3R19A

Chicken sulfite oxidase triple mutant with altered activity and substrate affinity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
372
structure length
372
Chain Sequence
b'DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGMLSTAWHRVRVSVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite oxidase
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 95
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r19A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r19A01
2A9CA 1XDYA 2CA4A 3R18A 2BPBA 2A9AA 3HBPA 4PW3A 1OGPA 2C9XA 2BIHA 2XTSA 1XDQA 3HC2A 2CA3A 2A9DA 2A99A 2BLFA 2BIIA 4PW9A 2A9BA 3HBGA 1SOXA 3R19A 3HBQA
chains in the Genus database with same CATH superfamily
1BF8A 1EFXB 2MNUA 5DHMC 5EULV 2QMJA 2GBVA 5BW7C 5IMKB 4LKXB 5GS1C 3QO0A 4NCC1 3H9SB 3IDJB 3DUUB 4ODHH 4PJCA 3VWJD 4HEPA 4H20L 1KJVA 5T1LB 1JWSA 5JNYB 1RZQA 1KXTB 5C97A 1VEPA 5DZVA 1KF9B 5HHNB 3MBEA 1HZHL 3O6KH 2MIZA 1F02I 3WFEH 2PTTB 2BMKA 2EJ1A 4KMTH 5E4AA 2XWTB 3RTLA 2VDRL 2NY3D 2V0AA 4PJIF 5AW8B 2VXTH 3TZVC 1MLCB 1E90A 2BW5A 2OJZH 3DUSB 1OAQH 4PLKC 3ZUNC 4CC4C 1OPGH 3QC6X 1A9BB 1HWHB 2DL9A 3BDYH 4XMVA 3VRIA 1JXFA 4GI9A 3I02A 4N5UA 3I9IA 3DX6A 1NCBH 1USZA 4ZUTB 3WL9A 2AJSL 1EZUA 4YFEA 2VC2B 2Z31D 4Y8DC 1CD9B 4LL9A 3NACL 3HAEB 3H53A 4P46A 1T1XA 1NAKL 1ORQB 3BT2H 3MZGB 4HUVA 4LHUA 2R1WB 5F8QC 2ICES 1MJ8H 3QZBA 5DURB 1EBPA 3ZDXE 4IMKC 4F9PC 1MXGA 3SDXB 4U6HB 4NUGH 1BW8A 3UZVA 3KEHA 3V5DA 4A7QA 2OMVA 4DK6A 1S5HB 5DT1L 5ETUA 3L5IA 4H8WH 1ULVA 2Y06L 4PV8A 1K85A 5G5DA 2EIZA 2FL5B 3GSUA 4X9IA 5AQ0A 5AKSA 5DTFA 2P24A 5IESH 1QSFB 3BSZL 3FUEA 1KCVH 3BZ4B 5BJTA 2JMRA 4OFYD 4WUKL 1EXGA 2DLTA 3ZE2E 3CHSA 4N2IA 4F2EA 3MRLA 3VH8A 3DRTB 5SV3A 1S46A 4IRZL 4JPVH 4LOEA 3OJDA 4QHLB 3VGFA 2V33A 4U31A 3VFTA 3LPOA 4JANB 1PIGA 1BZQK 1FNSH 2Z93A 2Q86A 5BUGA 5DQ9A 2XBZA 3W0WD 4FKEA 4NO2B 1ZK9A 1A1NA 2EDTA 3F62A 3KMDA 3DARA 3NSFA 3NCYP 1RIHH 2Y7NA 1U6AL 2ZT9C 1SEQL 1XGZA 2FQDA 3QDJB 4P57A 5CGTA 5HJDA 3SJVE 4DP5X 3UJJH 2G5UA 3FU3A 4LPVA 1JDAA 3ZXAC 3LXCA 3QYMA 2WP3T 1X5AA 2VISB 2NCMA 3U4KA 5IJVA 3LKRB 3RAJH 1OB0A 3ESUF 1RPQA 4Y19B 2BFVH 5GS2H 1NTDA 3HMWL 4P5KB 4EKXA 2YUXA 3DWTA 5DRNA 5TTRA 3I9AA 1LDPL 2QTVA 2DKUA 1J1XL 4DETA 4KITB 5I6PA 2ZXEB 4O02L 3MV7D 2DYSB 5E7FA 1WAAA 1MFVA 4CVZA 2R1YA 1XCQB 2HLAB 2GBAA 2FAUA 4U3SA 5JIQA 2V2TB 3D39D 3C2AL 4Z3FA 3M8OL 1OT4A 4QLWA 2VSKB 3EJZC 4RFEB 1E3ZA 3D9AL 2I24N 5KTEL 1VEMA 2QSCH 1MJJA 3WNNA 2ZCKL 3E9TA 1DN2A 1YEEL 4OD3H 4G43B 5B3JE 5IV2B 1CZ8H 1QPPA 4HFUH 1EMTH 2A6IB 1TTAA 3DX7B 3GXNA 4PJFF 4RAVB 3RIFK 4CN6A 3QQ3B 4F1ZA 4KZ0A 5DEZA 1MNUL 4OSUL 4RX4D 3TO4B 1H15A 2B1OA 4L4VE 3KGRA 1CC3A 2E6JA 4X80H 5D1QC 4ZMPA 4LCWA 1CDGA 5FHAL 3QDGD 5GS0C 2IPKA 5GSVA 3TNNB 4Z7QE 5J6GB 3QNZB 3CLFH 4FTVE 3VDAA 1SQMA 2FSEA 1E4JA 2PYEA 2VQ1B 4OGXL 5FUOL 1G1OA 1BQHG 1LO3L 4IS6A 2DYRB 3GBMH 4P5TD 3EHBD 3W37A 4CU7A 1OP5K 1VAHA 4QRRD 3U82B 5F88A 3L1OL 3MNWB 3LXUX 4M8RA 3U9UA 4ZW5A 5EF3A 5DDHA 4RBPH 5E56A 1ID2A 1I9JH 4GUPB 1TQVA 4L3CB 4XP9H 1T1YB 1W0VA 1PNCA 3IF1B 3QFJD 3FC8A 3EYFA 1H3XA 1JVKA 4X0KA 2A7BA 5BRZD 3DO4A 1UACL 4PJ9A 5CR8A 1G9MC 5SX5K 3OV6A 5DUBA 1G94A 1I3VA 1J48A 1MVUA 3P0YH 1E2VA 4Q74A 3F2LA 4UM8B 1PNDA 3MLTA 3EOTH 1BPVA 3IDYC 1CDYA 3VG0H 4R4BA 1DO5A 4NS0A 1XGRB 2AAAA 4I9WE 1NJ9B 4M1DL 4ZW6A 3ARGB 3VFPB 1AIFA 2L4OA 3ILEA 4PUBL 3NQIA 5LAXA 3RPIB 1PLAA 1OW0C 2J56A 1E7UA 3SDDD 4JJ5B 3G5WA 2LR4A 3GLEA 4OZIF 2J21A 2H41A 1A1OA 5E5UB 3MODH 1UB6A 5F1IB 5AOZA 4XX5A 4EOWH 1MAJA 3DOIA 4XXCA 1TZOA 5A3ID 4RIRA 3NACH 4LL1A 2ITFA 4KKCD 5L0QC 3C5XA 3FOMB 4GRLA 4JY5H 5F1SA 4FMKA 3O2WH 3BQUB 1NAKH 4ICWA 3ZTCC 4Y5VA 4PBWD 3TO2A 4FJYA 4PJAF 3TURA 1P6FA 2APWA 2JWYA 1ETJA 3EAKA 1EK3A 3C5ZA 2MOGA 3JTTA 4YQXL 1CFVH 3B7UX 4R0LB 4TL5A 2DDQH 3QZOA 2VNCA 4UT9H 4CMHB 1H6TA 2F2HA 1U91B 1UM5H 3M86A 1BZEA 2VWEE 3LRMA 3BSZH 1XGPA 4ONHB 3SKNA 3AQZA 3IFLL 4IBLT 1HHGB 1Y6NR 2QQQA 3HEIB 5JW5B 4F7TA 4NO5A 5T1DH 3KYMB 1KDJA 4TNGA 4X7CC 4K3GA 5LKNA 4P23A 1QZNA 1ZHBB 2P7TB 3KPMA 5D2NC 3T0EB 5HJ3A 1J18A 4IDJH 2P1YA 3GHEL 5EIIB 3FO1B 1V3MA 5CZRA 8FABA 2NYKA 4LF3A 5JOPD 1UJ3C 1J0JA 2BNRD 5F21B 3HE7D 1JCVA 1XV8A 1SRDA 3CHQA 4FNLL 1LTXA 4N6RA 5MP6H 1N3NB 4QNPF 5D1XE 5LGYA 2EABA 2ZWSA 5J13C 1R3HB 1A7QL 4OF6A 1XIWA 3C60B 4HIHA 4B9YA 3TNMA 3ULVH 3HHMA 4J6RL 4Y7MA 5ILTL 4YGVA 4EE2A 1T7ZA 2MQCA 5E00A 4MJJA 1A6AB 2PTUA 2GT9B 4E0RB 4G83A 1MCOL 1X7QA 5BQDA 5SWSD 4BFJA 4K8RD 5CLWA 3PIQA 5KUKA 2A38A 4HJSA 2YPLE 3WNPA 3H6AA 5JPNA 1JOIA 2PW1A 1P4BL 3FRPG 5DS8B 2XWZA 2YIHA 2K70A 3OMNB 5K9QG 5T5NF 1C5BL 1NSNH 5I23A 4DNLA 2UZXA 2W9EH 4TQ8A 5E1IA 4X6EB 3O3BB 3VUAA 3ZE0E 1QBAA 1CE6B 1JS4A 2IDCA 1UB5B 4Y2OA 4HUCA 5CJXA 1AP2A 2BNUA 1BHGA 2ODHA 2ED8A 2DLEA 3HLAA 1TQBB 2SEBA 3DX0A 3CCHA 1M2OA 4JVPA 1ZLVK 4GI8A 1AGFA 4J3WA 3LMJH 3OXRA 4IHOA 5KTEH 1WEJH 4PW9A 1MHCA 2PP9A 5DJYA 3BP7A 3NA9H 2YA1A 1ZLSL 4M5ZL 5T33L 1YEEH 3N0AA 1KV3A 3ZKMD 2KERA 2NW3A 1AZNA 4LSDA 5IF0A 5DO2D 3QXAA 2E46A 5FF6A 5HBBA 3DYOA 1BXUA 1RK0A 5E6UB 5E2JA 3O3AB 3LKOA 5DZJA 4ZSOB 3ULUE 2DD8L 5FGSA 1K8DA 3BC9A 3MLYH 1P2CA 5HPMB 