2A99A

Crystal structure of recombinant chicken sulfite oxidase at resting state
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
total genus 88
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a99A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a99A01
1OGPA 2A9DA 3HBGA 3R19A 1XDQA 2CA4A 4PW3A 2CA3A 3HBPA 2A9CA 2BPBA 2A9AA 1XDYA 3R18A 2BLFA 2BIIA 2A99A 2XTSA 3HBQA 3HC2A 2BIHA 4PW9A 2A9BA 2C9XA 1SOXA
chains in the Genus database with same CATH superfamily
3NRPA 3FQ1A 3MNVA 5GISH 1D5XB 3EJZC 3F7RA 3ZL1A 2IDUA 4KK8C 4PB0L 3U36B 2K8MA 2W07B 1YVLA 4LPCA 4M6AA 1ZD6A 4BWUA 5HHQA 4G1MB 3HRZA 2VJ0A 3KBFA 4GAFB 1T7VA 3OMNB 2JTDA 5IHUH 4PJDF 1OSPL 1AAJA 4M7JL 1XBRA 1OPGL 4RGNE 2WY3B 2DTSA 4WJ5A 3L1FA 3PQYB 3TEXA 1P4IL 3QRLA 3C60D 2JJTA 1DANU 3KWUA 4YEFA 4X0NA 2Z4QB 3JQOB 5LN8A 5EUOF 2WLKA 2GKIA 3VI3F 3BWAA 4PGJA 2ZT9C 1H3PH 3DO4A 3G5YA 4O00A 5FFGA 5CWSB 3QIWA 4Z7UA 1FGNL 3OJDB 2VLRE 1S78D 3MLYH 2BPBA 4BCXA 3CFDB 1EK3A 4HHAA 1D2OA 3FU5A 5AZUA 2AKRA 3RIKA 1YDPB 4DTGH 3BQUA 1YN7A 5EC2B 2GFBB 2OJZH 4QT5B 1NBCA 1BZ8A 1CE1L 2AS5M 2I26N 1RUQL 1ZK9A 5DD1L 1UWXK 2ZKHL 3UROR 1EERB 4Y9BA 4YGAB 4X0KA 3LH8A 1QWNA 1LO3H 2APSA 1DQJA 1R46A 4KKAD 1TYJA 4UNTA 4PS4H 4KU1A 4B9ZA 1C9SA 2C9VA 4QRQA 3ARFC 2Y72A 2MSPA 1EXHA 2DLTA 4AY0A 3LXAA 3TO2A 1YUHA 4WW2B 3CDZB 3MGTB 2NTFB 4PHZA 1WIOA 1J9SA 2XZAL 1MUJB 4NCDA 3I50H 3H9SD 4MMXC 5FYJH 1IL1A 4Y2OA 5DLML 1TVHB 2QVTA 4EBQH 2Q76A 4FQJL 3SE3A 4G2AA 1CF8H 4AGMA 4F2MA 1QR1A 3O81A 4FXGB 4IU2A 3FPXA 1QUNB 1J5HA 1TTBA 1UA6H 1WZ1L 3FB5A 3QFJD 1D5BB 5TDOB 2YD6A 5CGTA 4GMSL 4L1BA 5J1SC 2P43B 4AYFA 3V0VB 5GZOD 5L9DH 3FO0L 4IIQA 2LE9A 4W9IC 5F7MC 3VQ1C 4LCCC 4NZUH 2WLHA 3TESA 3IJEB 3BP4A 1AGEA 1TQBC 1Z9MA 4M6NH 3KGSA 4F8QA 4GXUN 1WGOA 1LYQA 1E4WH 2B9BA 3RU8L 2C3HA 2VQ4A 3FU3A 1H3XA 3LB6C 4G8GA 3HG5A 2IBZY 5FKAA 4MXVE 2EVFA 1GZQB 1UACH 5HJDA 4P2OC 4WO0A 2BFGA 2Z7ZA 3U4BL 3LVTA 4Z1PA 3I75B 3Q2NA 4KKCD 5GGVL 1HDMB 5EOQL 1JHLL 5CCKH 1TQTA 1A7NL 4HKJB 3CSYB 4O02B 3WHXA 1G6RH 5KSBE 1GTFA 3ARBB 4GIOA 1JG9A 4XPAL 4YDJA 2BXYA 3C8HA 4DGUA 5IG7B 1AXSB 3NK4A 4ZUSA 4Y4HC 1U8HB 1LP9F 4QHLB 2XXGA 3SDXA 2BMKB 5T33L 3FUDA 1KG0A 4I5BA 5DFAA 4NEHB 1XCXA 1HILB 3DIDA 3SGJA 2FEDD 2DQHH 2NR6A 4XE0A 1BBJB 3MZTA 3Q9PA 4UV7L 4HJ0D 3D0VB 4JHWH 3BWUF 3OHXB 3MPCA 3L7EB 5C6TH 4F5CE 3CHRA 3QUZD 3QIBC 4TTDC 5EO9A 1T21A 4DZBA 1GTNA 3WS6A 4YQXL 3NQIA 4LXFA 4M3JA 2WWKO 4ETQB 2MOVA 2WWKT 7FABH 2YAOA 4NBXB 4M8QB 3ILPB 5DZNA 5MI0B 1R4XA 4BQBA 2HLAB 3BMVA 5EN3A 3INUH 4O02L 1RL1A 4HULB 1IMHC 3NPSC 4G6MH 4NRYA 1XD1A 3O9WC 4KJYB 4GQPH 1CBJA 4MD5B 4R26L 4C4BA 4OZIA 1NFIB 3E6HA 4AVJA 4I18A 1WISA 1VCAA 3MJ8A 4UDUB 1YPZE 3RY6C 4J1UA 3WFHB 3IDXH 2KZBA 3HC4L 2HFFA 4YHMH 1SJXA 4L9DA 5HDBE 2AEIT 4HQQL 4LASH 1D5ZB 1QSFB 3QPXL 4N90E 3TV3L 4L1SA 5GZNC 1UB6A 4I0PC 1KIPA 4WFED 5DJ2A 5C1MB 3FB7A 3LNIA 1TZIA 1FC2D 3MR9A 3W37A 1JF1B 4B5EA 5ICYA 3FU7B 4QRAA 2E9WA 3WTUA 3H3KA 4CMMA 1Q9KA 4PRPE 1GHFH 4TNVK 4KNQA 3WFEH 1OVZA 2JKTM 3QRGL 4MQXC 1NUNB 2EYSA 4XNQB 2EDYA 2VW6A 3OKNA 1DVFB 3O6FD 4RGND 2WAQA 2EDNA 3D39A 2FX9H 4Y4KA 5FK9A 2VIRB 1P2CB 1C7TA 1MI5A 5H2BB 4LGRB 2F19L 3HC2A 4HOZA 2IXQB 5HI5D 5DMIH 3L4ZA 3Q1SH 2CLZA 4JHAH 5KJRH 2VLRD 3X3FL 4G7RB 4CNIA 1NGXA 3NCFB 3DVNB 3NIDE 2DJUA 3FUJA 4PVNA 3PJNA 3PJSA 3BSZA 3G04B 5AL0A 3H9SB 4EDWH 4YO0A 4O5LL 1V55B 4NPYA 1QFWI 1U3HA 1CIDA 2NNCA 2V5TA 2XNAB 2XQBH 1E8YA 1NGZA 3BVTA 3DRQA 3GMMA 3QJTB 4KAQH 4LEEA 4XNMB 1A1OA 1UWEL 4GSDL 4EI5D 4OCLC 4RMUA 3JZYA 5J6GA 2R2BA 3ARPA 4L37B 4Y9FA 3CXDH 4QCIA 2X1PA 4KRPB 3FW6A 3MLUL 1S7UA 2UZXA 3ZKQD 5CEXB 1U41A 3ZUCA 4P4RB 1MLBB 3B9AA 1ODAA 4HT1L 1U3JA 1EFXA 4KVNL 4XXCA 4MNGA 1OO2A 3MLSH 2XXCB 1DBBL 3Q8EA 4APXA 2PWHA 3BPLB 3O11B 1ASOA 2Z0UA 2GC7C 5DUML 4NNPH 1HOEA 1MQKH 4HLJA 4Z6AT 1AE6H 3BEWB 1T6WA 2A74B 4PJAF 4PJXA 2ZWZA 4FQ2L 2MKLC 1U8KB 2OI9C 4OVVA 3UTSE 3KPTA 2VUOA 2EYRB 3BUQA 1MRDL 4J3UA 4UT6A 3L3OA 1F4AA 4H8WC 4AX3A 3AWGA 3E6FB 3GSXA 1QSEA 4WJKB 4U1GB 3EFOB 4L5FE 5ALBL 4HXAH 2D0FA 3GRWA 2GY5A 1KJ2B 3HG2A 5BO1H 2CRIA 3DJSA 5JLZB 1UENA 1GPOH 5IT2H 4OLWH 3N9GH 1DQVA 1G0DA 4H44C 2YMTA 1JRHI 2XN9D 4ZOAA 2CKBH 4GLRH 3QWQB 2QQNL 2EDFA 4ZXBB 3UTZB 3V5DA 1D9KD 3QZWB 2EEAA 1AR1D 4UT6H 1PY4A 4GW4B 4NXKA 3CQFA 3ZE2E 3TVMC 2O4EA 3LN4B 4XCCL 4QO1A 3K8KA 2H1PH 2H32B 1MIEL 4X7FC 4DPBX 4E68A 1CLVA 2XKUA 2XACC 4PYHA 3V5HA 1DVYA 3NSCA 3P54A 1KGYE 3LAFA 4OCYH 2FEJA 4J3VA 1E9QB 4AUYA 2PYED 5F1SA 3AT9A 3Q2CA 1KJ2L 5TQ0L 3SKOB 1M7IA 1SHWA 3MUGB 5D2LA 4LHUD 4JREB 4K4KA 5HP5A 2Y36L 4LRIC 5I2IA 4FZEH 2LAGB 3O3BA 4WI6A 5GSVB 4PG2C 3VFOA 3STZA 2EXYC 2LU3A 4ZMXA 3ILEA 3DJZA 2YMXH 1DBMH 1DQKA 5C0CE 4K3DL 5CLXA 2B0SL 3QIBA 2DMBA 4Q4EA 3EYFA 2C7UA 3FQ4A 1HYSD 1EAOA 2GW5A 1L6ZA 3UXFA 2DQTH 5FFOA 4JZJC 3ARXA 4O58L 3T6XA 3RKPA 1DFXA 3E0GA 5GGRB 1J0IA 1OARH 2ENJA 5I9QB 5DC2A 2X70A 5HI3C 4KQ4L 3PGCA 4RH4A 2C9AA 4RGNB 1RHHB 5A2FA 1FZKB 2AJXL 5FYLE 4BH8A 3KVQA 2EXWC 3WTTA 4DO6A 3RY6A 3BRGC 2NY1B 1UEYA 5EOTA 3M6DA 4KKZA 2IWFA 1TJMA 2J8UA 4Y9EA 1AXTL 2FBOJ 4YHNA 1K4CA 4XPFL 2DI9A 4I0PA 1AO7E 