2A99A

Crystal structure of recombinant chicken sulfite oxidase at resting state
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into sulfite oxidase deficiency
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords Sulfite Oxidase
total genus 88
structure length 372
sequence length 372
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2005-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2a99A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2a99A01
2BPBA 2CA3A 1XDQA 3R18A 3HBPA 2A9BA 2A9CA 3HC2A 2BIHA 2BIIA 3HBQA 3HBGA 2C9XA 2XTSA 4PW3A 3R19A 2A9DA 2A99A 2A9AA 2CA4A 2BLFA 4PW9A 1XDYA 1SOXA 1OGPA
chains in the Genus database with same CATH superfamily
1N5YL 1OTSC 1RJLA 3QIBA 1WH0A 3NCWA 3IDMA 1HHJB 3HZ3A 5KW9L 2E86A 2IDTA 5CBAB 4NNXB 5IBLD 5HYJD 5FHAH 2ICWJ 3ILQC 2WKLA 1JWSB 2GITB 3QGVA 8FABA 5IHZA 3HZYA 3K72B 3LS5L 5FOBA 5BS0E 3T6QC 1MG2C 4YDVB 1MVUA 3C8DA 4ZMVA 1IARB 3EYQC 1YO4A 4PJFB 4PEEA 1LDPH 4F9LA 5FDYA 5IR1B 3U0WH 2P80A 1WSST 5HYQA 3CAFA 3LZOA 4E41A 3B34A 1MIML 3TYFB 4R3SB 1BGXL 1KPUA 2R8SH 1GJUA 1T5XB 2XA8H 4Y9FA 1ZT1A 1FZJA 1JK8B 3MV9D 5CWSB 5AWNL 3DGCR 2DJUA 2P42B 2CPUA 4ZPVA 1YSOA 1MXDA 3PIQA 4QJ3B 1P4IH 3N2JA 3P9WB 2ODIA 4NLHA 4G80B 3MA7B 3W11D 1YEHH 4LCVA 3DUSB 2YLKA 3D33A 1CI3M 3OKOB 4HXAL 1S7UB 4MQ7B 4EI5A 3D4CA 4PW3A 1I9RH 5F1NA 1TPXC 2RGSA 3B9KD 5IROD 5DUPH 2X1OA 3OPZH 1GYAA 1N68A 1OAQL 3ZMNA 4HUXB 2QSQA 3UZVB 1P1ZB 4HH9A 1Q0EA 5HHPB 5DO2C 3VD4A 1N59B 1KLUA 5D7LB 4LVOB 1R9FA 3TGXA 3VXOA 1FIGH 4XPTL 5E5MB 4KPHL 4E9WA 2WQ8A 2VXTH 1H8SA 1I9IL 4LNVA 1F90L 2HYMA 4X7CC 3V4VH 3V6OC 1LM8V 3GRGA 3GXTA 4L8SB 3SBRA 4AYMC 2O5XH 3PWLA 4MB5A 3RFRA 2X42A 3GRWH 3LRSA 5JOFB 2A73A 3BMVA 1MFCL 1MCFA 2A83B 2VDMH 3BPOB 3IGAB 3QFJD 1A7RL 4IRZH 4RRPA 3D3VA 3CHXA 1UYWL 2WGXA 1ZA3A 4Z7UE 1SMDA 3LZQA 4JO4H 1R0AH 2XZCH 1PDKA 2F1BA 4PJ6A 4ELMB 4JMNA 4A04A 1T0OA 1LO3L 4FX5A 3FFCA 1CLZL 3EBIA 3MRMA 3WFCL 2GUYA 1MG3C 3TVMD 4ZS6C 2B5IB 1U95A 4KKPA 2R56H 2G75B 2WAQA 2NY5H 3WTUA 5GRYA 1JNLH 1M2VA 1NMBH 2R69H 5C2UB 3BT2L 4QRRD 3FFOA 3PV6B 4E36A 4HLEA 4MXQC 1NCIA 1E40A 