1JGUL 3P1VA 2Y5EA 4OZ4B 1QTPA 1L9SA 2R0LL 1U3HD 4CN1A 5FHAH 3UYPB 3BWZA 4LLMA 2C9RA 3FKUS 4Q6IB 5D4JA 1G9NH 1QQDB 4MKTA 1J9TA 1FP5A 3HJEA 3QRGL 1GCFA 1YMHA 3NIDB 3K1KC 2DLFH 1NICA 1YDPA 5F9JA 1GC1L 3GSNH 1UEMA 5FUOH 2V2XA 4FL4B 4H26A 3U9WA 1MELA 2VLLA 2VUOA 1CYGA 2WSPA 3W39B 2YSTA 2PWFA 3L1OH 1YYCA 3FH7A 1JXGA 1T83A 4NQVA 2WBJD 4BZ2L 4X9GA 4L5FL 3QNYB 3QUYD 4JO8A 2HPTA 3O8XA 4PWIA 3STZB 4FAAB 2AV7B 3JV5A 2IWGA 4GSDL 2Y7OA 3FFOA 3KH4A 4FHKA 1WC7B 1GJWA 1ZCRA 2OXHB 4KKRA 3ZHLA 5T3XD 4HPYH 3UJIL 1JGVH 2JI1A 4YWGH 1S3KH 5H8DA 3TASA 3DO7B 4BZYA 3L3KA 1HEHC 4XRCA 1BZ7B 2KZ1B 3K7UA 5IVXE 5E9AA 1Q0XL 2FT8A 3BPOB 4YSEA 2WXGA 1FPTH 4FZEH 5CP7B 3NJIA 4M1DH 3HI5L 1A6VL 1HSBA 2DN7A 3QJVB 4M3JA 4POYA 3MR9A 4MQ7B 2OSLA 1DQLL 1UFGA 3L7EB 3E6FB 5HYSB 2DQTH 2EYTB 5JPMA 3NCJH 1M7IA 4KC3B 1WWWX 1A7OL 1DBAL 3K3QA 1CK0H 3SGJA 1B4JL 5GGUB 2AEIT 2Z7WA 2W81C 3WE6B 5I6XC 3HR6A 3C75A 3OKNA 1PDKA 4BK8A 1IAOA 3F04A 4GFTB 4UB0L 1N68A 4RMVA 4G71B 2JKWA 4KJPD 5SX4I 3QG6A 2N0KA 2CLRB 1NCCL 4HEME 1JN6B 5K9JH 5KVGL 4WWKB 4PRPA 2OMTA 4ZUWA 4MD5A 3VGBA 4AK2A 2XETA 2UXTA 2M1KA 4CBPA 3D3VB 1HXKA 1X5KA 4FFZL 4DGVH 3NDZE 3OB0H 2VR8A 4P46D 1G7MB 3ARFA 1EUUA 2CNYA 2EDWA 4OIBA 1FC2D 3BWAA 1DQMH 4I1PA 3JV0A 1MPAL 1HH9B 4LHUD 3V4PA 3QQ4B 3W38A 3IMRA 5TH2B 1AGDB 3ZLQC 2E8ZA 1TZAA 4YHLH 4N2EA 3IJSA 2JCWA 3LHPL 3BKYL 5IB5A 2ARJQ 1JPSH 1WZKA 2CRIA 3APMA 3LXBA 4Q9BA 3TX4A 5CEZD 3S8GB 3GB7B 4KKZA 4LSVL 2XA8L 1TNNA 2CCVA 3EYSL 3MV9A 5FGBA 4YHNB 2C4FU 4N8PA 5JHAA 3IRPX 2WLJA 4URTB 1YECH 4PWKA 4AJYV 1MUJA 1CXFA 2YQBA 4FFYL 1MQKL 3VXME 5EFIB 2O5YL 3DV4A 1M2VA 2X4OA 3CUPB 4HLZG 2HKFL 3T1FA 1CIDA 3S37H 1IAIH 9CGTA 4RMBA 3FBKA 1MW0A 1U3JA 4F3FB 4Y4FA 1CGVA 4J6RH 3Q8AA 3ZRFC 1DBMH 1NAMH 1D5BB 1OE3A 1TZIB 1YMMB 1UD4A 2CUMA 2DQEL 2DQHH 3D08A 3KS0H 3KWVA 3RURA 3OL2A 4RDBA 4CSTA 1IGCH 5BUAA 1E30A 2YD1A 5FYLD 5KVFH 2GJ6B 4XPBH 2DJUA 3A6BH 2L0DA 4MCMA 1SUHA 3CSYA 5AAPA 1FAIL 5MEOA 1Q9OB 3DGGB 1SNRA 4MJ6B 1R33A 4DGYL 1C5BH 1ZPUA 25C8H 1T1WA 4F7CA 2QPSA 4V33A 4WO0A 1SZNA 2FO8A 4L23A 3CDGB 2WNXA 3E3QE 3JBG7 1Q1JL 3S35X 3AXLB 2XWDA 3K6NA 5LQBL 3I6LD 2XC8A 2CLVB 4WGVB 5CIPB 5TDNB 1UT2A 4KUZL 1KCRH 1I9IH 3EJYC 3KR3L 4KH9A 4ZAKC 1KXHA 4Z3HA 5MEPA 4M1CC 3VFGL 5T3XL 2DH2A 4NJ9L 3IMTA 3T0BA 4FXKB 1CVSC 3ZT7A 4WUUD 4MJIE 2PP7A 2AABH 4FYQA 4NNXA 5T33H 1U8HB 1GZQA 1A64A 1QEWA 3H42L 1KJMA 3RL1B 3VXSB 4X6FA 5EUKB 1WA1X 1H9VA 1MJ7L 2QLVB 3LRKA 2AP2A 3QJHA 3U2JA 3OLDA 1UM6L 1B90A 4X4YB 1QFHA 1N67A 1BSIA 3LKPA 4H8UA 3EDEA 2DKSA 4K5NA 3MLVL 5D5MA 3FPYA 2BY3A 3HTLX 2Y6TE 2EH7L 4HGWB 4PJ5B 3U7YH 5C0FA 2V37A 2TAAA 1T3FB 5DJAA 1KTKE 4EEEA 3AM8A 3CFJB 2Y1VA 3D48R 2OMYA 1P9MA 4GO9A 1C5DA 3DYMA 9PCYA 4X9HA 3VGGA 1ETZB 1ZJBA 3QIWD 4L4TD 1MW1A 1E9QB 4PH8A 1NCAL 4NO0B 1IGTA 4GMTL 1X44A 4QNPE 1BAFL 2LVCA 4BINA 4QCIB 4I1RA 1GGBL 5GZOA 3RZCB 2VXVH 3TIEA 5D7KD 4FHJA 3LPGA 4MCNA 4HKXA 1R5WB 2XN2A 2KQNA 1EFXA 1AGEB 2PWGA 1W0YT 3SE3A 4RCAA 1P7QB 2WZ0A 4LAQL 5IMKA 4LKXA 5TK2A 2ZCHL 4GRWB 4H25B 4ZFOB 3VXRB 3H9SA 3IDJA 3DUUA 5C0AE 3M1BB 5JNYA 3QH3B 3MJGX 1KXTA 3L4CA 3NJMA 5HHNA 3IGLA 2VH5H 4GP5B 5CEZL 3MRGB 2JLPA 3VVWA 3AMLA 2PTTA 3KJ6L 4LGSB 1DVQA 2XWTA 3RY6A 2JLLA 3MUJA 2XQYK 1O7SA 2WOYA 1A6VH 3HI5H 5DFAA 2DOCA 4Q2ZB 1KBBA 1MLCA 1SHXA 1DQLH 3DUSA 4E2OA 1AGCB 1XF4B 1A9BA 2VTFA 1SBSL 4E5XG 1XH2A 3MI6A 1A7OH 1DBAH 4ZUTA 2IANE 5HP5A 5F3FA 1B6DA 4PWFA 4EDXB 3FSWA 3HAEA 5AW1B 2IPTL 3AAZA 2HTKD 2QELA 4ODSL 2H1XA 35C8L 4UQBA 1OAYH 4UANA 1ORQA 1T4KB 2QDVA 3ISWA 5HDQL 5FYLL 2EEXA 2X0VA 1QNIA 4GQ9H 1D5XB 3APFA 4K8RH 4PWJA 3SDXA 4GNKB 1JNLL 4U6HA 5CJOL 1HFUA 5C08E 5FWQA 1S5HA 4GRLD 4NKIH 4N1HB 4MBRA 1RCYA 2LGNA 3VYPA 4MB5A 5BS0B 4ZODA 4YHKH 1TKWB 1ZEAL 2PO6B 2FL5A 1FHGA 2YK1L 1N64L 2EACA 1QSFA 3GMPB 3BZ4A 4XWGH 5C0GB 4BFIB 2NR6C 3K2UH 2JTDA 2J1WA 3AQXA 4NKDB 5A2BA 1JRHH 2DBLL 4OJDH 3FU6A 4OGAD 3V0DA 1BFVL 3DRTA 3HE6D 1ADQA 2XA8H 3VD2A 2Q0ZX 2GIXA 1HL9A 4L0ZA 4L8SC 4QHLA 2BY2A 4JANA 1OTUC 2DQJL 4YDLC 5MEQB 2MQ3A 5CKGA 1QWHA 1OK0A 4ETQB 4HIIB 4LIQE 1E6JH 4NO2A 1AH1A 1MRFL 2WY3B 2JJWA 1SF3A 1MEXL 2KC0A 4N0UE 4LLWB 4S2SB 4BQBA 3O9WD 3VFUB 2EE6A 5DD0L 5FK9B 4OLWL 1JTPA 4PG2C 3L3JA 4LDLB 5GGVL 2D7QA 4OLEA 1XIWD 1ZE3H 4F1SA 4N0RA 2VISA 3L3GB 3LKRA 2BVEA 4Y19A 1WT5C 2VXSL 4P5KA 3ZDXB 3B9KC 2CDEB 3SCMD 3WKYA 3PNRB 3ISYA 5D1QE 4IEFB 2F54D 3MREB 3GZKA 4E9WA 4LVHC 3AITA 2AQ3A 4JHWL 4APXB 2EDNA 3QUML 4BFOA 3ERXA 3HHSB 3R19A 1SVCP 3P2DA 1RK7A 3FF7A 1XCQA 4PRHE 2HLAA 3WD5L 2V2TA 1KLGB 3CXHJ 1RZJC 3TN0D 4X42A 5DC9B 4CSSA 2OL3B 3CZUB 4RFEA 1Q9LB 1ZTXH 3JVGC 3KR3H 7FABH 2DQGH 1BGXL 2OQJB 4YE4L 4N2HA 3FFCD 3HMXA 4DP7X 5T3XH 3P0GB 5TK4A 4G43A 5IV2A 4S11A 1XH3B 2A6IA 3DX7A 1QFWM 4JX0A 4UNTA 4RAVA 4MZRA 4F8NA 1O6VA 2XZQL 1GTNA 3QQ3A 3LQAL 1NGZB 4NUJB 4MMXB 2D7PA 2O1AA 1CS6A 1ZANL 1X5IA 2WXRA 3ATFA 3SPIA 3TO4A 3OGOE 4Z7WB 2FK9A 4R5XA 2GJPA 1X5JA 3SJVB 3MTRA 1NWPA 1O0VA 3TNNA 5FYKE 5J6GA 1BVOA 3QNZA 3VGEA 4ANWA 2VQ1A 4KNTA 4R90L 1G6RH 3N04A 4KK9D 5EZJB 4TM9A 1S78C 3TYFB 3MNWA 1Y6MR 4DO4A 1JGIA 3DXAE 4GUPA 4ANXA 4L3CA 3WDJA 4ENEC 3A22A 1T0OA 4JMXA 1T1YA 