2FEEL 1IGJA 5DUBA 3LV3B 2IH1B 5CJBA 2VLRB 3HE7D 1M9SA 4PV8B 4Z7AA 1FG2B 3KPMA 4L8SA 4PJEA 4PRPD 1MIML 4FA8A 2EUWA 5F6HI 4RFNB 3KPRE 1A1NB 4K8RC 2V2XB 2Y6SC 2B59B 2OMZA 3LEXA 4HUUB 1BLIA 3TFKC 4EI5B 2Q5BA 1OCWH 3ZLQC 4P23D 4GBXC 1FF5A 4J23A 1UZ6E 4LP5A 1E4XI 1JWMA 3KPPB 4BFJA 3BSHA 1RURH 5EBWB 3WUZA 1UYWH 4DP5X 4YC2B 2WQXA 3OMAB 4FNSA 2H2PD 3G9AB 2L7EA 1DLHB 2R1YB 2B5IC 2WD0A 2ITFA 5T1JA 3MRFA 4CU8A 2JWYA 4PD4K 1PU0A 5E8DL 3QEGL 5EU6E 2E47A 1FLTX 2DWXA 4JM2B 2K7QA 4JFOA 1MFEL 4HJ1A 3D2UD 4ZJ9A 5GGVY 1IM3D 2AJYH 4C8XA 3ARUA 1S2EA 3V6OA 1C1EH 2IC2A 3F7LA 2R2HA 3BP7A 4ZUUA 2EC8A 3TO4A 3D3VD 3BCFA 5IEKB 5L4FA 5KZCD 1J0JA 4AIXA 5HGGS 5BQ7B 1IT9L 2HT2D 3KDMA 1DSWA 3PJLA 1AQDA 3PRZA 3QJHA 1UM4H 4V2BA 1KLUB 4DKDC 1DJWA 1ITBB 1R3KA 2H3NA 3FUKA 4PY7A 4YDVA 4AC4A 5J3HC 4H8VA 4X6DF 1A6VH 4MXQC 2IH9A 4HIXL 5I8KL 4DW2L 5DEFA 2RAMA 5FA3A 1JFQL 4C57C 3GJFA 1XGRB 4PGCB 1SFHA 3RGBA 4ZZKA 3TBYB 4P2QA 3DSNB 3PWNB 1BQHG 4MJJA 4AM0A 2D7NA 3PIQB 3HFFA 3HAEH 1D9KB 4Y5VB 5F9WB 4QMEA 1I9EA 2BSSB 2DYRB 2WXOA 1Y18B 4N2AA 1AR1B 5CSZA 3BVXA 3LQAC 1HHIB 5IB4B 3LN9A 2UXTA 5JR1H 2GSGA 1D7DA 3WLWD 5J5EA 5KSBB 3P4MA 3QUMB 2R2EB 5EZLB 3OG4B 5I1IL 3N0AA 3N85H 4F7KA 5F7NC 1T5KA 1YY8B 3QWOA 4DUWA 1EJ8A 1KV7A 3O45B 3CFQA 5F3HB 3IDGA 3N06B 1E42A 2VB5A 4AUJA 3C60C 4M7LL 1OSZA 3QUKA 1N68A 2P49B 1EXGA 4HVBA 4JN1L 4LHUB 4TRPL 4P0DA 4KROD 5D1XC 2AJ3A 1XH2A 1AHWB 3EG9A 3VH8A 1ZANH 1R5WB 4HETA 1NEPA 3KCWA 3MV7A 2CBTA 1Z3GH 4XZUA 1S78C 5HHXH 3P9LA 3C2AH 2VDNB 4W81A 1PL3A 1ZLWH 4FG6D 4AV0A 2LU5A 3H6AA 2EVHA 1X5ZA 1WAAE 3CBKB 5GS0D 3LQZB 1GYCA 3EO0A 3SKNB 2DM7A 4FEMA 1NCBH 5D5ME 4HS3B 4RNRB 1IC5L 1QTSA 3GXPA 3DUSA 4K7PL 3QUML 1D6VL 3FH7A 3QHTC 5HI4D 4KKRA 3U30C 5ILTL 5C0BE 2DWYA 3DDFA 5CBEA 4NZTL 4ZMWA 3BHBB 2J71A 1T2XA 3VRJB 1ZLUH 1YPZB 4WU7B 5C3IA 1E28B 3FT2A 4LRIA 5HDBB 3DV6B 1F1AA 4PG2A 4G42B 5CN1A 4JR9H 4MA7L 1MFBH 4EEEA 5EDSA 3QO0A 1JXGA 5C0CD 4Z78B 4W93A 4JRXA 1TTCA 4LL9A 1T04A 1G7LB 2VDNL 2HFGH 4ZBJA 3B2XA 3QFDB 4JZNB 2G2RB 5A16A 3EDFA 1WVZA 3OAYK 1DVTA 4PRPB 3MRMB 5ETUB 5JIDA 4M7ZC 2OSXA 2IQAA 2OZ4A 1YEKL 2YD3A 2FJGB 3VXMA 2OYMA 4QWWD 4RCAA 1QHOA 4OV5B 3QA3B 2OL3H 4FYSA 4GQQA 4OCNC 4XE5B 4G72B 2KZWA 1Q0XH 1REIA 4NC1E 3RJOA 5KUKA 4HC1A 3ZMRA 4X4XB 1DVQA 3VGBA 2EIZB 3UTPE 5K59F 5AW9B 5T1DL 3Q2LA 2H6PB 3TF7C 3UBXB 4DK3A 3NIDB 4Q14A 3EJPA 4AKQA 2CCVA 2DLFH 2EDXA 4NN7C 2H1XA 2ED9A 2IOOA 3ZMEA 3C9NA 2OMVB 3MA7A 1TJGL 3IDNB 1IBZA 1XCQA 3KPRD 4HWBL 4PGZA 2XN2A 5LKNA 3D2UB 4HIEB 3GKZA 4JM4H 1IM3B 1XAKA 3FRUB 4KK9D 4KKCC 3AB0C 5AL8A 3FMGL 3GEFA 4HC1H 4R8WH 4UU9A 1YEIL 2WUBL 3DUHA 4XVTH 3U1SL 3J07A 4H8QA 4LF3A 4OGYL 5KZCB 1E2WA 3G6JA 1LK2B 1DFBH 1I7UA 2O6PA 4GBXA 2R15A 4OCXH 2A83A 5B7EA 1DCEA 1N0LB 3NSJA 2ZG1A 2RQ8A 1VHPA 1AG0A 1BFVH 1K3ZA 2A6KA 2BP8B 5I18L 2YWYA 3BN3B 1JYWA 2X4OB 1P5UC 5IOKA 3FQRB 3DNKA 2BVOA 5GJTL 3B9KD 5D8JH 4LEOA 4UIKL 3C75A 1X9RA 3X14B 5AKVA 4K8RH 4X7CC 4ZX3A 5EU6D 3MRCB 3F84A 4JJ5B 2ZIDA 4U3XA 1G1YA 4IJ3C 4RISL 1OTUD 4HV8A 3QUZC 1WBZA 1HINL 3UZVA 3UZQB 2EDLA 4PHXA 3BH9A 4NXSA 1AI1L 2NYZA 5E2VH 2F8OA 3UTSB 4KKQA 1CI3M 5BUPA 3D9AH 3WUWB 1PZ3A 1AGDB 1OV8A 2IAAC 1OCCB 1F00I 2DTMH 1VA9A 3GM0A 4IRSD 1N64H 4TVUA 5H4ZA 4X5WB 1RJCA 1GYAA 1T66C 3W0WA 5D72H 1IV8A 1Z9NA 3PDGA 4D9QD 4QGYA 1CFVH 4TSBH 2WLJA 1CDYA 1I8MB 1KEMH 4QYAA 1YECL 2BVYA 2CKNA 5JIMA 2OR9H 4M5ZH 4AIZB 4ZTPH 1CUOA 2MHAB 2DBLL 1ZCRA 1GOGA 2VMDA 4Y2DB 2OTWB 2PW2A 3DJRA 3FRPG 4U1LB 3WXWL 3ZE2B 4PG9B 1AKJB 4MZRA 4NGHH 3MRNA 5G5DA 3WL9A 5IB5B 5IKCB 4WDIB 3L4VA 3BE1L 3S88H 3O6FC 5DD3H 3LKQA 3TFBA 3M1OA 2RR3A 2VERN 5CILH 4YSCA 3OX8B 1FO0B 4JFHE 3U0TB 5E8PA 1S9WB 2JXMA 1UOWA 2QSCL 3TN0B 4GS7B 1KTRL 2NW3A 4Z0XB 1Z5LA 2ARWA 1JXJA 2IJ0C 5D1XA 1E5ZA 1NM4A 4PJDE 2JNZA 4RZCB 1OCZB 2UWEA 4OTXH 5CZRA 3S36L 2A9ML 3LQAH 4DQOH 1OAUH 1ZTXH 1B3JA 2VW7A 4TSAH 4IBLT 1ZKAA 2R29L 3NH7H 5C0CB 4NCC1 3UP6A 2C9XA 3TZVD 1WWBX 5ICXB 3UG3A 4N9GB 1CXKA 1MKFA 5EUOE 1CBVL 3VVWA 2W5PA 3VI3E 5DQDL 5TDPB 2ISDA 4NQEA 4R7VA 4MA8L 3WNIA 3ZKMC 2GIMA 4LP4A 1PKQA 5GGRY 2FDBP 2ZAIA 1MFCL 4XO3A 3RX9A 1MHPH 1A6TA 3F12A 1LJMA 3DC0A 2IH3B 5C0BD 4RZKA 5I8EA 4ONHB 1INDL 3FU6A 3MLWL 4HAGA 3JWNG 1OP3H 3TIEA 4QRSA 2MNWA 1FO0L 3PHQA 3SSGA 5IFJB 3C08L 3RKDC 3LXUX 4GI6A 3CUPA 3BUBA 3QEHB 1LDPH 3GUFA 5C2UB 1IX2A 3GSRA 3QNYA 1VGEH 4MD0A 1K85A 1KPUA 2WSPA 3GHEH 4JY5H 1D6EA 1AHMA 1NBZA 2J20A 1CLZH 3SZ6A 1AO7B 1BZEA 3GKWL 4OJDH 2PYFA 5LBSA 1Q94B 4OCSL 1UM5L 3WKPA 2DWEB 3SBQA 1PZBA 1KXQA 1TZ8A 3CH1A 3K72B 4ODVH 5CKGA 2Q8AL 1ORSB 5ID1B 3FCTA 4S1QL 1C8QA 4MDJB 4GT7A 4N9OB 1QQDB 1QFWH 3KPRB 3C8KB 4P07A 4OGAC 1IQDA 3BUIA 1F4YL 2HFEA 1B4JH 4LB8A 1N6QL 5JW5B 5IMKA 3HA0A 4UF7C 1UKQA 2L04A 3G08B 3BDYH 1BQSA 3CD4A 3NGBC 5CJQL 3ZDXF 3HN8A 2V17L 2NY0C 4O2EA 3IFPB 5JUEL 3RDTB 4TUUA 5FYLL 3VG0H 5EIVA 5I19L 3VGHA 3SKMA 2YFNA 4NKIL 4YHIA 4AG4L 3UTPD 3ULSB 1JYNA 2FWOA 1XF3B 4I77H 5MP6H 4JFDA 2YUZA 2IFFL 3QQ3B 1ADQA 1Q1JL 5IB3A 4XT1C 4GH7B 4S1RL 2VLJE 1HHGA 2H2SD 2R2CA 3VXRD 4OZFA 1BZ9B 2BOBB 4UIMB 2VNCA 3CSPA 3EOBA 5EU6B 4G9FE 3EHBC 4M1DL 