXVF 1KB9J 3VWJB 3KGTA 3HKZA 2E76C 4G43A 1QZ1A 1CL7L 3KYMA 3RZCC 1BVKA 1HCYA 3C9NA 1NFIB 4F9PA 1VGKB 3SCMD 4LBAA 3B3BA 4PWEA 5I15L 2QGDA 1T21A 2Y7QB 1XGQA 3F6LA 4HOWA 5FGBA 5D6DA 4R84A 2WTPA 2P42B 4WFFD 5FGCE 3E1F1 4FLSA 3HKFA 3ZIYA 2EYTA 1U42A 2G5BA 4UZSA 5I15H 3FQUB 1QQDA 2F8OA 5L0QC 2MTAA 1S7UB 3HHSB 2CDGA 5J9PA 5T1KD 4MHHG 4A2HA 3BAWA 2VXQH 1MDAA 1Z3GH 2PO6D 5DJ0A 3VFSB 3WCYA 4AE1A 5I1LA 1JZIA 3PUUA 5JHDD 3V0FA 2F2HA 4FFTA 3KPRD 5IJVA 1FSKC 4HJ1A 5IBTL 4HAKA 1VRSA 3L4ZA 3VFTA 3UAEA 1B6UA 4WZ9A 1H8SA 3MR9A 2R1WA 2EO1A 4JDVA 4NNPH 4AX3A 2XQBH 3MAWA 2XVLA 4IRJC 1MCLA 3IGLA 2V7NB 1JF1B 5JQ6L 2Z7YA 2A6IA 2Y07H 2O5XL 4NZTL 3ZO0A 3L9RA 3NPSB 2CO3A 4C8XA 3FSAA 5AZEL 4B96A 1X7TA 4GG6A 1S7VB 3BH4A 4YHLL 4XVJH 5JHLA 2X9YA 5IHZA 1HHGB 4NZTH 3ARFD 2VLJE 3O3AA 3S5YA 3HBQA 1Q9WB 1XR9A 1FC1A 1SYSA 3VQLA 1G9EA 1T4KB 3X3GL 1O75A 1FZOB 2VLRA 1U8JA 5B7FA 4JREC 1A7NL 2E59A 2WHVA 3INUH 4AKQA 5KZCD 3ES6A 3X3FH 5LGJB 3AITA 5IT2H 4NRZA 1E42A 4KNTA 5I1IL 3RZWA 4J12A 1NFAA 4OFYD 1AMXA 1KGWA 4QHUB 2HN7A 3E0GA 4KRPD 2J1ZA 2OP4L 3FMGL 2PYFB 2EDXA 1O6VA 1F2QA 2X1XR 3H55A 4QYAA 4IK7A 5CBEA 2IBZX 3IFNL 5FKPB 1OP3H 2DLEA 3QEGH 4ODUA 4XTRC 3NFSH 3C6LB 2ZXAA 2ZWZA 4ANWA 3FO2A 3DVNB 3LHPL 1CGTA 1ILUA 2Y5QA 3O2DL 2APXA 2B20A 3LXBA 1UXMA 2IGFL 1FL3B 4UIMA 1ZS2A 4X6CF 4QCIA 1U33A 1U91A 3D0VA 5E5UB 2W80C 1N67A 1IEAB 5I73B 1PLAA 3EH2A 2F8XC 4KJYA 1ODUA 5DHVH 2OI9C 4NOBA 5DZ9A 3FFCD 4NJAH 1TTRA 2H1PH 2EDOA 4X6CE 1HZHH 1OCZB 3EO9L 4FJYA 2PMZA 3O6LH 4ZW5A 2I9TA 3IJHA 3MI6A 1F4YL 5DFVD 1S7RB 1D5BB 1DJGA 3U0TA 2ISDA 1NTDA 5HYSA 4K3JL 1UD4A 1MFAL 5CZXC 3UAAA 3UC0L 5HD8D 1J9CT 4F92B 1L7TH 4KQ3L 1N12A 3TIEB 4U49A 4MNHA 4K8RD 2IQAA 4K3JH 1YMHA 5CLXA 2X3CA 2Q0ZX 4WI4A 4QHLA 4AGOA 1B0RA 3PHOB 3VXME 1LE9B 1QYGL 1KXHA 3EJQA 2G4GA 3U82B 5KYWB 5JW3L 1F58L 2XZQL 4GBXB 4KFMA 1OHZA 2DQCL 