4IJ3C 4OAWB 4D8PB 1GGBH 2V7NB 5IUSA 3IF1A 4G7SB 1PJ9A 4OFIA 4Y8AA 1R46A 4Q14A 3TA3D 3LDBC 3ARPA 4HH9B 3EH1A 1A7PL 1INQB 4ZS6C 2ZCHH 2QKSA 4JM4H 2MWCA 1KXVC 2O61B 4UM8A 3Q2LA 2NX5E 5CEZH 1SOXA 2ESVB 1XGRA 1DCLA 3MRQB 2IH1B 2IQAB 4JW3A 4KVCH 2BSDA 1NJ9A 2YEZB 4LOFA 3ARGA 4L1BA 3UEQA 3VFPA 1A5FH 3C6LB 2IV8A 2VO8A 2OZ4A 3P3SA 4OCYL 3RPIA 4YNYB 2AJVH 2UZYB 4BHUA 5B8CC 4NQTA 1Z9PA 4JJ5A 1L9NA 1HHJB 1R19A 2HLFC 3LZNA 2C3HA 1SBSH 5F1IA 2HA1A 4I3RL 4L4VB 2J3SA 2PYFB 3NTCL 1XT5A 1IFHL 4WENB 3OHXC 4OVVA 1M05B 3ARQA 5JUEL 1CURA 2FDBP 1JI1A 3D25B 2IPTH 3FOMA 4NJAL 1I9EA 5LNDA 3AWGA 5IFAL 2JKIS 4R3SB 3DTXB 4MDJB 3BQUA 2AF2A 1UKTA 4FTVB 4G70B 1IT9L 3T6XA 2CA4A 4Y2LA 1BQ5A 5HDQH 2DV6A 3CFDB 4KMQA 1NZRA 4BUGA 1KPVB 2O5NA 4C47A 4LQFH 5A2AA 1JNLH 2ZF9A 4KK8D 4GO8A 1HKFA 5FFLA 2UY7B 1BFTA 2X9WA 4YEFA 4JKKA 1BMWA 4J3OC 3RWJB 1KYOJ 2NXYB 4JRXE 1U91A 1ZEAH 3RB5A 5HVHC 2YXMA 1N64H 3ZL1A 1ZLUK 4ONHA 4PHZA 2W1NA 2JQAA 3E2HC 1HHGA 3DX9A 4MXVF 5JW5A 5HHQB 5J11B 3U1SL 3MJ8B 4J12A 3KYMA 1ICTA 4O9HL 1U42A 5FOJA 2DBLH 2P43B 1X6LA 3PUUA 2WQAA 1BFVH 1ZHBA 2P7TA 3T0EA 2W8CA 1FRGL 5EIIA 1I7ZB 5DS1A 3FO1A 2P8MB 4MD0B 4M6NL 4XP1H 4FLHA 2AC0A 4PG9B 3UTPE 2IH9A 4Q9QL 1GS8A 1N3NA 3STLB 1CF8L 1HCVA 4R2GD 4R97B 1SXZA 1R3HA 2XKNB 3C60A 1NCDL 3FN3A 1I53A 3BE1H 3T6VA 1QD0A 2XQ0A 3VWJC 1FHNA 3BW9B 4M7LH 4OLUH 4ES9A 3LRLA 1HT6A 3AABA 1A6AA 2GT9A 5DD0H 4E0RA 4JPSA 3VD0A 4KDWA 3HNTL 1AS8A 3PXHA 2I32A 4GPVA 5A2KH 3TT1L 1DSFL 2NY3C 4S10A 2EICA 5DD1L 2B08A 1ETB1 3WKNA 3ALXA 4Y2DD 3ESOA 4KQ4L 3ZKQD 3UZEC 4ZFFB 2YZ8A 3CHPA 4X6EA 3O3BA 2NY6C 5HHPB 5AYTA 1CE6A 4DERA 1AFVH 3QUMH 4TRPL 4WFFD 1UB5A 4MNGE 4XCCL 2FLRT 4AGLA 5EUOF 4UTBA 3KW8A 1M1SA 1XAUA 3BFWA 3VQLA 3ROLB 4ELKB 5J57B 2AQQA 2P26A 1CFMA 4NX0A 1ETA1 4TLSA 3UEZA 2ATKB 3LKQB 5IG7B 4GUCA 1B9KA 2CAKA 4AOFA 3AREB 4AGQA 5ANME 1BGXH 5IJKC 5DR5H 1TYRA 4GP8B 1K2DB 2JQMA 1A65A 4L1HA 1QLEL 1SY6H 5AZ2H 3HG1E 5FPIA 2CMRL 2UWEF 4BSWB 1T6BX 4G3YH 4NAJA 1NM9A 5JXEA 1HNGA 3O3AA 2VDML 3NGBB 3N2JA 3ORJA 4WW2B 5D1XB 5ESQB 4ZSOA 5F3BB 1ZANH 5C3LD 2VDPL 3B43A 4EN2A 5HPMA 3SDYL 5AOLA 4OZ4A 2AK4E 1RZPA 4GQQA 3UBXG 3T4AC 2M2DA 3L95B 3FUJA 3ZO0A 3UYPA 4MKMA 2CD0A 3FNKA 3OMAB 1AC6A 2N7SA 4LSRL 4Q6IA 3S96B 1NLBL 7CGTA 1RUKH 4MSWB 4CAGA 2YFNA 5J56B 4NENB 5AWNL 4P07A 4PRDB 3HNSH 3S5LG 3U9PH 2EQDA 2YPLB 5KUMA 2VW7A 3ELQA 5AUMB 1GZHA 4KRPD 2NTFB 4PW4A 2NT1A 4R90H 5EOCJ 5D4QA 5MERB 4IQHA 4NM8L 1MI5E 3TJEH 3W39A 4BGLA 2YEQA 5ISZE 3ZE0B 1DSWA 3OPUA 3QNYA 5IB3B 4XC3L 2CO3A 2F7PA 1BZ8A 3ELAT 3FU7B 4G5ZL 3STZA 3VJ6A 3Q05A 2AV7A 2YO3A 2GC4C 1JIBA 4EKJA 2E56A 1F41A 3V0IA 1WC7A 2OXHA 3SO3C 2YUWA 5I26A 1CLYH 5C0IB 3NCWA 3DO7A 1M56B 4PRIE 4RFOL 2Z8SA 1MY7A 1MQ8A 5E1GA 4M4RB 1JMZA 1CFTB 3VFSB 4CGTA 1BZ7A 5CZXC 3TFKD 1G7LB 1X9LA 1UYWH 3V4PL 2Y4SA 5CP7A 4NN7B 4JNXA 2K7QA 1EDYA 3IE4A 3SSGA 1OHZA 2SODB 4MQ7A 5T1LD 1E50A 2WC7A 3B1UA 3L7EA 4N5ED 3E6FA 3I50H 5HYSA 1LWJA 2EYTA 2Q9OA 3GJEB 1IBDA 1SQ2N 3FHEA 3QDME 5GISH 1J5IA 3GC3A 1AQKH 5B38G 3WE6A 4FQ1H 2D9CA 3I9GH 4NWTH 4Y88A 5EIQA 3WIFB 3CBJB 4FLSA 3ZBMA 4YSCA 2WUCH 3FHQA 1IFHH 4GAYB 5H94B 2E47A 1NH6A 4K7PX 3MJ9H 2ZUQC 4F27A 1FBIH 1MCNA 3CFKB 4M9OA 4FXTA 3CLWA 3RFZB 3MYZA 5IFAH 3CIQA 2CLRA 5JHBA 1JN6A 4ZJ9A 3ARBD 4GQPH 1FZMB 4ZQTA 4WWKA 3U2SB 3D3VA 4GSXA 3BZ5A 3EIFA 1G7MA 2E4FA 2X2HA 5CFAA 4NN5B 2XZCH 1HH9A 3QQ4A 2FGWH 1BXAA 4GEIA 5TH2A 1AGDA 2EEBA 2YKKA 3KLHD 3PP4H 5DK0B 1MH5B 1IILE 2QMKA 3QCVH 1IJNA 4KKBD 1JGEB 4P49A 1AY1L 1F4YL 3MLRL 3GB7A 1AAJA 1IBGL 2XPZA 2HFFB 4G8GE 4O9HH 4P5TC 4FA8A 3EHBC 1I1AC 4YHNA 5C2BH 1YNLL 2BXYA 3HC4H 2CU9A 3LEVL 1UCBL 5IVXB 1F3DJ 4UOZA 5FV2A 2XN9E 5GGRY 5EFIA 3CUPA 3V7AG 4Q9QH 2VW4A 4G6FB 1AKJD 1YY9C 2X05A 4DGIH 2DLIA 1QRKA 3FQNB 4F3FA 4HIEB 4TSAH 4MRBA 2K7PA 3ALPA 2WSDA 3DPBB 2LT9A 4HWZB 4LPUA 4EXPX 2OYMA 4Z3EA 3LEYH 1D5BA 1TZIA 1Z6JT 1GJIA 3RU8H 1YMMA 1JF6A 1XGUB 2VSDA 4JN1L 5B1KA 2GJ6A 3QRBA 2GK2A 5AYUL 2OP4H 1R3IL 4NKOB 3HNTH 3QDJD 5LGHL 4LNRB 3TT1H 3MV11 2FX9L 5HY9A 3SGKC 2UVEA 5JW4M 3CFCH 2EVFA 2J71A 4J3OF 1E43A 1Q9OA 1A22B 3DGGA 2X0WA 4MJ6A 2ZX9A 4NYLB 4KQ4H 4WFHD 3K74B 4YBLC 1JSYA 1CTMA 2NY1B 1WISA 1TQWA 3MRDB 4TVSa 3CDGA 3R1GL 1G0YR 4TRPH 3AXLA 5A3IC 4FYRA 5AW3B 1GC1C 3G5VB 1I9RH 3E8VA 2CLVA 5CIPA 5TDNA 4PJ7E 3MMEB 3UPRB 2WMPB 5DRWB 3TTSA 2GI0A 1PZAA 1THAA 4GY4A 1IKNA 3SE6A 4XB7A 3ISRA 1G0DA 1JK8B 4XNYL 1SYVB 4EXKA 4I0KA 5TQ0L 1YRKA 4FXKA 3VQMA 2YJLA 1KC5L 1U8HA 4JG0H 4KKAC 3QFGA 4O4YL 4U6VL 5AVSB 3RL1A 3VXSA 3VXMB 5HVWA 3BVDB 2X4NB 5EUKA 4H0LC 1NMBL 4AVIA 4IKNA 4X4YA 2CSPA 2ITCB 2YAFA 3FB5B 1AJ7H 1OP5H 2J4WL 4X6CF 4OZFG 1R6VA 3Q5YA 4XVOA 1BYOA 2IVFC 5ESAB 5B39B 1XFPA 4MXVE 4B7IA 1JF1B 3DMMC 3GK8L 4HGWA 2RBLA 4PJ5A 3TO4D 1T3FA 4GG8B 1JZGA 2FJFB 4M1GL 1UWGH 4LDCA 3CFJA 3U1PA 4U1GC 4Z7OE 1MKFA 1KCSH 1DVYA 4FNRA 3A47A 3FCUB 2VDQH 1ES0B 1ETZA 1MZZA 1HTYA 1E9QA 4OQTH 4NO0A 3WY4A 3V6OC 4TS6A 1TPXC 2VC2L 3EOBB 5DUMH 4EIZC 2J88L 4HHWA 5CF3A 4X8JB 3L2MA 4NQCD 3B2MA 3VGHA 3RZCA 1L9OA 2WLYA 2J7LA 3PGDB 2ZZUT 5DLLA 3Q43A 2Y2WA 4JK0D 1DL7H 1R5WA 3LNEA 5FLVA 4Q0XL 1AGEA 3V55A 2X4TB 3LX9A 