4H2AA 1UG9A 1P5VB 3ZZLA 4U1IB 2VISB 5GRXG 4LSVL 3UCRA 5JMRA 1G4RA 1L6XA 1UWYA 3QG7H 3A6CL 5CU5A 5FGRA 3UDWA 1IEAA 2Z7WA 2W9EL 2SODB 3BJ91 3JV4A 1HEJC 4OSUH 4JW3A 2Q7AA 2DLHA 4NP4H 5D6CA 5JORB 4FFWD 3O4LE 4TUOB 1VESA 5C08D 1U6AH 2AMUA 2ESVA 2YOCA 2Q20A 3I3EA 4IRSB 1G9NL 3RUGF 4UILH 3MNZA 1G0YR 3DARA 5CIPH 5MERA 4WENB 3CZGA 1MCFA 3NCWA 4PRDB 4YDNA 4LPXA 1DVXA 1P5UA 5I15L 1INQB 1JRHH 3HPJA 4KY1H 4HH8A 1O7SA 3RILA 5B39G 5IJKC 3TX4A 3C5SB 4UQCA 1NEZB 4GRLB 1GIGH 4HX1B 4MAZA 1KLFA 4Q9BA 1SUHA 3VRLF 1ADWA 5C2BL 3LHAA 5TDNA 4HA1A 1HYSC 1Z9LA 1LP9E 5FHAL 3ZO0A 1FORL 1WC7A 3BGMA 4K7PY 2K0RA 3ECQA 2WXPA 4NJ9L 4DF9A 5HYQA 3PWVA 2NXYC 5IQ9A 4U1SB 1GRWA 3SKJL 3AM8A 1E43A 3N50A 4ZUTA 4YXKL 1E90A 3WIIH 1P84K 3UL4A 3IJHA 1HJBC 1ZK5A 1MSPA 1XF5A 3T2QA 3CAFA 5ID0B 3VFMA 1IEHA 4ZMLA 1BPLB 3O2DL 1QHPA 5J6HB 2ITDB 1HQ4B 4S2SA 4CC4C 1AZRA 3TJHD 5JDSA 5F0MB 1UZ8A 3H9ZA 1OD9A 1JPGB 2XJKA 2G4EA 1FH5H 3X12A 1YYCA 5IFHL 3TZVB 2P1YA 1IGFH 2UYLB 4LLYB 3DO7A 4YNYB 3MA9L 4XMLH 2R69L 3Q6GH 3K2MC 4X99B 1BOGA 4GAYA 4M1CC 4PJ9C 1J8HA 2X09A 2Z64C 4G8IA 3KPSA 4UQIM 4WW1A 5ISZA 5D5MB 3N04A 1F6FB 5LGJB 1HH9B 3MODL 5AFAA 2AABH 5C0EA 3OB8A 2R1XB 5C0BB 4A6YA 4DVBB 1XDQA 4N85A 3UIZA 4D0CA 2A6DB 3L4XA 5JOFA 4WHYG 4EDXB 3OLEA 4P23C 5DJDA 3VWJD 3MRIA 3CHSA 4HPOL 5J57B 3OKMA 4QIRA 4XCYA 2FLBT 4QHNA 4HOWA 1WHPA 2ZX5A 3ELAT 4ABWA 3MJ9L 4KO7A 5AW3B 3FPYA 4F33A 4PJCA 5G55A 4WWNA 2B4CH 1TJIH 4LPUA 5EO1B 4N68A 1OWRM 1MOEA 5EO0B 4U1JB 5JIQA 1RUKL 5HVHC 2FSEA 3VSVA 4F15C 1OEZW 2B3IA 4MVBD 4O9HH 4WK0B 4DFIA 3STLA 1MCQA 4YMPA 4GKOA 5I6XC 4A6YH 2P3YA 2DYPA 3L1OH 4XAWH 1HHJA 3F6IA 3GTNA 4ZQKA 2X2JA 4NP9A 4I0CC 3L7FA 2ALAA 4OQTH 5C0FB 4RQQA 3VXPA 1SM3H 2J55A 2XWBA 3K4AA 3LZLA 2ZUVA 3I9GH 3IJ9A 1FL6A 1URLA 1NIAA 3P69A 2GHZA 3KWWA 2CIIB 4Q97A 3HNVH 3QWRD 5DJ8B 1XR9B 2P9RA 5KYUB 2WIIA 3MJ6A 4I4WB 5E4EC 1N2RA 2VMFA 1QTYT 1XB3A 1FNEB 1AIFB 2ICWI 1OIOA 3D1MC 3OGCA 2R0KL 2FB4H 4X4ME 2WTRA 2XFXB 3ABLB 3FT3A 3QS2A 1I85A 3SDDD 4MNHA 5FW6A 5JTWA 2VDLH 1DBKL 1AZUA 3BVUA 1YYML 2HP4A 4X2UA 1WEJH 3VYNA 4JUTA 1DJHA 3GGWA 2N3JA 4DPCX 2FJHA 3W2DL 4NT6A 3AADB 4FABL 4R0LC 5EB9A 4A66A 3CVDA 4WFFE 1FRGL 4MX7B 2AQ1A 5E1IA 5F6IC 1W15A 32C2A 4P48A 4OCWH 5C08B 4CKQA 1CTNA 5CBAA 3KLQA 3ZRSA 4HH9B 3RQ3A 3WY3A 4BQ6A 1SF5A 2AEPL 4ZO7A 3WGVB 4GMTL 2F54A 1QNIA 1BVKB 2CDEA 3RFZA 4KROC 2XA8H 2VM3A 2VDRH 1INEH 5D7KE 3OR6A 3WY2A 4MYWB 1HYRC 5EBMB 4A55A 1I3UA 3MXWH 4LDLB 2APVA 2FE0A 2QHRL 3AS1A 2NY4D 1LO4H 3LMJH 3KLSA 2PPCA 1JHKL 4FG6C 1Q72H 5GJSL 4DK5A 12E8H 4IHBA 2BERA 1RZJC 5DA0B 5A2LH 1RIVH 3REVB 5GS0C 4LCIH 3HMXA 4YSQA 2E9JA 5AWNL 1AQKL 4LCWE 1A5FL 5HI4C 3G6AA 4KUZH 4L8BA 4XPHH 5DTFA 3A6OA 1LTXA 3O41A 1XCTA 1SLUA 3RG1C 3TCTA 5L8LB 1QBML 1QSZA 3CZNA 3L13A 1I8UA 3MJ7A 5JPMB 4Y16D 4HPHA 4PBVC 3QUYD 4CW1A 2VH5L 1NH6A 4UNUA 4P4KD 4QEGA 5LNGA 4PJ8A 3II2A 4POUB 1R3IH 3ZDWA 4E9TA 4PVLA 2IWEA 2H45A 5ERWA 1RK0A 1JWSB 5SX4H 1ZLSH 4U1HA 1N26A 3CSGA 2FWSA 3B7UX 5AQ0A 3V0EA 4D3CH 4MKMA 5EOCH 4EQ2A 1C7SA 4Q89A 3C5XA 4NN5C 5GGUA 2CLRA 5L8KB 1OAKH 4P46C 3ET9F 3H56A 5H37G 1U8PB 2ZUWA 4HIJA 2GG1A 2Q3AA 1F3RB 1M71B 3VGFA 1EGJA 4HK3J 3ARSA 1GY1A 2HWZL 4Y8DC 3NT0A 4UQBA 4NSKB 1RQ5A 1F90H 5GGQL 5JQ6L 4JY6A 3B9VA 1RZGB 3K2KA 3KLKA 4FRWA 3M88A 3VWJB 35C8H 3V0GA 1FDLL 3APFA 4JHVA 1BD2A 4YFEA 4ZFOA 3VG9B 4PJDB 2HJKB 2XWTB 5GRYA 4XO8A 4KZEH 2Z92B 1NCWL 4DT2A 4J3TA 2Y25A 2F1BA 4JVPA 3VFPB 3NACL 4Z77A 5EUOB 2B2XL 4WEBL 3VI3B 4ZNEE 2E27L 4PJ9A 2CR6A 3AUWB 4N0UE 1BF8A 2H8PB 1ED3B 4XNYH 5EWIL 4K2UH 1I8LA 3RAJL 3T0XA 3MYZA 1N5AA 2ZPKL 4MA3B 4ODUA 2XPZA 5SWQA 5L4IA 2EQDA 5E5RB 2K6WA 3H42H 2N4IA 4PP1D 4L4TE 1LEKA 4PVMA 2JB6A 1MH5A 3EOTL 1HZKA 2NCMA 2EYTB 3Q8BA 2D31A 3MRKB 2EZ0C 4DEUA 5DRWB 4HIHA 3P11L 3B9KC 1AC6A 1AOHA 1DUZA 4WKZB 3C6EA 4KC3B 1CGWA 4NENA 3MACL 5TF1L 3M7FB 4L3EA 2IDTA 2P5PA 3SDDB 4IMLA 5ENWA 5JNYA 3ZHNA 1EEZA 2DEWX 3BD4A 4R4FL 1SGKA 3EYQC 3QDGD 3D33A 1SXNA 4JLRA 3VDBA 3DPBA 2OX5A 1EZSA 3S3CB 1I9JH 3S3PA 4NO2B 2X4RB 2OMUA 2SEBB 1ES0A 4YAQA 2GK0B 2LHAA 1C12B 1DEDA 1F1DA 3DGGA 3L5XL 3W82A 4HOXA 2XT1B 2EE2A 1LO0H 5DMGD 4ELKA 3HZKB 1ORQA 4ENZA 5SX5H 1IGIL 5C0GB 2R4SH 4Y5XA 1EHAA 3OKKA 4YPGB 3T65A 2CRMA 3MUUA 3VQLA 1G7QA 1U2CA 3EDJA 3MV9D 5K93A 2D3NA 1I3RA 2VLJB 2CQVA 2ZUUA 2Q2EB 3DVGB 4F2FA 2XYCA 2P45B 4RIRA 4LCUA 3OKDB 4FI7A 4HBCH 1H15B 2VXUH 4F7CA 4G9FB 2XY1A 2BDNL 2HLEB 4CVZB 3NABH 4AQ8C 1IEBA 2XRAL 1FIGH 4LPWA 4MLSA 4TMPA 5MEND 3LH2H 2NX5E 5EC1A 1J1OL 1FN4B 2NLJA 2BOCB 2F9BT 2H0PA 1A47A 3V4PB 3RTQA 4R0LA 4MZ3A 3P0YH 3O4LB 3T0EA 5L6YH 2BJMH 1QBLH 2PTUA 4NO5B 4O2FB 2WBJA 3C6LC 2NNRA 3BAEH 5E6SB 3FFDB 3Q48A 1U92A 4LOUD 3VW3H 1PX4A 2VITB 5F1IA 2EINB 4XI5D 5D7KD 1TEFA 5IK3B 4K23H 2AXFB 3RVTC 4G83A 2WV3A 1XSIA 1IBYA 1WFTA 2XQ0A 3U9PL 1HSBA 1M7DB 3RNQA 3ULUD 3LSOB 1FCGA 1JGLH 2VC2B 4HLEA 4U31A 2A73B 4P5TA 4NO3A 2OW7A 2N59A 4XPBH 1LP9B 3CFNA 1WA0X 4YDIL 4LCWD 3U0PA 5F71A 4L5FH 3SE8H 4OD1H 3ABKB 3V4PL 3G5WA 3MLPA 5DJ0B 3WNLA 1JZ8A 4LSSL 3JXAA 2J3SA 1WF5A 5EZJA 4NQCD 3ZSTA 1WA2X 3RWFA 3V4UH 3I6GA 3EYUL 4ATWA 2APFA 