1HHJB 4J3TA 1KTJA 4C57C 2P5EA 4D9QD 5FUCE 5JW3H 5C0EA 1KNOB 3QUKA 1FPTH 2EDQA 4Z7WB 1XCTA 3QIUB 4KVCH 1A1NB 1A0QL 2A6JB 3UG3A 4Z7VE 3FRUA 5EO1B 2BIPA 3P4MB 3VGFA 1R24B 1PLGL 4E0RB 1K4DA 1I9IH 5DRNA 4IKKA 4R90L 4PRHA 4GKOA 2WXLA 4UQCA 4GIAA 3HB3D 3L7EA 4PJBA 4YZFF 1PDKB 1Z7JA 5D93B 5FYLL 3ISRA 5HJGA 4ELMF 5L2JA 4QGYA 2FNWA 3SIKA 3KW8A 1I1RA 1QW8A 3VYPA 5DJ8B 1D7FA 2R23B 1TZOA 4YZFE 3V6OE 1RZFH 4ZAKC 3DK0A 2UZXA 2YPKB 2X70B 1NGWB 3MA7B 2NQCA 4EUPB 2PPFA 3IDIB 4P4RA 3M7OA 4YBHA 1EO5A 1CMOA 4YC2C 1HDMA 1YUKB 3CXDL 1TDQA 3QUYC 2F8VA 3FN0L 4X4XB 3P3UA 3ATAA 4CVUA 3LS4H 4HLZH 2BNUB 4JZOA 4PCTA 1JHLL 1XD0A 2R8SL 5ENWA 2DQFA 2K4WA 3OKNA 1TQTA 3EOYG 5GGUA 1EEYB 3CDYA 3VFGH 3PV6A 4XVTL 1MJJA 1A9BB 3HZYA 4J3OD 4RWHA 4XNMA 4Y5YB 5LQBH 1AE6L 3ABKB 1XF5B 2XY1A 5MENA 5EU7C 2UXGA 4Z3FA 2ADYA 3AU1B 4BWWA 3T1FB 1TYRA 5BZDA 1CVRA 4PY7B 3TTSA 1DO6A 1CDJA 3LQZB 3CMOL 5KANG 2VDMB 4ZFOA 3W0WA 1A8JH 1IC1A 1RERA 3TOPA 1ZA6B 4PB9L 4OCNC 4GRLA 2F1BA 2OJEB 2Q3ZA 4MMXB 2TRYA 2WM0A 1E40A 4PRNA 1A3QA 2GTZB 3L4WA 5JTWA 1N0XL 2QELA 3H53A 1HH9A 5E5LA 1R19A 3C75A 4U1HB 2BVQA 4GPVA 2DQMA 1Z9LA 2BY3A 3RVVD 1BBDL 4N9GA 4NC2B 4TS6A 2SODB 3KPMA 5FDWA 1YUHB 1CYWA 1N0XH 2Y2WA 3G6DL 3NDYE 4RCAA 5EU5B 1WWAX 3A6CL 5F7DB 4B50A 4JHZA 3B3IA 1QSEB 1UWXK 5C3TA 4Q4EA 3PHQB 3D50A 4RFNB 1P7BA 3A6CH 2VN6A 5E2JA 5A2IH 4PJXF 1FNGA 2NW3A 5F70A 2NY3D 5E6ID 3TEXA 3VI3A 2D7NA 5K69A 3IVKA 2X28A 5A2BA 1AG6A 3UO8B 5JPMA 3TV8A 1A6UH 4XHJC 2ZKHH 1F6LL 1JDCA 3UAJD 2ZAIA 4NZRH 3CZFA 4UWQB 4KTEL 2X4QB 2GITB 3QCUL 4PJXE 3EYOA 1BZ7B 1TEGA 2GK0A 1BF5A 5BV7L 5FK9B 3K4ZA 4Z3EA 2VAAB 3E2HB 4JRXB 3MXVL 1L7IL 4PRPB 4TVPE 3ZL4H 4WW2C 1RHHA 3VCLA 1N6UA 2BSEA 3BLKA 2WBKA 1XSJA 1ET5A 1UZ8B 1XXFC 2WLIB 5IBUB 4OGQC 1G7HA 2EILB 2VDNL 3L3OB 4NENA 4R96A 4G9FB 5E1AB 3IMBA 1F6AB 4NRXB 5DRXB 5DEGA 4OZHB 4RMRA 3UTSE 2H1XA 