1P7QA 2J8UF 5AW7B 5CUSH 4H25A 4ZFOA 2I07B 1A9VA 3VXRA 4CC0A 4HG4K 5MHSE 3M1BA 4LMQI 1KEGH 3QH3A 3U4BL 2W9DH 1SXSA 4D3CL 2MRYA 2NY0C 3MN8A 3MRGA 2YBRB 2G2RB 1XEUA 4DKEL 2CH8A 1EJ8A 4P8QA 3E38A 5DFTA 1UH4A 4Q2ZA 4FHBD 3V5HB 1A14H 1EANA 1AGCA 1NC2D 1JUFB 1XF4A 5GS1B 2XIDA 3IGFA 3I6GB 1ADQL 1CXLA 5DC2A 3FXIC 3S35L 4BE6A 4EDXA 3NSCA 4A1RA 3BT0A 3CQFA 1MCQA 5TPWL 2IAMB 5GZNA 5I8EB 4ZMOA 5E51A 4Z6AT 2L04A 1P5UB 4TQEL 1T4KA 2BFGA 2NY2B 5T1KB 4UMSA 3RILA 3U83A 3WGVB 3IAQA 2BLFA 2YD4A 1AZBA 5IHLB 1SBBA 1D5XA 4I3SL 4X8GA 3OZ9H 1E4KC 2VLJB 2WKLA 4JO1L 3DETC 2ARJB 4CL7A 4WF7A 5M7QA 4YBQD 1FO0B 1JHKH 2RQ8A 2P44B 5BS0A 2WW8A 3N6YA 4H0HB 1TKWA 1QMUA 1U3HC 3LNGA 3MRMB 4WHCA 2FVNA 4XXWC 2Q8AL 2PLTA 3GMPA 2IH8A 5AZEL 3QQNA 5C0GA 1J1PL 1W8NA 4BFIA 4FA6A 1A6WL 4LDEB 1KFGA 3UIZA 3QJSB 1K6QH 4NKDA 1AY1H 1F4YH 2P80A 3BGMB 1RK1B 3BKJL 3MLRH 4FQHB 5C0AB 4MXQC 2YRZA 1Y7VA 4ODXB 3L5WB 5HI5C 4XGZB 4X0NA 2QJDA 8PAZA 2WBJC 4P04A 2IPUG 3FAXA 5MEQA 3EKCA 1QFWI 3QQXA 3C8HA 3N1PC 2P8PB 4ETQA 3CX5K 2ZKWA 4HIIA 3QPQC 2WWKT 5LBGA 2HH0L 5EIVA 6PCYA 5DCCA 5IQMA 4S2SA 1CYWA 1YUHB 4LLWA 3HMXL 1EO8L 1YCSA 2IANB 3VFUA 3IJ8A 4PJGE 4EIBA 3RGVC 4KXZI 5FK9A 2R0KH 2V5SA 2JCCF 2X7LB 3FH5A 3LRSB 1TENA 1CLOL 2IGTA 1ANUA 2W92A 3WY1A 4AQZA 2BW4A 3L3GA 1ZLVH 5LGHH 1JDCA 4M3KB 1XGYH 1Z1WA 4XMPH 2BWDA 4YIQB 3IMUA 2CDEA 2JKRM 4P3DB 3MBEC 3VFVB 4IEFA 3MREA 4X7SL 3MRIB 5C08B 4APXA 4WTWA 1A7RH 1RFDH 2QZ5A 1RURH 3HHSA 1UZ6F 4PJXE 1GZPB 5EF1A 4PGCB 5FWRA 4NBYB 2WP3O 1VEOA 2VSMB 1KLGA 1Q9WB 3LD8C 4JQIA 2OL3A 1JXKA 3QUGA 4X5QA 1Q9LA 2P48B 4YR6B 4AL8L 1J8HD 2OQJA 2DYPD 1TTGA 1I75A 2VT0A 3PWJB 1L6PA 4P46C 1F2QA 1MDAA 3WDHA 1XH3A 4QMEA 4GKNB 1KC5H 3VRLE 1BJ8A 4HAFA 4JPKH 1OD9A 5I1CH 2WZPA 5JO5B 3H9ZA 1NGZA 4NUJA 3RDTB 3GSWB 4MMXA 2DI7A 4IRJD 4PCYA 4G7VL 3VDCA 3WOVA 3G6JF 1NMBH 4HWEH 2G3ZA 1PZ3A 4JO4L 4Z7WA 43CAB 5GHWH 2FSDA 1O5PA 2RH0A 1AOZA 3C09C 2CJSA 3SJVA 5JXED 4JE0A 5EU5B 4F93B 3KBFA 4HWBA 1NC4B 4KMLB 4B9ZA 2ZNXA 1TU2B 2OZ4L 3ABLB 2O6DA 4HS6B 2AVGA 5I28A 1P84K 2E0PA 3UC2A 1QHQA 3QUZB 1JCKA 4YX2L 4M1GH 3LS4L 4AJ0A 5EZJA 1RUAH 5EOQL 4Z0XB 3U1QA 3TYFA 3HJ0A 3ZGHA 2XFGB 2YAQA 3WS3B 3FFDB 2FD6L 2J73A 4V2CB 5T3ZL 1CBJA 3B6SB 4HW6A 5F97E 4OAWA 2VQ4A 4OVUA 4D8PA 2V7NA 4IIZA 1CL7L 3T65A 1BOGB 4N3UA 3GM0A 4PRHB 4OJFH 4YXHH 2WM0A 4G9FE 2QV2A 2GUYA 4FQLL 1NUGA 4JN2B 4OCNC 4HH9A 3POHA 1T22B 1INQA 4MDIB 3NIGF 3GEWB 1QNZL 3KDMB 4C59B 2O61A 4XOBA 2DMKA 4LPTA 1GYWA 5G4NA 4WEUD 3PDDA 4KTEL 4LLUB 4P2RE 1T66D 1WFUA 2ESVA 3RVUD 3MRQA 4N4YB 2IH1A 2IQAA 4O00A 2YEZA 3NCFB 3C6LA 5D7SH 1QKZL 2Y1YA 4FNQA 3KL5A 4YNYA 2UZYA 1H6FA 3MSPA 1C08B 4RFNC 3IU4H 1HHJA 5ENWB 3UACA 4L4VA 3CFQA 4FG2A 2PYFA 2FEDC 1N6QL 2PR4L 1AHMA 1XSOA 3PRZA 2N1KA 4QRAA 2E6QA 1M05A 4JFQB 3FYIB 3D25A 5TPWH 3SGDH 1GYAA 4FZ8H 4R3SA 3DTXA 4MDJA 1VADB 4FTVA 1CUOA 3CFDA 4LRNH 2Y07L 4U2ZA 2QHRH 5J1SC 1KPVA 2BVPB 3ILPB 1Y1DA 3O4LD 4I3SH 1NBCA 1YAIA 4I1NB 2OMWB 4K94L 4JO1H 3HUJF 2UY7A 5GJTL 1FVEB 4DOHE 1YEIL 3DXAB 2XA3A 4X6CE 2XV6B 5L8LB 1FVCB 3RWJA 2UUDK 3ARDB 2Q20A 2Q8AH 3QXDB 2Y9RT 5E95B 3V0EA 5JHDB 2BCKB 1CFSB 5HI3C 3LH8A 1QSVA 2BSCA 3EYOB 2BVUA 3F64A 5HHQA 4PSPA 3MJ8A 1A6WH 3V6ZB 3EJCA 1NMAH 3BKJH 1HHHB 2BSED 4HCGA 3NCXA 4CJ0A 1I7ZA 3H2PA 2CK2A 2EKJA 2NX5B 2P8MA 4MD0A 4ODTH 3EGXB 5D93C 4PG9A 1IZKA 4B5EA 1OV8A 2Z4QB 4UTBL 3LCYA 2XTJD 3SIKA 4RWYL 3N55A 2GBUA 2WWMC 3KGUA 3STLA 3HRZB 2XKNA 4LEOB 1YEGL 2HH0H 2OULB 3L1EA 4JFDB 3BW9A 3HMXH 1DJYA 3LQAC 1I7UB 5I9QC 1GAFL 2DM2A 1CLOH 3H4FA 4H40A 4FYSA 3Q13A 1O7VA 4BKSC 2EXWD 2NZ1A 5DJ6B 2R29A 1N0XL 1W8OA 5EPMB 2JIXB 1YMMD 5DVPA 4FQIL 3DC0A 4XP4L 1EEUA 4HSCX 4HULB 1H9DA 5LB1A 5BO1H 2XWXA 3BEVB 3X11B 2F0CA 4ZFFA 2GJ6D 4DP2X 2YD6A 2EINB 5EF2A 1TXKA 4XO4A 1Z32X 3HBPA 3VXUD 3CVHH 3NP3A 2X28A 2HZHA 3A4AA 4H8PA 4XAKD 4JRXB 3ROLA 4ELKA 3OQ3B 3ZT5A 3W0WE 3CPLA 2WIIB 4HD5A 1F18A 2ATKA 3KVPA 1PZUB 4JHBA 4XXCC 4AL8H 32C2B 2BOBB 2EEFA 3AREA 2VXQL 4FI8A 3EDFA 2G30A 3H6JA 4P5SA 1G4RA 4M5YL 1K2DA 1S7VB 2QSTA 3B7YA 4A2DA 4GRLC 3OMIB 3HNVH 2DWEB 5AAMA 4BSWA 1PJWA 3KWWB 1PZCA 5IHWA 5EG6C 4Y5VC 1SPDA 3WUZA 5ESQA 5F3BA 4WW2A 5D1XA 3T2NL 3C5ZC 1NGYB 5KOMC 2J5WA 2EUWA 2H2SD 4XMLH 5EMYA 2FH6A 3QYCA 3IMBA 1FE8H 2V3FA 1T03H 5J1AB 1A6UL 3L95A 4PR5B 4PJCF 2X1WL 1CR9L 3C6EA 4FERA 3MV7E 5ITBL 1UFUA 5I1IH 4MSWA 1CCZA 4NENA 4P4RB 4PRDA 3TBBA 2YPLA 1AXTL 1NBVL 4R9HA 3IKKA 5AUMA 1KCBA 3D39E 1WUZA 2NTFA 4P23C 4YX2H 1GR7A 3W81A 3QJXA 5D70H 3CE1A 5MERA 4LLYB 3BMVA 5CP3A 3KGSA 2AV1B 3CX2A 1MFCL 1QACA 2XRAL 3OB8A 3VSUA 5J12B 2MNJB 1KV7A 2FD6H 3QZNA 4Q6YA 4EMZA 1E4XL 3FTZA 2FHCA 3FU7A 4MNGB 1ASPA 2K4WA 4WWPA 2J6EL 4ABVA 3M1OA 4E9XA 4P9HH 1IM9B 1JAEA 4W81A 1XIWC 4JDZA 2QR0B 5KYWB 4FQLH 5C0IA 1CD0A 3BPCB 3JXAA 3MROB 4MA8H 4ELDA 2EIKB 5JOEA 5L4MA 2YFOA 3AG2B 4PY7B 4M4RA 3MNDA 1CFTA 1RULH 2WN2A 3VFSA 2YKLH 4DGUA 4GOSA 5ANMB 5J8OA 5KSAA 1G7LA 2A6KB 3KNBB 3QDGE 3DX4A 1P4UA 4G82A 5JPNC 4BQ6A 1KIPB 1ACYH 3BAXA 4FQPA 5GGSY 2BWIA 1JGDB 3GJEA 2EC8A 1GYVA 2FCBA 4N28A 4QRRE 1RLBA 1A9EB 4XCEB 4OCXL 4M6ML 2EXSA 3MGOB 2YAEA 4IK7A 2DI8A 5CJXC 3VXTB 3WIFA 