4HFWA 4RGOL 4E42B 1VJSA 5E2UL 5KG9B 2IDSA 1KC5L 4XBGA 2FLMA 1LK3H 4AJ0A 3LPPA 4ZG1A 4GQRA 1PZSA 2WO3B 1FPTH 4TVPD 4TLTA 2XVGA 1VSCA 4JPKL 3F3HA 3U7WL 5JYLA 1RZJH 5GS0H 3OJ2C 4JKWA 4PWIA 4C55A 3T0DA 3SZKC 2WXMA 2FGZA 4EAEA 5EU3A 2X4UA 4JPVL 1XZWA 5IQ7H 3EDDA 5C70A 4P46A 2A9DA 3ZYJA 1TJHH 4ELMF 1E9OA 3QC5X 3ZBMA 3IFNH 2IWKA 1KPRB 3MRJB 1M56B 4QRPE 2ADIA 4H7VA 3BW9B 3JYCA 3BPOC 4JFYB 3KGUA 1FUNA 1OOAA 3COOA 4XPGL 2C34A 3I9AA 1EJOH 1CDGA 1LL1A 1G7JB 4UWQB 3WE1A 1A4AA 1V7MH 2YBGA 2BIHA 5LQBH 3H9YA 3CVBA 5EG6C 1RUPL 3FONB 4PJ5A 5HHNA 1Z0NA 4MDIB 3TBTA 1XEUA 3AG1B 3V4VA 5IGXH 1K8IA 2J4WH 2H2SC 1N5YH 3UTOA 4IGBD 1KLGB 4ZDHB 4LP8A 3FTYA 3OMIB 3WNKA 4I2XE 5K59E 3K7UA 2X0WA 2OK0L 2WSKA 1FNFA 1SMOA 1KYDA 2HKFL 2ZXGA 4WO4B 1KB9K 3S7GA 1ID5I 4MWFA 2VLLB 3GXNA 4IHOB 1H9DA 3S37X 4FFWC 1UM6H 3SQOH 4LPTA 3K71B 3UAAA 1NAMA 1OE1A 2WUCH 4JGJA 3WKMH 2FYYA 4ANXA 2IO5A 3L3KB 1JV2B 2FX8H 5IVZA 1CL7H 5FGBC 2W0KA 4BH7A 3MXVH 1ETB1 5I8OH 1XSJA 2O6CA 4CGTA 4JQIL 3T1WA 5INCB 2BC4B 3ZT6A 1MVUA 2JJWA 4PGDA 1PPIA 2VSCA 5C8JA 5IUSA 1Z2KA 4Q0XH 5B22A 1KGXA 3SQRA 1B6DA 1PEWA 5CP7A 3RWEB 3BCDA 1DJYA 4XNAA 4FS0A 2JK5A 3ULVF 1NAMH 4DGIL 3D69A 4AQAA 4X80H 4PREB 5IVNA 2PTTA 1U8NB 1IC4L 2KDGA 3ZYOA 1QW9A 3LKSA 4PLKD 2B08A 3VD5A 3VUAA 5AG8A 2YRBA 3F01A 3D0LA 5L0QB 3BKMH 3HZYA 3V0WH 2DQIH 2B8OT 4IDJH 4ZFZB 1PLGL 2AJSL 5C07D 4A1RA 3NESA 1Z9SA 1NCGA 1J12A 1EMTL 2CJUH 4TSCL 3KYKH 3QEQE 4KMQA 2W1NA 2HX9A 2VXTH 3IFLL 2XKNA 4G6FB 4ODHH 3EGXA 2D7TL 2OJEA 3TJHC 4HFUH 3KS0J 3CQQA 5C6PB 2V5SA 3FQWA 5G4MA 5IW6B 5DD5L 1QVOB 1ZS8A 3GM8A 3Q2WA 4PWHA 4AYMC 2BY1A 1N18A 2CGRH 5CGYD 4AQ8A 3T04D 2NX5D 3KL0A 2BVQB 4NHCH 1KTJA 4EN3C 4GO6B 4F9LC 3WNNA 4F7PA 1S9XA 2AJZB 4LCWB 3SBPA 3TIDA 1SF3A 3RVVC 3PWPE 3K3QA 1GGBH 2C1OA 3NUKA 3VXSE 4NZFA 1WBXA 3V6ZA 2K8QA 1JK9A 3HG1A 1MW3A 4GOSA 4IOIB 5I75C 3C6LA 3ETBF 3LY6A 1BM3L 1KT2B 3C12A 4WU5A 2A9NH 3WFDH 5D1ZD 2GPZA 4FXKA 3ROOB 3WSQL 3OLDA 3GMRA 1BGXH 4TKWA 3HUJA 3ZQ9A 5CD5D 1JGVL 4PJFF 2C4FU 4UQ3A 3QDAA 3HKFA 1TTFA 4ALAC 4GKSB 2BVUA 4RWYH 1JGUH 5DO2D 1KIRB 1GGCL 3WFCH 3CLFL 5D55A 3T4AC 5JHLA 3UYRL 5DHYA 2PR9A 4PTUB 3AQZA 3T0WA 4YR6A 2OCJA 4FLSA 1M3JA 2R56L 2QHLA 4XP1H 4XN2A 2VUYA 1YZZA 2YAQA 1MQ8A 4R4ND 4AV4A 3B7TA 5BVPL 4TNWF 4KO5A 3S4SA 3ES6A 3FQUB 3HB3B 5I0ZA 3FT4A 1NLDH 1XZ0B 4KKPA 1AC0A 1T7XA 4PEEA 1LLAA 3QJSB 2VAAB 1CFNB 1SLXA 4F7EB 2QQLH 2ID5A 4QYOA 3X11A 3TC9A 1P9MC 2QTEA 4S1SH 2GITB 4YLBA 2YXFA 1L9PA 3TCLB 5CM1A 3EZ8A 5TE4L 1KFAH 2ICWA 1QWUA 1CDJA 4HKZA 3HCVA 2L3BA 3OKOB 4EI6A 3ATDA 4N0UB 3PL6B 3RZCB 4QRPD 3MO1A 4XMTA 2QVIA 4XWOC 2ZCLH 1XVSA 1XIWA 3RX7A 3GS0A 4ZMOA 5L88H 2EUZA 4NN6B 1IGTB 1TCRB 3DVFA 1ET5A 3B83A 4L4TB 1UQSB 2R0LL 4GXFA 1ZLEA 3NRFA 4AJVA 5BJTB 1FFOB 4LSUL 2FT6A 2QADD 1EAQA 2H0EA 3AUVA 4MZIA 5D4JA 5GS2D 5D96C 3RGVD 3KCPA 1QX1A 2BO0A 4KNSA 1AS7A 4QUOA 3ZDXE 4C4KO 4P2RE 4WJG3 2NY4C 4C4KT 3BRFA 3DMMD 3MFFA 1WLHA 4ZZFA 2FHBA 3QFGA 5ESAA 3SE4A 5KWYC 2VABA 3GSVB 3VB9A 2ZCHH 3R18A 3DIVA 3QDJD 3WCYA 3PAUA 3LS5H 3MCLL 3Q1EA 1B2YA 3ZL2A 5E5LA 4OQ1A 4FL4B 4OB5L 3RBSA 4Y16C 5FGBA 3QUYC 2NY3D 4HHWA 4LARL 4KH2A 5ESVA 5JQIB 2DIAA 2Z93A 4P4KC 2HTKD 3HJEA 5M7QA 5CJOH 4CVWA 1GYWA 1KCVH 4H20L 1E40A 1KB5B 3WFZA 4A04A 1A4JA 3PF2A 3V6BR 5G2NA 1ND0B 3RL2B 2R4RL 1QEWA 2IWGA 3GI9H 3OTTA 4KQ3L 2EUVA 3S96B 1L5GB 1WFUA 1JPSH 1CN4A 3GSNA 4KXBA 4ZOBA 5J0BA 5CJXC 3BDBA 3IU3A 4PWEA 4QTIH 4YHYB 5KVDE 4X6DB 3WKQA 2QQKH 2NX5B 3NFPA 3NEOA 4KI5C 1CCZA 1QD0A 4KVCH 3P30L 4M00A 1JZDC 3LNHA 1TTUA 2B1OA 4MJ2A 3TA3D 1MNNA 1MHCB 2ROYA 4Z0BL 2P80A 2OXGA 1XFPA 2JQMA 4ODXB 3VRLE 5AKSA 1TZAA 1G7HB 1SEBA 1UGNA 1XDYA 1ERNA 4KTDL 2YQBA 5D1ZB 4YXHL 4DQAA 2D9QB 2C8NA 5E2WH 3KR3L 1L0QA 5AYUL 3VXTB 3GMOA 3OKYA 4MJ6A 5MEOA 5IBTL 4G43A 4NUJB 4Z7UF 4FXLA 2VZOA 1SXSA 2ITCB 2JELH 4KPHH 2KI6A 3FCSB 3R06A 4OZHE 5D7EA 5IESL 3CMGA 4HS8L 4HPYL 1VFOA 5DS1A 4B53A 3AU0A 4G7YL 4XH2B 4KMTL 5FUCE 4FA7B 4EN3A 4F9LA 4B9YA 2EH8L 1WZLA 3VXSD 5DEGA 4LOEA 3IFOA 4FHKA 5EU7C 2EEFA 2VXQL 5AW7B 1QFWM 3EOAA 4XMVA 1L7IL 2QSTA 1GZPA 3T0VA 3SCMD 2ZUQC 5F3BB 3F58H 2VLKE 2WW8A 1IGYB 4A7QA 4WEUD 3JWDH 1PW3A 4PP1C 4G5ZL 4DN4L 1BBDH 2JSFA 4W68A 4XNXL 5E56A 3T4YB 4TUKL 3UPAA 2YEZA 3RPKA 2Y5TB 3X13B 4EXKA 5HHOE 3JTTA 4WV1C 1VKXA 1W2KT 5E94B 5A2IH 4DVRL 3T4AA 5F7DA 3WXVL 5EFIB 5A2AA 4IBWA 1IM9D 1OTTD 5BRPA 1DVUA 1FFNA 2CNYA 3LKRB 1WPCA 4WWKD 5E6ID 5JXAH 2XPGA 4U3SB 3QNXA 4ANWA 5EUKA 3W39A 1CLCA 3GXMA 3U82B 5IJBC 5CLYA 3WD5H 3QJXA 4QRPB 4XB7A 4I85A 4ZW6A 2WLLA 2CIKB 2WQVA 3BWSA 4QF1A 4JO1H 1HOCA 1NJ9A 5AVUB 1HTYA 4CC0A 2WP3O 3B4NA 2Z8RA 3ISWA 5KSAD 4LVNB 2WP3T 4ALAH 5KANI 3F6LA 1M53A 2C26A 1Q0YH 5DMGC 2A38A 3AZUA 2E7LA 4A37A 3L45A 1B2WH 3NPZB 1KZYA 4Z7OF 2QADB 4YHZH 4Q9QH 3CHOA 4OF7A 1BZ7B 1W0WB 4JFTA 3AMLA 1K5NA 3DIFB 3ZUNC 1CGVA 3DO3A 5F7UA 3PNRB 2DJSA 4I2XB 1YEDB 4KHTH 4HGMA 2YD4A 5FGSA 4HW6A 2XWJA 1DDHA 4FCAA 3NCMA 1AR2A 1OB0A 4H26A 4ZO9A 2XIDA 3WJJA 3T6QC 4YHKL 1ACCA 3UACA 3CFIC 4A68A 4JFQB 2ZWKA 3WIFA 3QPQD 3SPJA 1ETZB 1KTDB 2NY3B 1BXAA 4WRLA 3QUXC 7TAAA 1BMWA 3SDXF 4XI5C 