4BFEA 1A5FH 3WELA 5EU3B 3U79A 7FABL 1JFQL 4IGBD 2WXPA 2RJMA 1IT9L 4EN3D 1A7PH 4LRNL 4DZBB 3UPRB 2EVFA 1SUJA 4JFFD 4PN6A 2JJSA 4GAJL 4MJ6B 5H37H 3PL6C 1LDSA 5BV7C 4Z3JA 1HIMH 4MJJA 4P3DB 2PWFA 3OWRA 3BI9X 5I9QB 3HC3H 3NFNA 4L3CA 3Q2WA 1HHKA 1T0NA 5LAPA 2AEWA 5LCVA 3O0RH 3T0VA 5CJXA 1FYHB 2VO8A 2ZUXA 3GB7B 5I0YA 3ZN6A 3VXQA 5LBSA 3NA4A 2DPKA 3FSOA 2XN9A 5HYJD 4XR8C 1A2YA 2XFXA 4KI1A 4M8QB 3GIVA 4YO0A 1TQWA 3GBDA 1E9OA 3IB4A 3WLBA 3OJDA 1T83A 2BX5A 3GI8L 4QTHB 5D1QE 3ARWA 3G9AB 4PJ8D 2HX9A 3U0PB 4APQB 5F71A 1I7ZA 4K7FB 3FT9A 3BFWA 5TQ0L 1S9VA 1EXUB 1NMBH 4DQAA 3LIZA 3W38A 4G7YL 3MRJA 2ED8A 1FORL 1KIQA 1INDL 2NDFA 1RJZA 3RZCA 3KM2A 4Z5RA 3ZDYB 4BFKA 4G7YH 3SOBH 2JI1A 4GKNA 3UYRH 1TQCB 4HMCA 5JUEL 5ES4B 1JZEA 3BWAA 4KJQD 2AJZA 3RFZB 4Z78B 2WVSA 3GBMH 5DJ6A 1OHQA 1K8IB 1UD2A 2DIBA 4IM8A 2CHZA 3GJFK 4U6VL 2OMTB 1PY9A 4Y19D 3SE8L 1JYVA 3HAEA 1RIUL 2JLLA 2GJ6D 4OCYL 1GIGL 2Y1AA 2CE6A 3PHAA 2F5AH 3GLEA 4KZEH 3ESMA 1Q0EA 1U95B 2DMHA 5EN2B 3UX9B 1LGVA 5EBMA 4XMTA 2JCCB 3A6BL 1OCWH 1RIUH 1WFNA 3WSQL 4Y16B 3TO2B 4UM8B 4R2GC 5DYFA 2I5YL 4ODBD 4XNYH 1AC0A 1TENA 1JAEA 3U1SH 3TNNB 4P2YA 1JZGA 1ZA3B 1QOKA 4HIXL 2PPEA 2XPGA 3SDAD 3TBCA 2J21A 3O0LA 4AK2A 1EZSA 1S7WB 2XX0A 3GMLA 5EORH 2ITCB 1GHFL 1NGYB 1KPVB 3GIZL 4HIXH 1BQUA 3ARED 4JR9L 4QOKB 1VB9A 2R1YB 3HE7B 3BIKA 5FEBA 2BJMH 3NQIA 1DQML 1QLEH 2ADIB 1GHFH 1V3MA 3DUSB 1H5BB 4JUSA 4WV1C 5GZND 2VDQB 5AYUL 5HHXL 4E9SA 1YECH 3ETSA 1OCOB 4ZXBC 5IQNA 5EH1A 1OP4A 4AVHA 3O11B 1BXUA 4F93B 2C5DC 4ODXA 2LLGA 2VIRA 5I1DB 3ZTCC 1CE6A 1JYXA 1GZQA 2QHLA 3MRDA 2XZCL 4QWWD 4OIBA 1MIEH 4KOCA 3BGMB 3HPLB 2YKLL 3I6KB 2Z8VC 5GS1B 2KLRA 4KHXH 2YWZA 4GS7C 4PJ5A 1FNLA 5D7LD 2IALA 4Z7IA 4ZW6A 1OAKH 1UH4A 1T7VA 4UF7C 3V4PL 5BO1L 2I25N 5ISZD 3MCKA 4B9YA 1HH6A 5HHQB 2BM3A 3B5TA 1Q38A 1XH3B 3FU0A 4AYFB 5AB9A 4BH7B 3EFFA 4XNZC 1U3NA