4OI8A 5BCAA 4MXWH 1N6QH 2PR4H 1BEYH 4GAYA 3VTAA 5H94A 1E7VA 2BZDA 2HUEA 3IJ9A 1LEIB 3JTBA 3QFJE 2JJTA 3CFKA 1UA6L 4UMGA 4YDZA 3RFZA 1V3JA 2MKWA 4HGKC 5CSGA 4ZXBB 1IC0A 5BRZE 3D8MA 2GC7C 1FZMA 4NQDD 5HHPA 1SDYA 1OALA 1GGIH 3U2SA 1KYUA 2Y07H 3MLWH 1NUDA 1MI5B 3HC2A 4JDTL 1YO4A 5IP4A 3FYEB 2X42A 4G6JL 3Q9QA 5AW4B 3G6JE 5ISZB 2GEEA 2QPEB 4B9FA 5F7WC 4K23L 4N2GA 1OCCB 3SODB 3P4NB 3VD3A 4JBSA 5CS7A 2EVJA 3CZGA 3X1GA 1GVIA 3B2VH 3QCUL 3QUXD 1MH5A 5DK0A 4E36A 4HJEA 1J9SA 1JGEA 3KGTA 4GXUM 3F05A 3FT2B 4TOYL 5BS0D 4AITA 2HFFA 3JV4B 4JHAH 4PRIB 4WO4B 1BFOB 2ZUTA 2PO6D 3REWB 4DIXA 4JFYB 3N42F 4UINL 4HWNA 5ICXB 5IVXA 1V5JA 1CD8A 2YD7A 2AQSA 4BELD 4M48H 2ITDB 1RUQH 1AZUA 4ATWA 1WAAF 2MH4A 1MWAH 4NZDA 4Q56A 3W11D 2QPUA 4RAHA 5J6HB 4XNUL 4UV4L 5JYMA 1WCBB 3FQNA 4HIEA 4XN5A 1T83C 1YEGH 1JWUB 3DPBA 3V6FB 2AXFB 3QDMB 3QWRD 4HWZA 5FGCB 1KACB 3B34A 3O8XC 4EI5D 3ZDYB 4UTAA 5I1KL 5AOIA 1CJYA 2YLKA 3FRPB 4NKOA 4KH2A 5DA0B 4LNRA 1NIFA 4I48B 3U30B 3LPPA 4X4KA 2JF1A 2KPNA 1GIGL 1SUJA 2XZAL 1H19A 3GDBA 3VGDA 4PB9L 4JPWH 5EOTB 4NYLA 1IGJB 4IMLB 1AO7D 4XP4H 1RQ5A 4FOMA 1UWYA 2XWRA 1YEFL 5HDRA 5KYUB 1MHEB 1QRNB 3BN9D 3PAYA 4GRMB 3MRDA 4HHAB 3ZSTA 4JFFD 4XPFL 1T2QH 4XPAL 3VA2C 2WINB 4AI7A 4UWQB 4FEIA 5JIPA 5JOPE 3G5VA 2BNRE 4ZTPL 4W9EC 5JPMC 4OD1L 1AG6A 3IDMB 3AACA 1C7SA 3NZHL 3MMEA 3SGJC 3U4EB 2WMPA 5DRWA 4DP6X 2EYRB 3UPRA 4GKSB 4MAYB 3MA9H 2Y7SA 5IBLD 3MCKB 1JK8A 1SYVA 4G8GB 3SHSA 2E7DA 2ODIA 1W15A 2VXQH 2WXHA 3AUVA 5K39B 4M5YH 3X3GH 4X4ZA 3IN0A 3H7LA 5IROD 3ZOAA 2H3KA 5SWSE 3VXMA 1Z0MA 2H6PB 5C0JB 2X4NA 1NPUA 3WBDA 2NQCA 4AIZB 3VFRB 1HE7A 2ITCA 4JRYD 4ZFOL 3FB5A 3SE9L 3ARFC 1AYRA 1HI6B 2F1BA 4JFVA 2LOEA 3ZUCA 2F7RA 4DH2A 4M7JL 4OUUB 3TVMB 5JOFB 5ESAA 2HMID 2WZPD 3TCXA 2YRLA 5B39A 5J3HD 4HV8B 2IMNA 1JF1A 4N90D 4EUPG 1OTSD 4MJ2A 1KEML 3L81A 5ITBH 2PKDA 4GG8A 4ZPTA 4WHYH 5GRWA 2FJFA 4UIMB 1ZVNA 1JYNA 2Q10A 3LZLA 4KK5C 4WHDA 2XQBH 1ES0A 4KI5D 2E9WA 2YUZA 4XVJH 5EEWA 1A3RH 4AMXA 3TBSA 3EOBA 3CVIL 5DD5L 2XRAH 2YXWA 4GQZA 4QWWD 1JYVA 4X8JA 1I1FB 3NJHA 3PGDA 4NSKB 5AB1A 2E27L 2QT6A 4HX1B 2J6EH 3ECUA 2X4TA 3DK0A 3JV6B 1RZKH 5TD4A 4Y4FC 3AT8A 2R27A 2F58H 2I07A 4PJ7B 2KBGA 4F58L 3X13B 3D85B 4FXLA 3W2DH 3OXSB 2EH8L 2EDJA 4NOFA 3Q2WA 2LU4A 1AS6A 4QY8B 4GKOA 2YBRA 2G2RA 1BVKB 3US1A 4AKPA 4O58L 1RPUA 4Z3TA 4LP4A 5TQ2H 3MRCB 1BFSA 3RWFB 3V5HA 2CHZA 4AH2B 4JFPB 5AALA 1JUFA 5GS1A 2D8KA 5D8JL 4RMTA 2ESVD 4UAHA 4ZTOH 3I6GA 2H0FA 1CD1B 5I1JL 1ESOA 5I6MA 4XBPB 1WGVA 2IAMA 4J4PA 3A0OA 5I8EA 3V9EA 1F4AA 2W07B 2DJ4A 5J5EA 1I1RA 1ZLUH 4DQOH 5T1KA 2EDBA 1S5IL 4Z7OB 3SQOL 2QQKL 5DHVB 2J57A 2R15A 3ESPA 4W9KC 5T3XE 5GGQL 4NUMA 2BRRH 1QW9A 2VLJA 1Z2KA 2IBZY 2ARJA 3K91A 1QYGL 3K4ZA 5L8KB 2P9RA 1FO0A 2ZJSL 3EFOB 5EZPA 1AQ8A 2C4FT 1X3DA 3V0WL 1EEYB 3P73B 2QADC 3MRMA 4TSBL 4M7KH 1BQSA 2R4SL 5AB0A 1LXMA 1KB9J 4WI2A 2BP5M 1FSKC 1G6VK 1B2YA 3K6IA 5CEXB 3BGMA 4FQHA 1RK1A 5CU9A 5D7IE 1KPRB 5C0AA 4BJLA 3GD1C 2NXYD 3D2TA 2E3VA 2JB6B 4ODXA 3L5WA 4OKDA 4U4IA 4XGZA 2XY1A 3I3EA 4FULA 3BJ91 4NERA 4UINH 2KUTA 3SOBL 1UOLA 3THMH 3OHMB 1UKQA 3AM8C 5E2WL 1N5YH 3GKZA 1P9MC 2P8PA 4PGZA 4MYWB 1ZSHA 3H55A 4N3TA 3V8OA 2OL3L 3KPQB 2X4PB 1ODAA 3H2QA 1AVAA 3N1QC 1YPZE 1L7TL 3UAJA 1YUHA 3HS9A 1DVFB 4WIQA 5GZOC 2IANA 2YA2A 5B7MA 5T1JA 4AJVA 3ASOB 4RAUB 2X7LA 3LRSA 1UD6A 2YAHA 1G9HA 3SE3C 4EZJA 4LSTH 5CCHE 5CGMA 4BBWA 3RY5A 4CKQA 1WD8A 3WKPA 4YIQA 4N5EC 1OM9A 5CEZE 4P3DA 1ZVSB 3VFVA 4HOMA 2CLZB 2GB2A 1NGQH 1S7RB 5C08A 4HK0B 1DQQB 3B7RL 3RY6C 2H45A 4DPRA 3GKWH 1IUZA 1PEWA 2ZX6A 4D0CB 1GZPA 1E5YA 4XPAH 2I25N 1RY7B 4HWBL 1D5MB 2WO3B 3LKSB 4PGCA 3CN0A 2WKGA 3OWRA 4ZTPH 4A2GA 1Q9WA 3QORB 3G9AB 3PE9A 1QBBA 4YR6A 5C3TA 3CDFA 2ZOOA 5EEUA 2OLDA 3P9MB 3PWJA 2FBRA 5D72L 4PIRF 4ZMYA 4GKNA 3RI5K 3GMMB 4XZUB 5A16B 5FYLE 1J12A 3II2A 2NY4D 4U1NB 5HGHB 4HIQA 5JO5A 3PJNA 3N3EA 3GSWA 3RDTA 2H3NB 4KRMB 3ARED 4B9IA 1UJTA 2C5DC 1ZS8B 1EUTA 4GRWH 3BUIA 4YUEH 43CAA 4EJ1C 4M8UA 5BOJA 4U0RB 4HIXL 2VLMD 5IW3A 4PJGB 5GRYA 5FAAA 5EU5A 2AQ2A 1I8UA 4GO6B 1NC4A 1J8SA 1IFRA 1TU2A 3UJTH 2D03L 3KW7A 4HS6A 4U6TA 1XQ4A 5F7EH 3I6LE 2H1LM 3QUZA 4M8QB 1Y0LB 1SJVA 4Z0XA 2Q76B 3IDNA 4GUQA 4N24A 4JPIB 2CO6B 2DMHA 2XICA 1WAAE 3WS3A 1A7NL 3FFDA 4JFSA 5EWIH 2NOYA 4D0BB 3B6SA 5A7EA 1OGAD 2DEXX 3GSOB 4AMKL 1GY1A 1AHKA 3HN8A 3EG9B 4WUUE 5T1MB 1NBQA 3VFNB 4PJXB 1BOGA 2E27H 4PRHA 3MOAH 1JZ8A 1WVZA 3LSOB 2R2CA 2QSQA 4JN2A 3WIHH 1ZT1B 1T22A 3ZHFA 4MDIA 2EZ0C 2WV3A 3KDMA 4ZO8A 2F74A 1OL0A 2HT3C 2B4CL 4TUUA 5DVLA 4LLUA 1TG8A 2GK0B 2YPVL 3P9LB 1ET5A 3MXVH 3W1ZA 3L4ZA 3ESMA 5AFAA 5F1KC 3CC1A 3HW7A 3EZJB 1ZIBA 3K6SB 5HD8D 1C08A 4KQ0A 2BERA 3IYLW 3VSVA 3RL2A 5ENWA 1JHLL 4OCWH 2AXGB 3OM3B 2UX7A 1S6NA 3MFFB 5D8JH 4X7FC 2Z7UA 2XXMB 1TYJA 4L4TE 3ZDZB 3BAJA 3B5GA 5E4EB 2LHAA 4JFQA 5HGBB 1O6SB 1TCRB 1FV1B 4EN3D 2ZNWA 3WFHB 1PYWB 5D7KE 1SN0A 5AOKA 1A7BA 4K3JL 1VADA 1RHHB 3II1A 5ALCH 4PP2B 2WLKA 2A9AA 4BK4A 2COQA 5B3NA 3SQOH 4HKBB 4TV3A 5GGQH 2BVPA 3ILPA 4P2QB 2E59A 1B4LA 3VG9B 1OM3L 1MG2C 2OMWA 4R4FL 3VU2A 3QI9D 1E8WA 1FVEA 2WJ7A 3DXAA 2B0SL 4Y4KB 2ZUVA 1UWXK 3VVVA 1FVCA 