5ESQA 4N2OA 2Z4TA 4Q9RL 4YWGH 2ORBL 4CADB 3UBGA 4QXUL 4WUUA 4E9LA 4P2RD 4PD4J 3N40F 5C0RL 1XGPB 3ULUC 2M1KA 2CR0A 3U0WL 3LPWA 4G9DB 5DZJA 1PD6A 5CSBA 3P2TA 4AK1A 2DIJA 4UTBA 2AERT 2NUPB 5KSVA 1XGYH 1EEUA 2DQEL 4HS6A 1A3QA 2HPTA 4ICWA 2F8IA 3D34A 2IPTL 4HKBB 1X5XA 3M46A 1EAPA 2YLKA 5DR5H 5TE7H 4A63A 1D2PA 5EZPA 1XGUA 3D85A 4L4VE 5GS1B 1K5WA 3TA3B 2AV1B 4U1MA 1AGCB 1CR9L 4OZIF 2I5YH 3HS0B 3MROA 4Q2ZB 4U6XB 1HCYA 2A6IB 2Y1YA 1RZKL 3OAUH 4NAQA 3K0WA 1W16A 4C47A 2QL1A 4X7EC 4GFTB 5J1AA 5F0PB 3QEQB 4FNRA 3QXDA 4B9PA 4PMEA 4WTQA 4F8PA 1UUSA 2R0ZL 1XH1A 2XOTA 3T09A 4AYDC 3X3GL 4UTBH 5SX5K 3BYTA 3DRTA 1UGKA 1YNTA 3EH5B 2BVPB 2VXVL 1AZCA 5HGDB 1QRNE 3FQXA 5CJXA 3MBEC 4DEPC 2BX5A 1UD3A 3VXNA 1EZVX 1P4BH 4RAVB 3VYOA 3CZJA 5GGTH 1F4XL 5EEUA 5D93B 4KI1A 3BXNA 4TNEA 1ZGLB 1BECA 1S9YB 1VENA 3PWPB 2A9BA 3VXSB 2QVFB 3D09A 1FJ1A 2BSED 4L3FA 1AZZC 5I1GL 1T3FB 1PSKL 4XWGL 4EIUA 4JO8A 2IVFC 4GW5B 4X7TA 5KS9A 1D5XA 2GJ6E 2NTSP 2VRAA 4GB9A 2W07A 5DEZA 4MQTB 1QZ1A 1VCBC 3LDBC 5C7XL 2WOYA 2WWOA 4G1MA 3VH8G 2VC2H 1TIUA 2ED8A 1EANA 1DJGA 4X5XB 3A6BL 3GLAA 3Q01A 5JW4M 3QZBA 2KQMA 25C8H 4NQDD 4FG2A 1JZ7A 4NYLB 3PQYA 4IGBC 3S97C 2Z4QA 1OT1A 4HUVB 1G7MB 2DMCA 1BQLH 3QHZL 3QORD 1IM9B 2EIEA 2YWZA 4KJPD 3RA7L 3P0VH 4YSTA 2VKWA 3ZKXC 4U3HA 5CWSA 4PRHD 3ILQD 2IDCA 1PQZB 1YQ2A 5HPMB 4HF5H 2DDQL 3V4LA 1HCVA 1DVSA 1P1ZB 2FIRT 4AQEB 4PWJA 5BO0D 2X88A 1U8LB 4HGKC 5EC2A 1BLNA 3FB6A 1WO2A 2JKSA 1EO8L 4BUHA 4OD2B 3FN0L 5KSAB 5C3LD 3BVNB 4X7DC 4A67A 5B1AB 2XKSA 4NWUH 5F3FA 1MZZA 3N43F 1A64A 4IMKC 4WFGD 5LO7A 3LNDA 1B9ZA 3ARGD 1N0XH 3MNWB 3I2CL 4ORZC 2DYSB 4POYA 3O2VH 3ZPDA 3P3UA 3SN6N 3IJSA 2B39A 3SPCA 3M7OA 1KIUB 3OV6A 2ODIA 1ECYA 2APTA 4PJXF 3WN6A 3C09C 3TWCL 4F7MB 4WW2A 4GRWF 2NTFA 2OM5A 3CBRA 1ET8A 5I16B 1MUJA 1DUYB 4Z3TA 2R83A 5CZVL 5F88B 4ENED 4ONFH 4Y5YC 1FNGB 1WFMA 2DM3A 2DQUH 3PAVA 5C0JB 1O6VA 2E8ZA 2R23A 2VERA 1BQHB 2VDKH 3UJJL 3TBBA 2YZ8A 4IEFB 3D18B 1U8OB 4E9VA 1JPTL 2D03L 5K9QG 3FO0H 2OA9A 4OLUH 4PV9B 3IGFA 1NCNA 3FUFA 5I5RA 2VE6A 5TDOA 5IBUB 4QR7A 1L9OA 3QI9B 1FYTE 3PDOB 4BZ1H 1XV8A 1U2HA 2EXSA 3BZFA 4A7UA 3ZDXB 4P2RB 1QLRB 3JYBA 4MAYB 5D7IA 3UBXI 2I69A 3IJEA 3KPNB 2B1HH 3I02A 2BY2A 4XBPA 4IU3B 5HYFA 4GIPD 1CZ8L 4KJQD 3U46B 5B8CC 1IAMA 2RIKA 1IKOP 3NIFF 4M03A 2WLMA 4EE2A 1T2QL 2WYTA 4KHXH 2LGNA 1A3ZA 1GZQA 1A7NH 3FO9A 5AVWB 3IXTB 1QKZH 5TH2B 3FU0A 1ZA3A 4I89A 1DSFH 2N1KA 3BC9A 3G7TA 1CXFA 1FLRH 4XPAH 3PFUA 5IV2B 2TSAA 5D2LF 5KVFH 2X05A 2YKKA 2EDEA 2ZP9A 3CSYA 1HXKA 3E7JA 3M45A 3QUXA 4O02A 2OSWA 4KGLA 3ARBA 5E1HB 1IAII 4GPVA 3U7YL 3B2UC 1CU4L 1U8QA 1OM9A 4ANVA 4HU8A 5DO2C 5IG7A 1CYXA 2IMMA 3B7YA 3SB3A 1DHKA 4UV4H 4UV7H 2WQUA 1U8HA 3IE4A 2EDOA 4QHLA 4YGVA 3LVEA 4OUUA 5BZWA 4ONGH 1USZA 2Y5EA 4X6FB 2X2HA 4J12A 3IVKB 2AEWA 1HILA 1IBGH 4QXTB 1MCBA 1BBJA 2YSSB 4XVUD 1OAYL 4HUNB 1BREA 1E5CA 4L4VD 1RZ7H 3EUDA 4L8DB 5DZLA 4OLZL 1Q9OA 3CVHL 4ETQA 2YQGA 2DMKA 3ILPA 4M8QA 5AALA 2HVKB 4Z3HA 2HLAA 2UZPA 5C86A 1S9VA 3LIZH 1N70A 2F61A 3ULUH 2COVD 5K33A 5D70L 3C5ZC 4AYBA 3IGAA 3PXJA 4KJYA 5FECA 2Z31D 5C92A 1O7DE 1KDIA 1QABA 4ZQTA 4WF7A 4K3JH 2UY7B 1NFIA 1NWPA 1T7WA 1QYGL 1MWAB 2KQNA 3NN8B 4OZHB 3SODB 3WY4A 5EMYA 2NY2B 1NMCB 2E86A 4PJEF 1F45A 3MBEA 4HYTB 3WFHA 2CK2A 8PAZA 5KVDL 4NKMB 3WKYA 2KHAA 4G3YH 5I0XA 1GGYA 2YGPA 4G7VL 5ECJE 1FBIL 4HXBL 5GHWH 1D5ZA 1QSFA 2MCMA 4DP1X 1IKFL 3O3AB 2Z1KA 4YVNA 1KJVB 2NY7L 3K0YA 1EPFA 4U1NB 4FERA 4YBLC 3CK0L 1L9NA 3NFNB 3QRGH 4I88A 4DGYH 3SE9L 3TBCA 5E24E 2E9IA 1KIQB 3GXIA 2VL4A 3FU7A 4JM0A 2GJ6D 4TVPH 2VLKB 3AWEA 4PJBA 2WQAA 1RPKA 1ZIBA 2CH8A 3SDCD 2LU4A 3MCG1 4ELME 1IAKB 3WIHL 2VR4A 4Z76B 4S1DD 1DVFA 4BSVB 3FTXA 5HHOB 3O8XD 1WFNA 2Q8BL 1I1AD 3L95A 3RGVC 3LJ3A 5FDWA 1BIIB 2CM5A 2VIRA 1P2CA 3ARGB 3ARED 1NGWB 3SOBL 4M61A 1MWAL 5JHMA 5KEZA 1A66A 3CCHB 3QDMA 3X3FH 2IXQA 2BNRE 4XXWA 3DMMC 2PETA 4ZTOL 1AMXA 1FE8H 1KTLB 3P3YA 5BV7C 4ODWB 2XU9A 4WGWB 3GD1C 4WIQA 3T6WA 1FVDB 3II3A 3WE6A 2XDHA 1MCPH 1B4LA 3ETSA 1H8NA 3G04A 3UC0H 1PD1A 4RX4A 1TO5A 2WBXA 1YJDL 2AK4E 1RZ8A 3PP3H 3MLVL 3ALXA 1U8JB 4XNMA 2PP7A 4F58H 1J5IA 3KEHA 1EAJA 3B2MA 4WZ9A 4JN2B 2Y7NA 3U83A 3FF8A 1Q38A 2ZOLB 2UZYB 1VERA 2E7CA 4IMKA 1RFDH 2WO2B 1HH6A 2GTZB 3A21A 3WFBL 5F9JB 1KBGH 3F8UB 5J9PB 5CEXA 1WZKA 2WQ8A 4GP5B 2J2ZB 4N2FA 3CFKB 4G8FB 2P5EE 4FQIL 2HRGA 5ALCH 3CLEH 4UT9L 3BRDA 4ODSH 4GAJH 3UBFA 4BFFA 3O11A 4Y7OC 5F70A 4Z3JA 3KJ6L 2WXNA 1NA8A 2DLGA 2CO4A 4P2CG 4U4IA 5J11C 1FZMA 1OSYA 4B7IA 5D7SL 2WZPA 4GUPB 4FP8L 4XN5A 4W9GC 4PJIF 3MBWA 4MMYB 1TG8A 4EVNA 2GT9B 1I4FB 5HHVL 4X6EA 1N8ZB 3ULVE 4Q7DA 3FFOA 5F7KC 4OZFG 3EUUA 4N0FB 4XC1L 5ALBH 1SJEA 1NBYB 2EYRA 5JA8B 1PJ9A 4PJHA 2O61A 4NDMB 3GZOA 3HE6D 3ARYA 1FFTB 1B0RA 1X5GA 3MRHB 3E6FA 4A2FA 1I7TB 1ONQB 5DURB 1BAFL 3VCLB 3PV7A 1H6EA 4JANB 1KJ2A 4AVKA 1O6TA 2AMGA 3P4NB 3ZTNH 1SJMA 5T5FL 4KKNA 4B9FA 4CAGA 4JB9L 1E6OL 5TK2A 1R17A 5CINH 4AGQA 2W95A 2GTQA 3D87B 4LGSB 2W88A 1ODUA 3O6MH 4EUPB 5ADOH 3VXUA 4ZXBA 4JHBA 1E5UI 3B3BA 2FLRT 2P7TA 2EACA 3KYNA 4FQQB 4L4VB 1KB5H 3HKZA 1UOVA 3CXHK 3SCMC 4UT7L 4JRYA 