4PJ8A 1T4KA 1UHVA 3FUEA 4PWJA 2B7DT 2C3VA 3QXDB 4F2MA 3MV8D 4X6DB 4L3EB 4LKCB 3BKYH 2YFOA 4N2GA 4BK5C 4J3XA 5CILH 2P5EA 5I1DB 1B9ZA 3KPSB 3FN0L 1OCCB 5EZOH 4UILL 4WWNA 3UYRL 4LLWB 5FM5M 2YXFA 4PJEA 3U0TA 1KMGA 5DZAA 1XGTB 1JN6A 1QBLL 1W8EA 4ABQA 3K6FA 4F57L 1QHPA 2ZWYA 4HIEB 4JL1A 4KVPA 3VWKB 3OC5A 1OF0A 2WQWA 3WGVB 1A7NH 1XGZA 5IFAL 1XGPB 2OMUB 2VITB 3HB3C 3OKEA 5B39A 5GGUA 1E50A 4WENB 4U6XA 3MJ7A 3FF7A 1WIPA 1ECYA 1ZWIB 2H1PL 3JWNG 4KUZH 4P3CL 3THMH 4D8OA 3BWAB 3UBHA 5BXFA 4FQHA 4NQXA 3B9KB 4EN3D 4G9FD 2XBTA 4QNPF 4DAGL 4G1MB 2NMSA 3MACL 3PL6C 3QJTB 4MZ2A 3ROOB 5GJSH 5D96B 2V37A 5I66A 4PJFF 2XZAH 3I6GB 35C8L 3W3BA 4A7GA 2A9AA 3H0TA 3PGFL 4NZUH 4XODA 1CXIA 3D0LB 5I6OA 3C5SB 4MA8H 4A39A 3NSXA 4CU6A 5T8IA 3GHEL 4GT7A 2VABA 3QHFL 4Y88A 1S7SA 4LE8A 1TJIH 3FOLA 3QRFM 5EEUA 2OSXA 4NQTA 4PS3A 4I2XB 3QDMA 1RUMH 1HKLL 5C0FA 1GGIL 1HAWA 2DQGH 3UAEA 1P0SE 3BDBA 1TTAA 2AJ3A 4IBZA 3CX2A 3WL9B 4XC3H 2BH0A 1N4XL 4HG4K 1TTFA 4DETA 3UZQA 1SN0A 4UU9A 2FT8A 1HKFA 4EUPB 3GUTA 4BFRA 4GI8A 5EZIH 4B9YA 4PJCB 3TJEL 3RY6A 5I17A 4JQVC 4OCRH 2PABA 1TMQA 5JPMA 1W72H 3FQXA 4JGNA 2IO5A 3OHMB 2E27L 1KV7A 1UD8A 3L5HA 4OLVH 4J3OG 3U6XS 5GGTL 3MUGA 5IB4B 4HWNA 4GYBA 1RMFH 4OIBA 3BZFA 4XI5C 2CDGB 1Q4NX 4PV8B 3RNKA 2HRHA 2E9IA 2IF7A 3PP3H 5EV7A 3TIEB 3WTSA 2AKRA 4LOUC 1V3KA 3NFNA 2NZ9D 3SD5A 1U42A 2A9NL 3VFMA 3MRJB 4ETYA 1T6WA 2V3EA 2KBGA 1NCCL 2XNAA 1A4KA 3QAZB 3VDCA 2ZKHH 3FU9A 4LSUH 3P0GB 3GMRB 2WBJD 2Q8BL 5KS9E 2O5YH 1ULVA 3CZJA 3EH5B 4OD1L 4O2FA 1R3HB 4PRDA 1JWMA 4JDZB 2JCCA 5IBUB 2QLVB 4K3JH 2PTUA 4JRYE 1F4WL 2DB8A 1U2YA 2I5YL 4GPVA 3OHXA 2I07A 2OTWB 3E2HC 5EZJB 2QKIC 1MAMH 1AY1L 3ZX1A 3ZL2A 1PBYA 4GO9A 5HYSA 3F01A 5AOKA 1H3PL 3CZUB 1P7QA 1F00I 3KYMB 1R33A 4PS7A 1NCBL 2AQPA 1S7XA 1ZXKA 2VXVL 2VWEE 4LEOA 4YVNA 5KVEL 4PD4J 3CSFA 3GFUA 3QWRA 1A21A 1OSZB 5I75B 3DV6B 3ZKMC 4CL7A 1I53A 2EDRA 1YMMA 2EUWA 1BPLB 4OJAA 3IKCA 5ES4B 3HNVH 1YN7B 1XDTT 3FPYA 3ARGB 4DP2X 1A6ZA 5A2CA 1I9RL 3B2VH 1A3LH 4Q2ZB 1FGNH 3DURA 3L6FB 3WS6A 5MHSD 4HZLA 1A1MA 5D93C 4JRXB 5EPMA 1WE5A 5I6PA 5ADPH 4KC3B 4NKOA 3VE0A 2PW1B 3IFNL 