3ARDA 3FSZA 1D9KD 3QXDA 4NC0B 5JHDA 4X5LA 2LTQB 2BCKA 1CFSA 3KLDA 4MNHB 5F0LB 3TO4C 4G9FB 4JO2H 2R29L 4DKFL 3EYOA 2ZUSA 3EADA 5HDOA 3F7YB 3T08A 4X9BA 3V6ZA 3TJPA 1ZAGA 2AZUA 2FB4H 1HHHA 3CDCA 4L2YA 3B7TA 4QUOA 1ACCA 1CB4A 2FRGP 2LFGA 4KQ3L 2Z1KA 1ZDQA 5AYQA 5LWYL 2NX5A 4P2RB 5DD3L 3EGXA 4NP9A 1M6OB 4OJYA 2F08A 2Z4QA 5E2WH 2KS0A 4OW6A 2BCMA 3GYRA 4JM2B 3NAAL 4AL8C 4HD9A 4K15A 4UM9D 4DVRH 2D7TH 3HRZA 4LEOA 1ZXKA 1HCZA 4JFHD 3MYJB 2AQNA 3WE1A 1DLFL 4BCZA 4WV1B 3WFCH 4JFDA 3C08H 2JB5L 2UX6A 5B1AB 4AM0Q 1VZIA 3RIKA 1I7UA 5HHVL 4TVPD 1FCGA 1PL3A 1I8IB 5DJ6A 3G5ZB 1MRDL 5EPMA 1TVHB 2JIXA 4RMRA 4UILL 3A6CL 4OZHB 2KT6A 3BEVA 3X11A 1HZLA 4MLSA 4C8XA 3ARGC 1FUNA 4DOHB 2X4UB 1E5AA 5I75B 1WIPA 4XB3A 1G84A 3OPZL 1Z9MA 4JRXA 2NY3B 5D5MF 4H44C 1BBJB 4LSUH 4QYOB 4Y5XB 5E03A 2XYCA 2WIIA 1OQXA 4MAUL 4F37K 1NIAA 1QVOB 32C2A 5ICZB 2BOBA 4BH8B 5CZVL 3ZE1F 3GIZL 4D9RD 1S7VA 2KHAA 2Z31B 4LHJB 1TLKA 2DWEA 4X83A 3BQUC 3KWWA 3GSNB 1VFBB 1BX2B 3KPSD 2N7AA 3JUZA 4HA1A 1IM3D 1P5VB 4V1DD 4WFGD 5C2UB 4WHYG 4Q8BA 1NDGB 1OP9A 5F9OL 2K3TA 4RSVA 4GKZB 3RVXD 5DEGB 1NGYA 3K8KA 2VZ1A 3ZMEA 1HHKB 2QBWA 4R0LC 1H5BB 3AFLA 3AWEA 2F54E 3K0YA 4XP6L 1HNYA 1RJZB 1XDTT 5CJBA 4PR5A 5J1AA 4R4ND 3WKML 4CMHC 1UTDA 3IMSA 4NZTL 6PAZA 1QP1A 1TQSA 2AJ3B 4QJ3B 5E0QA 4P4RA 5C9KA 4A2MA 1LO2L 1FWXA 3VFMB 3FHAA 3VE0B 3BP4B 1TZ8A 3VGAB 3ULUL 3T0EC 4Z23A 4LLYA 3Q8FA 2DICA 2AV1A 5IMMB 5SWZD 3FZUC 5I0VA 1A7NH 1U8QB 1XVSA 5D55A 5FFOA 4H0GA 3KDPB 3FFCE 3LS5L 4PCSA 3TP4A 1ZIAA 4K9EL 5HHXL 1MFDH 3LEXB 4MNGA 2XWCA 1IM9A 3QAZB 3C60C 5KYWA 2QR0A 2CALA 2D2OA 5KJRL 2GJRA 2IAAC 2JNZA 3W0WB 4HBCH 3MROA 1YYML 4K94C 1ACZA 4AIXA 1W72H 4PY7A 3Q01A 3VWKD 3MRNB 5ANMA 3SDXF 2A6KA 4N20A 3TLRA 2MPVA 3KNBA 3MACL 4TLUA 4AC4A 2CDFB 2XLLA 4ICXA 2YPVH 5I1AB 4HVBA 1KIPA 1ZTMA 2N1TE 5CXPA 2B15A 1MCPH 2AZAA 1LVEA 1YYLH 4HJUA 1F8TL 4JQXC 4IGBD 1JGDA 2YD3A 4HLJA 4ZBJA 4EIGB 5C6TL 4IOFD 1JHLH 4YDKL 4XCEA 4BKTC 1A9EA 3MGOA 3VXTA 1BD2D 4DPAX 2WBXA 2HAZA 3RHWF 4YO0B 1TQBC 5K9OB 3MV7B 1EO5A 1LEIA 3PQYD 4KNQA 5B7FA 2ADFH 2YOCA 3KLKA 4ZX5A 4ZXBA 3B1TA 1JK9B 3ABGA 1EIBA 3FU5A 4ZTEA 3D39B 2CR6A 4KZDL 1F3JB 1FIGL 2IAMD 1UZ8B 3L45A 2FUQA 4J4PD 1MI5A 5ISZA 2NY2D 4UTAL 3DX8B 1U8CB 3P4NA 5JXEC 4HOZA 2L7EA 1T6VN 2E7HA 2YN5A 5LCVA 1IC1A 1RZFL 1M42A 3TFBA 3MCLL 1AQMA 4JFOB 1VCAA 2VR4A 1NAMB 2DIEA 2Z4TA 3FT2A 3JV4A 3SEPA 4PRIA 5F7AA 4WO4A 1BFOA 3REWA 2G60L 1XD0A 2HJKB 2Q2EB 4JFYA 2FX8H 4Q6IC 4KZEL 5CJ8A 5ICXA 1PZ5B 1FL6B 3QG7L 4KQ3H 3RG1C 1BG1A 1OK8A 1ONQB 3PHSA 1IBZA 2FGZA 5DD3H 1QTSA 2ITDA 3QDGB 3H85A 2R7EB 5EV7A 5FKAB 1JBJA 4FL4C 2AQ1A 4R83A 4PTUB 5J6HA 1N59B 3PV6B 1WCBA 4L0YA 4KHTL 1JWUA 1MCDA 4R7VA 1YA5A 3V6FA 1KYAA 2AXFA 3QDMA 5H37A 3BKCH 4JKPH 4IYKA 1QAWA 5D9SA 2V8LA 4P2OB 1KENL 3NJLA 1MHHB 1FNGB 4W9HC 1H3WM 1DQDH 2X2JA 1BQLH 4HKJB 4I48A 4YSUA 5I1EH 2RALA 1JZJA 3FQWB 3Q5OA 3UAJD 5BRZB 1X5HA 3K72B 3QUKB 2VMEA 1MRDH 3APDA 1ADWA 2Z8VC 3W5NA 2GVYA 5AVTB 1TTUA 2OV0A 5EOTA 1IGJA 4IMLA 4UILH 4ZUVB 1LEKB 5AL0A 5IQNA 3BPOC 5KYUA 1MHEA 4CADB 1QRNA 4GRMA 3X1EA 3EXLA 3RIAF 4HHAA 5CINH 3KM1A 3BH9B 3FULA 4E9QA 1EXHA 2WINA 5E6RB 1WTGT 3OPZH 4GFXA 3EYVB 3IDMA 5L2KD 1UA3A 1JJUA 5CJQH 3DRQB 3U4EA 1DQVA 2EYRA 1QSED 4GKSA 4MAYA 3SDDB 2KLTA 3MCKA 4G8GA 3DJTA 2VLRD 5M95B 4HPOL 1WS7A 2Z6FA 2OR9L 3GIZH 5K39A 1M53A 1JPGB 4HUKB 5LBSL 2H6PA 5C0JA 3IXAB 4IKLA 4XPTH 4WWKC 4AIZA 4Y16B 1XF5B 1PD1A 3VYOA 2DAVA 3UBXB 5F9OH 3T0DA 3PUCA 4XO8A 3DDGA 1HI6A 3R0MA 4U33A 3MV01 2M83A 4OUUA 1CICD 3TVMA 5JOFA 1YUKB 1BVNP 2COVD 4HV8A 5C0RH 4EO5A 1VFAB 1F6FB 4WFFE 1WH0A 1E6OL 3EDJA 5G55A 4UIMA 3EOAB 1N18A 4Z7VE 1LO2H 1MCEA 3EGDB 3FQ1A 2VKWA 3EJSA 3F83A 5F96L 3MOBL 1NKGA 3MCG1 5A7BA 3LN5B 1NC4D 4YMPA 2XVKA 3VU1A 1HE8A 2YARA 5DZNA 1I1FA 4NSKA 1J5CA 2ZD0A 5L8JB 4K9EH 1LM8V 4J8RB 5F71A 4HX1A 3UTOA 1WIUA 1HOCB 2E75C 2X2UA 2WYHA 2BNRB 3JV6A 3HE7B 4LPYA 3GSQB 4OCRL 1UOVA 1FVDB 1IGYB 5FKPB 4PJ7A 4XMZA 5INDB 3I6SA 1Q72H 4N1CA 2WYTA 4HHGA 3ML9A 3X13A 3OXSA 3QZMA 4S1RL 1I8AA 1OGTB 4XPTL 3FTWA 3QEHB 4QY8A 1FO0L 5BZDB 4Z1PA 5LLIC 1M6UA 2NYYD 3HZMA 1NM4A 1QI4A 1H3GA 2FECL 3MACH 3UC0L 1BVKA 4GIOA 4Z0BL 3T8MA 3FF8A 1IIKA 5SWSB 3G9VA 1I85A 2X6AA 3MRCA 2IALB 1OAXL 4RNRB 3RWFA 4AH2A 5B38B 1S9YB 2OMUB 2FX7H 3EYQC 3GXFA 5DXWA 1CD1A 2DLHA 2G5BB 3DK2A 5D5ME 5E8NB 1IQWH 1E4WH 5I6OA 4XBPA 4LSQL 2UUDH 1RIVH 1TEYA 5J06A 2W07A 1IL1A 3P4LA 3FTUA 5C09D 5E6ID 5I1HL 1DEDA 3JWNC 3OKLB 5DEFB 1J7VR 2X40A 1DDTA 1IKNC 1O75A 5EORL 3RE0A 1NCWL 3SE4A 5IJCC 5DHVA 4J7RA 1WUNT 4TVPH 1FIGH 4FXKC 3A23A 3FO2B 3LB6D 3GZOA 3QCTH 4F8OA 1A1MB 5EBLB 3EFOA 4PWHA 4DN4L 1X7TA 1ZS2A 1EEYA 3P73A 3SYOA 5DSCB 1ZKAA 5LXVA 3MA7B 3FUDA 5BV7H 2CGYA 5IVZB 3H4HA 2RGSA 1K72A 3M17B 4K5PA 1Q9KB 3GS4A 1Z9SB 5CEXA 4QTIL 4BUHA 4GG6B 4IDLA 5DRXB 1KPRA 3P77B 3P11H 2JB6A 4M62H 3KYKL 5JHDD 4YEEA 5DMKB 3QG7H 3QA3B 4OLYL 3MQIA 1KPUB 4WTZA 2CK0H 1HIML 5KEZA 2LU7A 4Y1SA 5JW3H 3ESVF 1KULA 2WCGA 3KPQA 1OP3K 2DBJA 2X4PA 3CHOA 3EZ8A 1JPST 3QVAA 2ZF8A 4PCTA 1NBZB 4J1UB 1S7WB 4MWFB 1CI5A 4GH7B 4KHTH 3TBCA 3NBNA 2EEDA 1DVFA 2E76C 4PP1D 3RZCC 