2XWZA 4DCQB 3OXRB 1HCZA 3BKYL 3IEAA 4A2GA 5JHDD 2AQSA 3IKCB 2H32A 3O0RL 5LXGL 3OBAA 1YN6A 4KX8A 4FG0A 3UZEC 1HCFX 2VSDA 3FJTA 4NBYB 2E74C 2PABA 3H7LA 1AFVH 1HKFA 3Q8AA 5E00A 5AB9A 3MVSA 4WGVB 2QTVA 2CO6A 1BYOA 5FB8B 1QRNB 3SKOA 4TQHA 3MUGA 2JKNA 4Y19A 4K3DH 3GLZA 1TQUA 5E6IC 4WWKC 4YXLH 2FATL 5GSVA 3FB8A 2FECL 3HNSH 4E41D 4NKDA 1SQMA 3QNFA 1XB8A 3MOAH 4V33A 2X9XA 3O4OC 4HSQA 4N8CH 3H2WA 1N59A 2X4QA 4WUKH 3CDCA 3EGSB 1UJTA 1XH3B 1P84J 3KDPB 2NQ3A 4L29A 2LFGA 2GJ6B 5E5UB 4I8DA 2GSIB 2HX8A 5A1AA 4M43H 3FO2B 2V2WB 3EFFA 4XB3A 1RHFA 5I5JA 2I07B 4UINL 3SDCB 4ZAKB 5GGRA 3E8UL 1AIZA 4YEEA 2P52A 2PCPB 3C5ZA 1GMIA 3NYKA 3VI4F 1E4KC 1RHHA 3NJMA 3K74B 1FZKA 3O8XB 4X50A 4XP9L 2X89D 1X7QB 3AREB 2BW4A 1GGIH 5B1CA 4QOKA 3EO9L 4A7GA 3VWKB 5MEQB 1LDSA 2F58H 5D1QD 3P02A 2BFVL 4XCNB 5ES4B 3F7VB 1MAML 4UQEA 4U6VL 3VJ6A 2IH1A 3HZVB 1A2YB 4X4KA 1HFUA 3G6JF 3HOGA 2ZSVA 3BYYA 1C16A 2ZYHA 1LEIA 1FFPA 3BT2H 3U6XS 3O2WL 1A1NA 2V2XA 4N8UA 4BXSV 3OAWA 3QIUD 2P24B 3KXFE 4ZUWB 4HUUA 4YDZA 1M2VB 4X9FA 1JNHB 5EA0L 1E4HA 2X0VA 3NG5A 5MI0C 4LO9A 2JCCE 4UTCA 1H5BC 4I48B 3VSTA 3G6DH 2G9HB 5DJ6B 3ILDA 2G3ZA 3QHFH 4FYQA 1CTMA 1JDDA 5BVJB 2QPDB 1HT6A 3CWGA 2ADYA 1A7RH 2O6DA 4U7KA 2AJUH 2IG2H 1DLHA 2R1YA 3NP3A 4ANKA 4Z95L 4YHOL 4EQ3A 2NQCA 1CC3A 4LOVA 1S5IH 4MA1C 2V5YA 1MCDA 5EN2B 2AAVA 4JM2A 2JF1A 1EEQA 4IRZA 5FIEA 2W65B 1RZIB 3MOBL 2AK4D 1G4MA 4JFFD 4M9PA 4PRNA 2A6JA 1U95A 5ITBH 4I1RA 1Q9LA 2VXSL 3RVWC 5LBVA 4YFDB 5FWQA 1U93A 4TNGA 5EH1A 3N1FC 3U9WA 3IDMB 1EWHA 4WVRA 1PY9A 4XP6H 4JO4L 5BQ7A 4IRJD 5C97A 1Z1WA 2GY7B 3N55A 5T3ZD 2XPYA 3E9UA 4PUBH 1FYTB 1T80A 3SIKA 1KLUA 2Q0ZX 2IADB 4JG0L 4JQXC 1YEFL 5BV7H 3MREB 1J8SA 3RWDB 4N25A 3BPNB 1RVFL 4UYPA 1YAIA 2ADJA 2F53E 5E0FA 1ZV5A 3ZTCC 3NA9L 4IRZH 1XGRA 2DBJA 2HRHA 3J27A 4PGCA 2FRGP 3TBYA 1NCCL 3MV8E 2ZX9A 1JF6A 3DSNA 3HI6H 3S3BB 2MCPL 3VMNA 1TQVA 1MPAL 4MD4B 2VLME 1BOYA 1D9KA 5FUOL 5JXEA 2BSSA 3BGFC 1JUFA 5CZKA 4F8LA 2CUIA 1HHIA 3IGKA 3ULVD 4FYRA 1RK7A 2A77H 2YD0A 2OMTA 3T0AA 4I3SL 2XV0A 4LSTL 3V0JA 5KSBA 4ORGB 4OI7A 2R2EA 3NEXA 3QJRB 5J8OA 1KYUA 2YKLH 2UWEF 4ODBD 1YY8A 4ZX6A 5LCVH 2BVTA 4HJIA 5FFLA 5DEJA 4DPRA 5DD0L 1NL0H 3QORC 3A47A 4ZS7L 2ZAGA 1MJ8H 4M29A 1G94A 1QP1A 1X5LA 2RCSH 5HGHB 1AHWA 3WN5B 1NSNL 1KUMA 1ZWIA 4Z7UE 5CU9A 1Y1UA 5I30H 4RGMB 1CB4A 4ZMAT 3U2IA 5I71B 1O7VA 3B9EA 3ARDB 1QMUA 3OKEA 2KLTA 3NBNA 3GS7A 1ZHLB 3SKNA 2UXFA 2L7JA 2VDOH 4FHJA 2G4GA 2OP4H 2UX6A 4RMTA 5FYJE 3WNPA 3NJGA 1J1PL 1BG1A 2Y7MA 5AD0B 3CX5K 1F8TH 3H0TA 1A6ZB 1PZ5B 3OF6A 2DD8L 3OKLA 1BW8A 4QXGH 1YPZA 3DX4A 5J12C 1NC4D 3OWRA 2VDQH 4J3WA 3S98A 1E28A 2AV7A 3BWZA 1ACXA 4JDTH 5DZOA 5CMAA 2ADFL 3KM2A 3DV6A 3FUHA 2E6JA 5DJYB 2ZE0A 4LCYB 5AW1B 1NGYB 1NFKA 4XNBA 4Z78A 4NM4H 1OB1B 1OHZA 2CRZA 4OFIA 1L9QA 1G7LA 1MEXL 2ZONA 1AANA 1CVSC 4KOBA 4ENEC 5B7FA 1FVCA 2G2RA 1W72B 1PVHA 5F7WC 3PY9A 3QR2A 5EZOH 4JJHA 4ELMB 2YAFA 5DRNA 1YQVH 2FJGA 3S35H 2Y06L 4OV5A 1TZOA 3QA3A 1E4KA 4QKXB 2J21A 4AH2B 3IDUA 1DQDL 3DBXB 1G9NC 4X4XA 5D7HA 4NZ8A 5CFAA 2BNRB 3WEMA 2EIZA 3MRQB 4YX2H 3K6NA 2GJRA 3QQXA 4X5LA 3IDYC 1TJGH 4MJHA 4ZPVB 1QPPA 2H6PA 3UBXA 1C5BL 4XNZB 4UNVA 4UTAL 2XZQL 5FM4A 1NC2A 3CVCA 3NCJL 5F1OB 1YEGL 4XBEH 5IEHB 1W72L 2AK4B 2LT9A 5DJCB 3FRUA 3BJLA 4B27A 5IVXE 4TNVF 4EN2A 1EZVY 2EO7A 1YMME 1NCAL 3KGRA 4ZRGA 4X6CE 1LK2A 3IMTA 3IYLW 2FQFA 4H88H 4LVHB 4K73A 4PCYA 4PB9H 4D9LL 1H5BA 5F96L 5TFSL 3CN2A 1Z9OA 5ITFB 1RH8A 1UOKA 3EH3B 3OD3A 1HIMH 2BP8A 3Q05A 3T5WA 3GMNA 2X4OA 3AS2A 2P5EB 2Y07L 3HR6A 3VGDA 4XNUH 4FTVA 3FT0A 1KGCD 1QSVA 2FJSA 3X14A 3GMLA 2OJ1A 3MRCA 4MTMA 3DXAA 1SEQH 4P5MA 4BRJA 5L7XL 1S3RA 5DUPH 3P4LA 1MF2H 3APNA 2QEJA 1CVRA 1X9LA 3UZQA 3SY0A 2YPVL 3G5VB 2X42A 4G6AD 5BOZG 5JIHA 1K6QH 3GBLA 3MUZ1 3H1ZA 4XP5H 3OMZA 3UTSA 2LLLA 1HQRA 3D8MA 3ZZ1A 2XY2A 1M05A 4FFYL 4QHUB 2ZUTA 2ZF8A 2UX7A 2V7NA 3WUWA 1NMAH 1VFBB 1IAIH 1AGDA 1TDQA 2Z31C 5JOEA 1G7IA 4UOW0 1HHKB 5LG1A 4X5WA 5ACMA 3JWNC 4OZIE 1JVLA 1TQCB 4TQIA 2QKIB 2WQRA 1DDTA 3FSAA 3IB4A 4FQHB 5IMMB 4HK3N 5FW7A 2ZYRA 1P4LB 1XR8A 2C3XA 2IAMC 4JVWA 4B9GA 1I8MA 4DUVA 3MV8D 5I66A 5LDSA 3MKGA 5EPMB 1QLEB 4LFHG 3R0MA 3T2NL 3EADA 2R29A 2F74B 2X2IA 3B2VH 4AIZA 3R8QA 1PG7L 4D0DB 2MHAA 4KZ0A 4Y2DA 1A6AA 2PLTA 1U58B 4XN9A 3L3IA 1ULVA 1AKJA 4NI3A 3ULVL 4P59H 3QAZB 4Q58C 5DT1H 3RB5A 5IKCA 4PJCF 1MJUH 3GZPA 4OW6A 4WDIA 3QCUL 4S1DC 3JV5A 4GXVL 2I9LB 2CA4A 4M93B 4BFNA 1I1AC 3PXLA 3D39E 3LRHA 1A6UH 5LGHH 3M1BA 4X4YB 1A3LH 2UXGA 1FO0A 5I17B 4N3UA 3U0TA 2Z91B 1BFTA 4OJFH 4NNXB 1PNDA 3TNMB 3TN0A 1A7OL 5E6ZA 1NC4B 2CDFA 5L4MA 5E70A 4X9YA 4UMGA 2BNUB 3W81A 2YXVA 3QIWD 4JRFA 5IQMA 1H0DB 1QLEL 2ZF9A 4PTTA 2EUXA 3AAZB 4TQPA 2GHWB 2PO6B 3VRIA 4U6YB 5ICXA 4N2IA 1TUPA 3Q8FA 3PG2A 4OM0H 2JJUA 3BQUD 2X9YA 4XC3L 5LWYL 3EBAA 1BAWA 1QAWA 5FYJD 2O93L 3EO1B 2BK8A 4ONHA 3VU1A 3GSUB 3H55A 3QQ4B 3VD9A 4LNRB 4NHUB 1L9RA 3U4EA 1S6NA 2BS8A 4FFTA 2C4XA 1BEXA 1UZGA 3GLEA 3DX7A 3TBVB 4CN4A 4Y1SA 3AXIA 4ZMYA 43CAB 2BNQE 1T1ZA 4FD0A 1UOLA 3S34L 4MNGE 1AO7A 1WAEA 1WHOA 1S7TA 1X44A 3MLZL 4FFZH 1Q94A 1I9RL 4MNQE 5I24A 4OJEH 