3ZX1A 1XTLA 3O2VL 3TEYA 1H3UA 2VW6A 4A7UA 4RAUA 2PPDA 1DFXA 3AT0A 3UABA 1G7IB 3GNML 3QUYB 4FABL 3INUL 3P69A 4X6BB 1Q0YL 3X17A 4HP5A 4U1KB 2H1PL 4IOIB 3SDXE 1BM3H 4G72B 2NW2B 4YPGB 4LIQL 1KBGL 2X70B 1CFNB 1GRWA 3BUTA 1BOYA 2WWKO 3CU7A 1PCSA 1ZVSA 3GI9L 1WFJA 5D6CB 2CLZA 4MCYB 2BSRB 1S7RA 3L4TA 4HK0A 2VO5A 1DQQA 1KJ3L 1CGXA 3BIKB 2B1AL 4XZ4A 3S88L 4TNFA 2QVTA 4CMMB 5IGXL 1D5MA 3LKSA 4PEEA 3T0WA 2FTAA 3MLUL 4JFED 2MQ0A 3QORA 1T0NB 4XP5H 4B3EA 3NIDF 2P5WD 1KT2B 3BCDA 4JEGB 1H8NA 3CFNA 2OK0L 1RIUH 1S9WB 1HSAB 3JT0A 4LVOB 5GRUH 5D7IB 4RQQB 5EU6D 3P9MA 5GZNC 3FMGL 3QR2A 4WJG3 1YHPA 4PRBB 2EDQA 3J8F7 3O6LL 1XB3A 3GMMA 4XZUA 4LSPL 5A16A 5HGHA 1G6RB 4JR9H 1GGUA 3B2XA 5LBSH 3NEXA 4LBEB 4MA3B 4OZFB 3LD8B 2H3NA 3D2UD 3QDJE 1IAMA 5HVFB 3WHE0 3O11B 1ZS8A 2EDLA 1WZMA 3JVGA 5ANHA 2DH3A 4WFHE 1YPZB 1EAPB 3CLEH 2PO6C 4PJGA 5C7XL 1R5IB 4HOXA 1JVOA 2AS5M 5E5MB 2EDMA 3AQDA 4IOSD 5DJDB 1MCWM 1KCUH 3HKZA 4EI0A 2ROXA 1L0QA 2MPAH 4M8QA 3TJHC 4Z7IA 1IC5L 1Y0LA 3BN3B 4MVBC 3RQ3A 3W11C 3WEXB 2Q76A 1XBDA 1EZLA 4JPIA 4OLVH 2CO6A 4R6UA 4A6YH 4F24A 2AEPL 1J5OL 1XHHA 2TRHA 4D0BA 3B7SA 4P59L 4OFQA 4QYAA 3MUUA 3GSOA 4U3HA 4LASH 2ZXBA 2DWTA 4KI1A 3WAKA 2WNWA 3EG9A 3GBNH 3QNFA 4X8CA 5T1MA 5E94B 4FCHA 4EI5C 4WJ5B 2RQEA 4HALA 2PABA 4N22A 4PJXA 3VFNA 4B27A 3X3FH 5JW4R 2ZWKA 4KNSA 3LSOA 4B9JA 1ZT1A 4ACTA 3A24A 2YC1B 5GJSL 3RLSA 4OF5A 2R0WH 2ZPKH 2YAOA 2D3JA 2O72A 3FUFA 2BHZA 1MFBL 3Q8BA 2G75B 1IM9D 4OH2A 4B53A 2GK0A 5ECGA 3BN9C 3QEQB 3P9LA 1PS3A 2F19L 4Z95H 4Z9KB 1P69B 1MHPH 3SE8L 4H8VA 1URZA 1JPFB 3K6SA 2V6HA 3N9GH 1KELL 3UZQB 5IHZA 5I0WA 2AXGA 2F8XC 2BS8A 3BIBX 2RCSH 4UT9A 1G4MA 2EDXA 2HVJB 1AXSB 1GH7A 4FFVC 4OU3A 1L9PA 1G7PB 4J3TA 5DUPL 4FP8L 1GXEA 4PAZA 3BSZA 4HISA 5AB2A 2GHZA 1O6SA 1TCRA 1FV1A 4NQCE 5HGBA 3ASNB 3WFHA 4QI3A 1PYWA 3UH8A 2JKXA 4PCKA 1JNHB 2A77H 1RHHA 1MFAH 4J5VA 2E4TA 1NL0L 4PP2A 4IKKA 3SGEI 1U95B 3BKMH 4AIOA 5EORH 5DZOA 4HKBA 4XCNB 5IK3B 1QR1B 5EA0L 4IJTA 4P2QA 2IMMA 4XN4A 2VJXA 1RZ8B 1LO0H 3IWVA 1I7RB 1J0KA 4ZXBD 1CGSL 3MXWL 4Y4KA 5DJCB 5D1ZD 4RRPM 2WOBA 4WUUB 3FT0A 5J3HC 5JHLH 3WNOA 3F6JA 4MMXC 1B0RB 3C5JB 1PSKL 4ZMZA 4P2AA 4MNHA 3RTQD 2N01B 2R0ZL 4G9FA 3MUHL 2CUAA 5F7DB 2R59A 3F7YA 1J10A 1IC7H 4KOCA 4S1QL 4ABQA 4FMFA 4Q9CA 2X41A 5DQJB 5GS3A 4D9QD 5AVRB 3TPUB 2KDYA 1M9WA 2Y7MA 4PBVC 4P2RA 1L6ZA 4KKLC 4GAJL 1M6OA 1U2YA 1D6VH 5EU4B 2I5YL 1RJLB 3L4XA 4C4BA 1ORSB 3KXFB 4JM2A 1R0AL 2A9CA 1A3ZA 1JZFA 4ATTA 2R39A 3MYJA 3PDOB 3O81A 5I73B 4KHXH 4LVNB 3QUMB 4N2AA 4WV1A 2KLSA 3QIWB 4L4TB 4LNVA 3TYGH 2NY7L 2K6WA 4K71B 2HKHL 3OBAA 3BCFA 1FZJB 4PVBA 4D9LL 1E40A 2CRZA 4NDMB 1VPOL 3MC0A 1I8IA 1Q0YH 2BIIA 3UIYA 3G5ZA 3S37X 1TVHA 3ETSA 3UO1H 4KXDA 4OZHA 3O0RL 3VA6A 5ITFB 2C1PB 4XOAA 2X4UA 3UYRH 4DJMA 2FWSA 2B1AH 3LPFA 4XWOD 4NNPL 4X6CA 3ZYIA 2IIJA 3OKYA 4K3EH 3O6MH 3APCA 5IB2B 1BBJA 4QYOA 4Y5XA 5FGRA 4HU2A 5C7ZA 1QFPA 3T09A 1QRND 4WNQB 2BWQA 4OJCA 3P9WB 1QVOA 4GSQA 2YJQA 3MDJA 2D2CC 1IGFH 5ICZA 1QBLH 4BH8A 3FUKA 3M45A 3VSTA 2Z31A 3C6SB 1ZD6A 4N9OB 2M8XA 1ZV5A 4JY4B 3GSNA 1VFBA 1BX2A 4MAYD 4KV5E 4MB1A 5LXGL 1P5VA 4DEPB 2EE3A 1NDGA 2ETWA 2QFPA 1EHLL 3CDYA 2YRPA 3HFFA 5CN1A 1JXJA 4QHUB 1OLZA 4GKZA 5DEGA 1V27A 1Z5LB 2B4CC 1HHKA 2HT4C 4GRWF 1H5BA 1QEXA 2XZZA 2H7WA 2HYMA 4HXAL 1RJZA 5LO7A 2A2QT 2NXYC 4XPHL 1GOHA 4XX1G 1CE1H 3IM1A 3G6DL 2AJ3A 2V5YA 2WCSA 5E0FA 2HKAA 2X4QB 3QGVA 5I1DB 5J11C 3VFMA 1IKFH 3MBXH 1Z0NA 3TVMD 3VE0A 1J5DA 3P30L 4NCDA 3BP4A 4P0DA 4OFYA 5AKVA 3GMLB 4AXWB 1NEZG 1J8HE 3WI9A 5IMMA 4KGLA 1J5OH 1N6VA 3FTXA 1FGNH 3PWUB 3OZKA 3MRJB 3HE6B 1I1CA 4H1LH 1GYUA 5C0ND 5DJXB 3BXNB 3LEXA 5JZ7C 4ZDHB 1C5CH 1WZ1H 4R97C 1EXUB 3IN2A 1SOSA 4PJDE 3W0WA 1A3QA 1CFQB 3I2CH 4G5AA 2CJUH 2HG5B 2VLKD 5D7JB 5F7NC 1KYDA 4U3CA 1VGEH 4XE5B 2ZG1A 3MRNA 1KOAA 1MFBH 3ARYA 3O9WB 3QE5A 2CDFA 3U7AA 4HUNB 3WEOA 5I1AA 4QRUB 5LCVL 1JZ6A 3D85D 1MSPA 3SD2A 4EZKA 1XSJA 4HMEA 1OSPL 2AJYH 2BNQB 2X0UA 3Q48A 1X5ZA 1A8JH 1CWVA 5F7FA 1B2WL 4FQXD 4AE0A 4BHUI 2YA0A 3IFNL 5JYLA 2AQPA 1MREL 3SCMB 4DQAA 3V5KA 1NFDE 2C3WA 5IJBC 2F54B 2A1WL 1ECYA 3DJSA 3R18A 3RY4A 4N85A 4RGND 4UUJB 2W91A 4YO0A 5K9OA 3MV7A 2VWEC 2Q8BL 3TH2T 1TTBA 3L8QA 43C9B 2P45B 1JK9A 2IQ9H 1CL7I 2O5ZL 1NL0H 4XCFL 3RVVC 3D39A 1WP6A 3AREC 1DBBL 1F3JA 3KAAA 3N40P 3TN0B 2QL1A 2ZQKA 5IEHB 1UZ8A 5I15L 1VENA 3GJFH 3BAEL 5AAMC 3DA0A 2B3RA 3SPHA 2NY5L 3NUKA 3FFCB 1U0QA 3DX8A 1U8CA 5EEZA 5LVEA 5FW6A 5LN8A 3U0TB 4P2YA 1G1KA 3NGBC 4WW2C 5D1XC 3OAWA 3IAPA 4AEEA 3CFBB 4JFOA 5CILL 4M7ZB 1NAMA 5LGJB 2EUVA 3QWOB 3CXDL 4RX4A 3S2AA 4S1QH 4MFHA 2V3DA 4YH6A 3HA0A 1RUPH 2JJVA 2HJKA 3SBRA 3ZDXF 1J1OL 2C9UA 4Z18A 1PZ5A 2MCG1 1ONQA 1E5ZA 2GTQA 2FWLB 3QDGA 4OZGE 1YAZA 8CGTA 2R7EA 2YPKB 5FKAA 1KXQE 2I5YH 2CBTA 3PWPD 1WS8A 1BMZA 3FB7B 1TUPA 5HI4D 4PTUA 2J25A 4AM0B 2EIJB 4QXUL 1N59A 3PV6A 3GS0A 4I87A 1VKXB 4XODA 3RKDC 5IOKA 5FX3A 2Z91B 1R4XA 4IU2B 3RVWD 4XI5C 3O4LE 3OJ2C 4ZFGL 3WEAA 1ZHLB 1VZGA 4H88H 1MHHA 2QPFA 1FNGA 2DIJA 4JB9H 4MGXA 2XV2A 4AG4L 4UQCA 4KJWD 3ZTJG 3H2WA 4HKJA 3FQWA 3TWCL 1YQVL 5BRZA 3QS2A 3K72A 3QUKA 3TA3B 1TETL 1C9SA 4XAWH 3M6DA 3MLZL 