4GKNB 1WFOA 3BX7C 2CJ3A 3ZR5A 5ID1A 2KERA 1YNLL 2X4TA 3MTRA 1XL4A 3QWNA 1UCBL 2PWDA 4OF6A 3OC5A 1WYJA 4W6XB 4YUEL 4NERA 1S3KH 1QQDA 5C0DA 3ME0A 3C8KA 4XN1A 4W6WB 4PJXE 2V8MA 2L0DA 2CWRA 1XSKA 5JUEH 3KXFB 2JTYA 1G1CA 4D0BB 1I3GL 3NFSL 4JKLA 4MAUL 5KTEL 2UZIL 4G80B 4ILDA 1O9VA 3HE6C 3G08A 5HHMD 2YIHA 3RDTA 1BXUA 3IFPA 2JCCB 1NDGB 4PYGA 3VFNB 1XAUA 5E51A 1QSEE 4JFZH 4ZFGL 1QFUL 1WTGT 3NSFA 5SWZA 4HD9A 5AVVB 2YEVB 1DE4B 4TOYL 2OMXB 2P42B 1R0AH 1KB9J 1BZ9A 2BOBA 5F89A 4YE4L 1P7QA 1NM9A 1RIHL 4G8GD 1SDDB 4WSGA 1SDYA 3LTVA 3FFCA 1P5VA 4OJYA 1OT4A 1Q8MA 4U1IA 5BQDA 2BRRL 2VISA 3SD5A 4AXWA 1UJ3B 3IU4H 1R3HB 4XVSH 3I6KB 2X53A 4RFOL 2MCAA 3REWB 5FYJU 2B1AH 3CPUA 3NIFE 4FQ1H 1NINA 3L1EA 1OAZH 5A6MA 5DR5L 2CPCA 4NLHA 3MJWA 1ICTA 2EEXA 3N1PC 3VD7A 4FI6A 3LN5B 3DETC 1OP4A 2VRKA 4GG8A 1CD1A 4E0RA 4ISVA 3O6KH 3BPCB 3KBPA 3O2DA 2F53B 2IALB 5D2LE 5DXWA 3UADA 1INQA 1AACA 1VPOL 3GINA 2E7HA 2NR6D 1A7QL 3LZOA 3MV8B 4I3RH 1RJZB 3UAJC 2QJDA 1JE6A 5C0IB 1SN0A 1FORH 4JKNA 2WC7A 1J1XH 5HDLA 1E8ZA 3OJMB 1NEZA 4GRLA 3ZJAA 5ABDE 1F6AB 5EV7A 1RUMH 4F57H 2D3VA 2OSLB 3LEYH 4ODTL 4DP6X 4I1PA 1WCBA 4UMSA 5FV2A 2PW1B 2Q3XA 3BO8A 5E2TL 3T8XA 3CE1A 5FO9A 15C8L 1OCRB 2YAPA 4F80A 3NCXA 3V9FA 1G9HA 2YBRA 3HRZB 5AB2A 4U1SA 3NAAH 2NYYC 3G9VA 3HVDA 5GISL 1KXTA 3BDXA 3ELQA 1OZUA 3V0FA 3WEAA 3Q6FB 4N8VB 4AT6B 1CG9A 2P8MB 3MJ9A 1LMIA 4U6TA 5ID0A 5IHUL 2CO3A 2WM0A 4QLWA 3BWAB 1WE5A 2IAMA 3I3BA 5D1QC 4XPTH 5IFHH 2ZD0A 5DRZA 3PWUA 1HQ4A 5D6DC 3CJJA 4Z7UB 1JPGA 3WMQA 1HWWA 5BZXA 4W9DC 1H3PL 2UYLA 5A40E 1BJ1J 3GBMH 4YNYA 1WAAA 4X99A 1HS6A 3CU1A 2EIBA 3BQUB 4K5MA 3QIUC 1YN7B 5D5MA 3MLYL 5LGJA 1SUJA 2MNJB 3JWNH 4JG1H 3SE6A 3UGEA 2WHVA 5FYKE 4M5YH 3D39D 3PREA 2A6DA 4DTGL 4X0KB 4EDXA 4V1DA 2OJZL 4N0YH 4Y4KD 3ZK0A 1MI5D 1T83A 4OGZA 4UM9B 3GWJA 5ANHA 5AVSB 2AQRA 5FGCE 4QLRA 1DQJB 3RDJA 2O6FA 2E0PA 1YEHH 5DJZA 1ZOXA 1BJ8A 5E9DE 3S4SG 1LO3L 2M83A 5EO1A 4RFEB 3QZOA 1YUHB 3TO2B 4TL5A 1K4DA 3QJFA 4PS4L 4XHJC 3BVDB 3TV8A 3OL2A 5E1GA 4Z7VA 1IL1B 3G5ZB 4KITB 3B1UA 2F7PA 1U3HD 5I76A 2Q76B 3BT0A 4AUUA 3F7YB 4P5KB 3V7AE 1KBBA 3BUPA 3I50L 5FYJL 1WRFA 5GIRA 4IU2B 5DFVC 4LAQH 2LLGA 1RU9H 3LRLA 3FB5B 4IRJC 4LHQB 4EBQL 2BY0A 4W9KC 1JGEB 1CF8L 4MHHI 4YS4A 1PJWA 5HHMB 4HZ1A 4RRPM 5I1AB 3RWHB 2EDRA 4AYFB 4HJTA 2CIIA 1J0HA 2G60H 5TJWK 4IIQB 2VZTA 2EDBA 5DJ8A 1BFSA 5KYUA 1UA6L 2RFXA 3UH8A 1P6FA 5K1JA 4I4WA 4MQSB 1EFXD 1H8LA 3FHQA 5BPPA 1AGEB 2E3VA 1KACB 1JDCA 1FNEA 2Z65C 1B6UA 4WHCA 2WXQA 5GRWA 5L9DL 4Y1AA 5KN5A 3Q44A 4NZUL 4KNTA 2N0MA 3DX0A 4M6NL 1EHKB 1E3ZA 1L0PA 1BEYH 2ZWSA 1E30A 4ZT1A 3WO3B 1KCUH 1UH4A 3NA4A 3SD2A 1E4WL 1ML0A 5IVXB 1IO4C 2YS4A 5HGBA 4PI0A 1YMMB 2IQ9H 3HN3A 3K6DA 1UACL 4RWHA 4MX7A 4WK4B 1CLOH 4R97B 4X6CB 5H94B 5F7BA 3KJ4B 1QSED 1TYRA 2VDMH 5CCKL 4PJIE 3JT0A 1BZDA 1PX3A 1G6RL 4ZUSB 3VFRB 4AZUA 3GXTA 4OZ4A 1BVKA 4R2GD 2YJQA 4IQHA 4FOMA 4CSSA 2P5WA 3VD2A 4ONOA 1OF2B 1KG0B 2DQGH 2RB8A 2CDGA 3K46A 4I5BB 4JDZA 5EBMA 3RZWA 2NRDA 1E9PA 3TYGH 5C09A 3VGAC 4M5SA 4U7SA 4QJ3B 3WTSA 1NFDA 2J5LC 4R83A 1I8IB 2KZKA 2FWUA 2DQHL 3V9EA 3RPIA 3DKHA 5ANMA 3GMPA 4JHWL 5C3TA 4Z7QF 5C6TL 5J06A 5FDWB 2VH5H 4DGVH 4H0HB 1TLMA 2VYRE 4NRYB 5D7LA 1NBQA 3OB0H 4XO5A 1WUZA 3T77A 1J0ZA 1FZOB 1SXCA 7FABL 3DTDA 4XMPL 1THCA 2EICA 5JPMA 2XC8A 1R24B 2V7HB 4OZIB 1NFAA 3INUL 3MJ8B 3FTVA 4AMKH 4YK4C 2H3XC 1T0PB 1KXVA 3OHMB 1KCRH 3UAJA 1UB6B 3UTTA 5E08H 2GIXA 4JCWA 3FB7B 4L4JA 1TFPA 1WD8A 3IDXL 3QIBD 4JRXE 1FFRA 4YHML 3MR9B 4GUQA 3ZU8A 4LASL 3DOIA 2NDGA 4WFHE 4OFPA 4NJAH 2R7EA 4J2QA 1U8PA 4CMMB 4P9HH 3X17A 4HU2A 5I74C 1A6WH 2EYSB 4PI2A 4QRRE 3POCA 2PPDA 4WHYH 3RWJB 5DYOA 3FTGA 3MGAA 5AZEH 3SYQA 2N1TE 4NSKA 4DH2A 4GO8A 5D2NC 5FM5O 3OC8A 4U3CA 2JKLA 1GHFL 3D39B 3NEEA 1T0NA 3WFEL 2X4NA 3K5RA 3EYVA 4YIQA 1FSKC 5FK9B 3LD8C 4GI8A 1C5CH 4RBPK 1S9KC 1MREH 1G0XA 3CX2A 4YVUA 1I1FB 1NBVH 1CGXA 4LBEB 2VN5A 1UASA 3AT0A 2MKWA 4I0PD 5LGKA 2HJKA 2XWTA 3CC1A 4M6OH 3MKKA 3AY2A 4JDEB 3RX8A 2Z92A 3VI4E 5CHNA 3PCYA 2D8KA 1E5AA 5DMYA 3LXCA 3HS8A 5DMIL 3PJSB 3VFPA 3KLDA 4ZNCD 4JHAL 1ZA6B 3P2DA 3WHE0 4MQXD 5DJXA 5KJRL 1S7WB 3Q7JA 3GMMB 1ED3A 4PGEA 3FSOA 1F97A 2ENSA 2MNUA 5FYKD 3O3DA 1PCXA 3OPZH 4MMZC 4TV3A 4EDWL 5J6GB 2HVJA 3G6JE 2XQBL 3VFGH 4KAQL 4R4BA 5C0AE 4FLOA 2K78A 3GPEA 1VRSA 2M2DA 4CSTA 2BNQB 2EYTA 2QGEA 3FN9A 2VDPH 3MRKA 4UB0H 4ATTA 3IPFA 1EFXB 4WKZA 3ARFB 2OV0A 3S8WA 4MNGB 1JYXA 2PR4H 3V6FB 3N43B 1HK6A 3T9WA 4MNQB 2ICEC 1UVQA 3GPSA 3GB7A 4MMXB 2VGLM 3AS0A 1ZT7A 5DMKB 1JPST 2DWSA 4PJXB 2CKBB 3TO4D 4TUJA 4NNPL 4EO5A 4ZOCA 4N24A 2HJFB 1AE6L 2W60B 4GQ9H 4N2HA 1CYGA 2QPSA 4HJJH 5CP3A 4NO2A 2X4RA 4JPWH 2SEBA 4APQC 5E8OA 1C12A 2HKAA 3Q0HA 1QSEB 1FA4A 3CFEB 2ZOTA 4CMHC 3W0WE 4I9WE 5C0GA 4LCCB 2OMYB 2WVSA 4YPGA 3WG7B 1RXLA 2EDTA 1TQBB 3ECVA 3DVGA 2VLJA 1NAKH 3IS1X 5LGYA 3ORJA 4KXZI 4P2QD 4FI8A 4M4PA 3M8OH 3OKDA 1TZHB 5BO1L 1H15A 4G9FA 1GPOL 2X40A 4CVZA 1AMYA 4OLWL 3N9GL 4NFBA 4AMXA 5HY9A 3F04A 1NLBH 1IFHH 4P2OB 3IBEA 2APBA 1ZTXE 2CKBL 4L23A 5T3ZH 3RVUD 4BINA 5IBLD 3V4PA 2BWQA 3FYEB 3HUJF 4H40A 2NNAB 4NNYB 3NIFB 2E9GA 3O4LA 4UT6L 4A2DA 1XGTB 2AF2A 4M6MH 2H1PL 2DJ4A 2E56A 4KMLB 3O3EA 3VGEA 1ZE3C 4XHQA 4Y4HB 3VQMA 1M7IB 3OJVC 5D2LB 5CD3A 5IHZB 5I2IB 3TH3T 4LEXH 3O3BB 5D1XE 4L05A 4OCYL 2AXFA 3QIWC 3BUYA 4TQEH 3STZB 3MV7D 3V55A 4ES9A 1CURA 1KTKE 2FHCA 2XQYK 1GYVA 2NZ9D 1M7DA 4MKTA 4OJAA 3QIBB 4IJTA 4AI7A 4HMDA 2OAAA 2L4OA 1VFUA 2C7UB 3AMKA 3BAWA 3ML8A 5JZ7D 2YMXL 4YSRA 1HZHH 4NQEE 1DBML 2BRQA 1PKQE 3TL5A 3FSWA 1JHTB 5DJ0A 3MBXH 1JWUB 1KC5H 3NPSB 3O9WB 1E27A 4HKXA 2Y2YA 3PGCB 1ETJA 2DQTL 3PYCA 3KE0A 1L7TH 3MRDA 4E42A 2NW2A 3KGTA 4JHZA 4MQ7A 1O6SB 1OARL 2OSYA 4M8UA 1U42A 5EOTB 4UZUA 1EO7A 4CDGC 1U9KA 4YHNB 3V0AC 5CGBA 1HVXA 1FV1A 4I0PB 2FH8A 4NPJA 3ETTA 4J8QA 4JRXD 5LAXB 4B97A 1FZJB 5CLTA 2CZNA 1DQMH 1WP6A 3KPMB 4PJEB 1NCDH 3KW7A 3SE3C 2FBRA 1USQA 2RBLA 3DX3A 3L17A 3SBRA 3VXMD 1KPRA 4PFEA 2XTJC 5DC4B 1TU2A 5CEYB 3L9EA 3BW9A 3NTCH 1CS6A 2MTAA 4JFYA 3QFJE 5KBMA 2CM6A 2D4DA 2XX0A 3TU6A 3CHQA 5FGCB 4OFYA 3VDAA 1DN0B 1JWMB 4XCFH 3L2MA 1OCWL 2VR9A 4JQIA 5E9DB 4XMKH 4JFDE 4XAKE 4XO9A 5IB2B 4CVXB 5ICUA 2FSDA 1HX0A 3I6SA 2X0UA 2GVYA 1JXDA 1UYWL 3IRZA 1I8AA 4G11A 2K4WA 3VD4A 3B34A 3THMH 2N56A 4JFOB 2C3WA 5HJ3B 1IGMH 2CO7A 2Y6SD 4FN0A 5DD6B 3IKKA 4WO4A 1MW1A 3FK3A 3TFKD 2R2HB 1U21A 3HAEB 3L81A 4IHOA 1RP8A 3NCYS 1D5RA 3US1A 2AJYL 3K71A 4GBXD 3MU3A 1AQDB 3QJHB 1C1EL 1ZIAA 2F7QA 2PKDA 3L3KA 3PXHA 1JV2A 3CH8A 3U1PA 4RSVA 1R3KB 2H3NB 4YDVB 1SYSA 4BHUI 3KBEA 5DEFB 5FA3B 1TTRA 4Y89A 1UM4L 3ZO9A 3L2NA 3JVFC 4HSAC 5INCA 2X5PA 1BAGA 2NR6C 4X4MA 3D52A 2YZ1A 2WPGA 1A6VL 2Z3FA 2X6UA 1VACB 4W9EC 3F5WB 5CSZB 1ZHBB 2RALA 2BCMA 1QA9B 2OI9B 1WK0A 2D7PA 2AXWA 3RFRA 4BK4A 3DK0A 4N26A 1JZJA 5FLUA 5BMFH 1TEGA 1KJMA 2Z9TA 4O2CB 4YPJA 1CTOA 4APQA 3ZHDA 3EGDB 4J3OG 1HNYA 4GUCA 4I18C 2D7TH 4PJIB 3W0WD 5JR1L 4CSPA 2ZCKH 2AFNA 1OSZB 1UWGH 4MJ5A 4PRIA 5I1CH 1FAIH 1J0KA 3N85L 4U6HA 1QR4A 4Y1TA 1J87A 3EG9B 3VH8B 4WFEE 1K3IA 4MB3A 4P9MH 4PQXA 1QVOA 2DQMA 2DKUA 2R0WH 3RI5K 3KLAB 3VX1A 1OP5H 2BVQA 4M4RB 3CFBA 1ZANL 1MFDH 3TVMB 1BWWA 1Z3GL 3EO0B 3LHPH 3EBGA 1J8HE 5HHXL 5ISZE 3KPSE 3C2AL 3KM1A 5HDRA 3DUSB 4KDTA 4MCMA 5TK4A 5CBEB 4IBZA 4Y4KC 2CAKA 1YO4A 3DHUA 1NCBL 1KT2A 2JKXA 2BIMA 3EJRA 1J48A 2MOGA 1N6UA 3FH5A 1AZNA 2OL3B 1HHHA 4LU5H 4PGBA 4PJCE 3QK0A 4J6RH 4PJGF 4YHLH 5D1XD 5DWUH 3RE0A 3RNKA 1EZUA 4GKSA 2D3LA 3QO0B 1F2XK 1CICC 5EIIB 1OALA 4JRXB 4QD2E 3KPOA 3MYJB 4E36A 1U3HC 4JR9L 4QXWA 5F8RC 5A16B 4D8PA 4NQED 4BGDA 4N1HB 1JK8A 4WI4A 4JZJB 2IQAB 3H4FA 3P73B 4QRRB 2J5WA 3Q5TA 2HFGL 4NCC2 3QQDA 2E9BA 1I53A 2PPFA 5DVPA 5HYSB 3FQUA 1ZSHA 3TCXA 5JO5A 1CPUA 5DVKA 4BQ8A 2YUXA 3L3HA 4Q6KA 4KX9A 4TQ8A 4WTWA 1OTSC 3S5LB 4K94H 3H54A 1CFNA 4L48A 4F7EA 4ZD3H 4JO2H 2DKSA 2C7FA 4ECNA 1AG6A 2OL3L 1AS6A 1ZAGA 3DVIA 4XXCC 3UYOD 3Q13A 1ZMYA 1Q0XL 1TKWB 4LL1A 5HVFB 1DJIA 2MRYA 3VI4B 2G3XA 2GITA 1IC0A 2QMKA 5GSRB 4OF3A 3W9DB 4V11A 1SBBA 1EDQA 1KF9B 3MA7B 1XCQB 4M62H 3BZ4B 1KCLA 4FLHA 5IJDC 4N0UA 3PL6A 3RZCA 4R7DB 2DLFL 3L3OC 1AYOA 1WIPA 1CQKA 4JFPA 1NIFA 2IPUK 3P1VA 4JM4L 3G6JB 3LXBA 1XT5A 2OKMA 4GBXB 1I7UB 5C0AB 2HRPL 3FU9A 3WLBA 5K9QI 4HC1L 4R8WL 4ZTEA 3D0AA 1NWOA 1IAIM 4GW1A 4L4TA 4XVTL 4NO0B 1RZPA 4JFDD 4XAKD 1IFRA 2F8VA 3FQYA 4R2GC 2BP3A 1DFBL 2BVOB 4OCXL 1DBJH 2XN9E 2CLVA 5T1KA 1BFVL 3NCBB 1X7TA 3TPKA 4D8PB 3E2HC 1U8MB 5I5IA 4HV8B 1UC6A 1WBZB 2FVNA 1HL4A 2K70A 3MCLH 4RMBA 5D8JL 1IJNA 1G9MC 3MRRA 3BH9B 4K8RL 1MCNA 4ZW7A 4G8EB 4J4PC 1UKSA 3CPLB 4Y4FC 5CKAA 1G43A 5GRZA 2X7LA 2BIIA 3Q3GB 5FOBA 2ESVD 2WXFA 2DV6A 2YA0A 3AFLA 5CAYB 1YNTF 2TRHA 1OE2A 3D9AL 2PYEE 1EUTA 3W0WB 1OLLA 2DQFA 1X5KA 5SV4A 3ULAB 2DTML 2OXHA 4KI5F 1N64L 4E2OA 1J86A 1QNZH 1GY2A 4OFDA 5DA4A 5D72L 1AH1A 2YHGA 3CZEA 4X98A 1L5GA 1CFVL 4KRLB 2JKJA 4TSBL 4LK4A 2H4EA 1ZT1A 3MV11 5KS9F 4UQDA 1KEML 1R3JA 3HBQA 3RHWF 1GSKA 1UADC 4M5ZL 5E03A 4ZTPL 5G5DB 2VXQA 1FHNA 2QV4A 3CVIH 5KJ7E 3LKQB 3CBJB 4WI8A 3KR3H 4RMRA 5CUSH 1JD9A 3TNNA 2WXHA 4NGHL 1QO3B 1T66D 1XF2A 5E8PB 1G7HA 2WCSA 3C60B 1PLCA 4GKZB 3S88L 3GSQA 1CGUA 5DD3L 1FC1A 1BD2E 1SHSA 5JIPA 1Z5LB 3VXTA 5CILL 4UBDC 2WWNA 5D1XB 3FCGA 4NUJA 2PWEA 1PYWA 2EILB 1MCIA 4L8CA 1PCSA 1YYLH 2FECI 1JZ3A 3S8FB 4LKCB 3QSKB 4L8SC 1SOSA 1HSAB 3CXHJ 3CDFA 3WTVA 1JZ5A 3L6FB 4OTXL 4DQOL 5KBDA 1P7HL 3LQAL 1OAUL 1ZTXL 3KVPA 3QEUA 1J8HD 3BQVA 2ZG2A 1IBBA 3ARRA 3KPSD 4NQEB 3NH7L 3GIVA 3U2SA 5ISZD 1PKQB 1A6TB 2C9QA 3K5SA 2Y7QB 4JMXA 2VN7A 1A3RH 5DS8B 5K39A 1F3DH 3U30B 2YJLA 4UQ2B 4DFHA 2FGWH 4YJZL 3HR5B 4QRSB 1HAWA 1MHPL 3RIFF 3CUPB 4K7PX 4PS8A 5FF6A 3LRKA 1FNSH 3CDYA 1RUAH 4YHPB 2AVFA 4MD0B 3QNYB 2AK1H 3S37H 2JI2A 2O5YL 1BJMA 2Y5TA 3GBNH 1R1CA 1D6EB 3PP4H 1MCCA 1TPXC 1DQIA 1CICA 1DBAH 1LDPL 4L3EE 5AVXB 3V52H 1VGEL 1OWWA 3CH1B 5EFIA 3GHEL 4JY5L 1V7NH 2DYPD 1CLZL 3V6OC 2MPVA 4M7ZB 3TO4C 2FBJL 5BS0A 3N41B 3C8DA 1IQDB 5KANG 4KV5E 3D3VE 2VTFA 4NC2B 3D25B 1R5VA 5AOIA 5EF1A 2PN5A 2CIKA 2Y7LA 3QFJB 1QFWL 1QRKA 4B60A 1YA5A 3QVAA 3RKDD 5AB1A 1B4JL 1N67A 4JKPH 4ESKA 2C4FT 5D7IF 2EIMB 2EECA 2X28A 4DP9X 1E4JA 2FWOB 3BDYL 3FOMA 3BSZH 5IB3B 1NMBH 1T0MA 4JFDB 4PR5B 2VMEA 4AENB 4ZYKB 5PAZA 3VG0L 1EXUB