2Z34A 3SDAB 2YGVA 3BZDA 4ZUVA 1WAEA 1LEKA 4MA1B 4GXUN 1LD9B 2VYRE 2C9SA 2JXMB 4CADA 2GEQA 4Z7WF 4OB5L 4NN7C 3WJMB 3GXUB 3BH9A 1BLIA 4QHMB 3SZ6A 2D7MA 3EYVA 3NCBB 2XTJE 4ODHL 5CGYC 3ULUC 3KVQA 4DWHA 4UNVA 3AB0B 2B1HH 2FWOB 3DRQA 4MQSB 1FYTD 3SDDA 1E8XA 1PFOA 3MLSH 3PWVB 3HKFA 3L5XL 4KMTL 4FG4A 5DYOB 5MEND 3F3HA 2WQRA 3NJJA 5I0DA 1TSRA 4UZUA 2DQDH 2JJTC 3RFZC 2FHFA 2OJZL 2C8NA 4AQEB 3IXAA 5LXGH 2VDQB 4R7NA 3BDYL 5CBEB 3TEWA 3WCYA 2FEEL 1XF5A 1NCBL 1EHLH 3TBYB 3UBXA 3DX1A 1TR7A 1YMME 3B83A 1YNTB 4WI5A 5KSVB 2VRKA 4NN5C 2GJ6E 1W16A 2DJSA 3AU0A 2F7IA 4G59C 4POZC 3VXUE 4WNJA 4AUYA 4AENB 1E67A 3BT2L 1VFAA 3NFSL 2KPWA 1S7TB 1MJ8L 3T6QC 1FNEB 5F7KC 5B3JF 2CM6A 4XAKE 3EFDH 3EOAA 2DW5A 2YOAA 1XGQB 4NUGL 3OKKB 3EGDA 4AGPA 4CA4A 3T6ZA 2X89D 4M5TA 1K5NB 3GI8H 4H8WL 5AW2B 2L7QA 1XCTB 3LN5A 1KN2H 4YDJA 3GUTB 5JA9A 3EDDA 5IESL 3E6HA 3IFPB 1KCVL 4YHPB 4CDHA 4EPSA 4Z78B 1TVBB 2VR7A 4J8RA 5EOCH 1HOCA 1U8MB 3EBIA 2BNRA 4RGMB 3HE7A 5I30H 3GSQA 1FVDA 1IGYA 1MAKA 4XVUD 5FKPA 2Z0UA 4JPVL 1H0DB 5INDA 5DMGD 5TE6H 4BFEA 3DHPA 4R2GB 3WEBA 5CKAA 1CYXA 3VSQA 1OGTA 4PJEB 1FNSL 4XMWA 3U7WH 3QEHA 5BZDA 2FJHB 2MKLC 3K5SA 1WE5A 1KIRB 3L3IB 2ZONA 3QISA 7TAAA 2R69H 4GYBA 3B3IB 5C6PB 5SWSA 1WICA 1F58H 5IHBA 2IALA 4RNRA 1YN7B 1S7QB 3GHPA 1S9YA 3UJJL 4CKVX 2OMUA 4GW1B 2NY1C 1B2WH 4Y2DB 2G5BA 1R5VB 2YMXH 5E8NA 4DTGH 2NSMA 5FIEA 4ANVA 5E8OB 5AENA 1EJ6A 3HG0A 1UWXH 2DIAA 2IG2H 2ZWYA 2A1WH 4DGWC 3FB8B 3RAJL 3ZQWA 4U2YA 2BFVL 4AYMC 1AZRA 2ZYRA 1E4XI 3FO9B 3OKLA 5DEFA 5IW1B 4AT6B 1OCRB 3PL6D 5DEJA 4HIPA 4Z7VB 3K6FA 2DMCA 2C9VA 4OFDA 3BVXA 1O9WA 2HTLC 4UIKL 2GSIB 4LCYB 3KLAB 3FO2A 5I15H 1A1MA 4NHUB 5EBLA 3CFTA 3BAEH 5DSCA 2RIKA 4D7BA 2VN6A 4JUTA 4JZNB 1LWHA 4ONFH 3MA7A 4R4NC 5AOJA 4GRWE 2RFXB 2OTWB 4P2QD 3M17A 2QSCL 5ID0B 5TF1H 4HJJH 1U8JB 1Q9KA 1Z9SA 4GG6A 4CSZA 2WKOA 4OD3L 3RJQB 4Y4KD 5DRXA 3MBWB 1E4KA 1CZ8L 2O30A 3P77A 1EMTL 4JHZA 3ZZ1A 2NSQA 4FFWC 4B97A 3ULVD 5DMKA 2VQUA 4YHOH 3QA3A 3LY6A 1KPUA 4KROD 3DIVA 4N2BA 2WGNB 3E80A 3LN4B 3WS6A 4X80L 1EV2E 4JZJB 4NQDE 3W56A 3IFOB 1FORH 2JI2A 4KRPB 1NBZA 2WXPA 4J1UA 1S7WA 4MWFA 4AYEC 1F1GA 1XZ0B 4YSDA 3N1GC 1WO2A 3L08A 3WSQH 4QRTB 3E3QC 4TTDD 3CLFL 2QVFB 2XT1B 4WCYL 2ZSWB 1G7IA 3QUYA 2EC9T 4LOUD 4X6BA 3GBML 3ABKB 1XDQA 4U1KA 1IU1A 4I0PD 4IOIA 4N9GB 1EAOA 1BJ1H 2NW2A 3CFMA 4YPGA 4PBDA 2C3VB 1YQVH 1CFNA 2X70A 3NRPA 3QO1B 1LK3H 3KWUA 1TETH 1I9JL 1HKLL 2DIBA 2E74C 2YUVA 5D6CA 3NFPA 5BS0E 4XP9L 4MCYA 2BSRA 4WW2F 3RWIB 1FH5H 2ZE0A 1EO7A 1CIUA 1UD5A 3GRWH 4OB5H 3NZUA 2PCFB 4YZFF 1OF2B 1PLBA 2ZXWB 4L8DB 4CMMA 4HGMA 4DN3L 1TTCA 4G1EB 4QF1B 4B7LA 4FCAA 1AI1L 2AJUH 3P0YL 2A4ZA 4ZS7L 1GTFA 4FI7A 5TDOB 4J39A 1K5WA 1T0NA 3EOTL 1KT2A 1J86A 3GXDA 3CH8A 3VG0L 1S9WA 1HSAA 1XXDC 5D7IA 3L5XH 4KJYB 3DURB 4RQQA 1NIEA 1Y1UA 1ZA3B 2IAMC 3SDCD 4J4PC 1UATA 5AG9A 1L9TA 1P5UC 4PRBA 5IB1B 2NY2C 2B59B 3ZE0F 1G6RA 4ONGL 3K4DA 4MA3A 4LBEA 1YC7A 3MODL 4OZFA 5GGTH 2ED9A 2CXKA 4GW4B 2B5IB 2R9HD 3O11A 3Q3GB 4EOWL 3ARBB 4OCSH 5DMIH 2CKNA 1MVFA 1YPZA 1AO7E 1EAPA 1FH2A 3GPEA 5GRJL 5B1CA 1KN4H 4JY5L 4H1LG 3KBHE 4F91B 1H6EA 3O2WL 4G6KL 4HT1H 1R5IA 2F5BH 5E5MA 3NFSH 4JFFE 5E2VL 1KTCA 5DJDA 4Z7AA 3AXHA 2JI3A 1RJCA 1QA9B 3WEXA 1CFVL 1RD6A 2DDQL 3ZGIA 1TITA 3I9PA 4UT9L 4NB7A 3LPWA 1OCOB 1J5HA 1EVTC 3ULUF 3KLQA 4PGDB 1UM5L 4NO3B 3M7OA 3VD9A 5E94A 3BVWA 4WJ5A 1N8OE 1DDHB 5T1DL 5IVNA 1HAWA 1Y18B 4ZPVB 3WTYA 3T3ME 2CIKB 1FFTB 4MS8D 4JRYE 4NQED 5DHVH 4IDJL 2YC1A 3UAJC 1AKJB 3MRPB 3B2DC 3AG3B 1FNHA 5JXAH 1PLGH 2V8MA 4BK5A 2G75A 4KKNA 2BSBA 2G2PA 1PAZA 3PNWB 4JCWA 3LH2H 5MP6L 4AY0A 2ZWNA 4N90E 3QEQA 3BP5B 3UG4A 1MIMH 1OAKH 3B2UC 1F3RB 3IGAB 4KAQL 3SPGA 4E9SA 5J7CC 3ULVL 1JPFA 4Z7WE 5BZXA 5F70A 3UZQA 5I18H 2X88A 4NC2B 2MQGA 3F58H 4KI5E 4M5SA 4Q52A 4F20A 2HVJA 1AD9B 1D2PA 1AXSA 1G7PA 1SFHA 4HLZH 1ZHKB 2NPLX 3QZWB 1KBKA 3CVDA 4BSJA 4N8CH 5IVXF 5I2IB 1U8LB 1JNHA 1MFMA 2W0KA 1NSNL 2Z1PA 2W9EL 5EIIG 1U95A 4NGHL 4DHLA 1B6UA 2V7HB 4XCNA 5IK3A 1QR1A 2R56H 2BJML 4PLJC 4OF8A 1I8LA 1MF2L 2O6EA 2YBGA 3KHOA 4W9CC 4MHHG 2E8YA 2ZOTA 5D7EA 1RZ8A 2UVFA 4UIKH 3SKMB 4C58B 4GAAA 3E0GA 3QIUD 4TTGA 1E42A 1I7RA 1DJZA 1QABA 1NCNA 5DJCA 5FA4B 1II4E 3QIBD 4WUUA 5C8JB 3RDTC 1B0RA 3C5JA 3GLDA 1DBJL 1F56A 3CZNA 4ZFQA 4AVKA 1EWHA 3LMJL 3QRLA 3AU1B 5DMJB 4OV5B 1WEJL 5IB4B 5F7DA 5LDSA 1MNNA 3VD5A 4IK6A 3NA9L 2HX9A 2XVGA 1OF0A 4C4UA 2ESVE 1O5DT 5KVEH 1DE4B 5DQJA 3FQUB 1BIIB 2DY2A 2NZ9C 3MGTB 2Q6WB 3TPUA 5DZLA 1QR4A 3LNIA 3PGFL 3TEUA 1JI2A 4NI3A 5EU4A 3QUZC 2H2PD 2IGLA 1RJLA 1LP9B 4GXVH 4WW1B 5FHBH 1EGJH 1ORSA 3KXFA 5CN2A 5B1BB 4Z8FH 3MLYL 4YHZH 4AYDC 4GSUA 3OVUB 2AK1H 3LVTA 3PDOA 2B20A 4PGEB 3QUMA 3CVHB 1IEAB 3QIWA 4L4TA 1G9NL 1WWAX 1NPNA 3H1ZA 3WUWB 2DLFL 1FZJA 1RU9L 4J2XA 3GSNL 4WCYH 4NQCB 4GMSH 3NEEA 4NDMA 4FD0A 5PAZA 3ZKND 1KDIA 1E27B 1SN5A 4P2OD 3RRQA 2Y6SC 1HKLH 1SY6A 4FQQB 1VFOA 3D18B 3H8NA 4J3VA 5ITFA 2C1PA 2OW7A 1V54B 4HPYL 2CKBH 1B0GA 1JGVL 4DN3H 2BSTB 3PP3K 2XWEA 1S3KL 4YWGL 3BRDA 5IB2A 3ABMB 1AI1H 1SEBB 3B9EA 4ZS7H 2TSBA 4H13C 1AXIB 5F44A 2N0MA 4WNQA 4ORZC 1J9CT 1JV5B 5FYJD 1NC2B 2YGOA 3GZPA