1JPST 1LD9B 1VFAB 1F4AA 4J12A 5EORH 1HXMA 1Y6NR 2A0LC 4XPHH 5EUKB 3O6LL 2L7QA 3FQ4A 4KK9C 1YNTA 4P9ML 2E6PA 1O7SA 2OTPA 1IZJA 2IH9A 4M00A 3E0GA 7FABL 4DQOH 2JB6B 1D7DA 4W9FC 1YEDB 3TF4A 3H56A 5AVZB 2FJFA 4PTUA 3MYJA 4H0LC 1AD9A 1XSIA 3BGAA 5I18L 1NCJA 2FQGA 1QSVA 1I8MB 2WHVA 5D7SL 1DQDH 4OZGF 4OFYA 1NDGB 4FCHA 1DSWA 1KLFA 3ILPB 3QISA 3EFOB 2L0DA 1A6AB 3B4NA 1G7QA 1C12B 2BOBA 1G6VK 2V0AA 3QG6B 2W80C 3MLYL 4PRPB 1IBHA 3PV7A 1NCNA 3MCYA 2QTVA 1AG6A 3OQRA 4DOHE 2EXTA 1IGYB 2GJ6A 3BE1L 1CLZH 2EC9T 4LRNH 3IVKA 1S5IH 4AL8H 3MV01 5DJCA 5FOJA 4U1HA 4PH8A 5GZND 3ASOB 2VDKL 4Y5VA 3FCSA 4TVSa 4QO1A 3HMXA 1ZDQA 4WHDA 5CD3B 5K9JL 1IGJB 1QLFB 3PL6A 3H3KA 2W65B 4OLXH 2MCMA 1KXQE 1NAMB 1OAKH 2RR3A 4UQIM 4ZFQA 3TOPA 2AV1A 2WCGA 1RUKH 3OX8A 2J5LC 3OKLA 1KG0B 1BW8A 1ZY9A 3D2TA 4H8PA 2FHBA 4KFMA 4QYAA 5JQHC 4XH2B 3ZKSD 2F9BT 3B5HA 4N0UE 2FZ3B 4DERA 1KGUA 1FH2A 2VOTA 1AXTH 3RWDB 4QTIH 4XZUB 1GAFH 1RZPA 3EAKA 4WI7A 4HWBL 3ZHNA 2H9GA 4X9FA 2NY0C 3NEXA 2P26A 3MODL 5FW7A 4XOBA 3G6JE 1QFHA 3Q9QA 2CMRH 4ZO6A 5D2LE 2Q1EA 3JWOL 3WTTA 3B2UD 1E3FA 5GZOD 3QDME 3LIUA 5HPMB 4OSUL 3ARRA 4EI5D 5L2JA 4PJDE 2NRDA 5IQNA 4TNWF 3PUCA 2XTSA 3MGTB 3FO9A 4OGZA 4BELD 1QEWB 3WDIA 2UYLB 1J8HE 4NM8H 1AZBA 3A24A 4OLEA 1EUTA 2VDQH 1TYRA 4H7VA 2V6HA 4HZAA 1NCHA 5KG9B 1PL3A 2YBGA 3I3BA 4ZO7A 4I0CC 3WUWB 2CLVA 4HP5A 1CD1B 1GS8A 3M8OL 3PABB 4OZ4A 1RZKC 1IEBB 3RWCA 3TA3C 4DP1X 5C0JA 4O58H 1PKQB 2DQGL 2H47C 2RACA 2X70B 4KJPC 5IB5A 4QKTA 5IW6A 3AXIA 5B4MD 4ELDA 4WI9A 4KI5E 1N4XH 3L7FA 4XNBA 4FFZL 3MGTA 5GS3A 1KB3A 2W60B 4Q6YA 2AEIT 1R3LA 5FGCB 3S36L 4N0CD 5DVNA 4ADIA 2VQ1A 4ACTA 4QXTA 2ZTBA 2V9QA 3STLA 2DTSA 2XPZA 1BF8A 1Z3GH 2F8IA 4U1MA 5FYKD 4NFDA 4YK4B 3B2VL 3SN6N 2DLFH 3D51A 5KBDA 4X0KA 5G55A 1ASPA 4U31A 1FRGL 3PWPE 2AXGA 5F96L 3DVNA 2KQNA 5TE6H 3I50H 3VXRA 1CZ8L 1UXWA 1WGOA 2BNRB 4PU2A 1C5CH 4JUTA 4KFZC 3C09B 2OLDA 25C8L 4ODHL 3VFTB 3C5XA 3F6IA 1NCAH 3GNMH 3WFDH 4HIQA 4ODXA 1O9WA 1X4ZA 3BKJH 4LPCA 1MCHA 1R19A 4F37F 1A0QL 4X50A 2IOOA 2M2DA 2FX9L 1EBAA 5FR3A 1YNLH 4ZW8A 3N5AA 4YWGL 1S9YB 4YX2L 3HR5A 4P57B 1BWWA 5F7NC 1CIUA 1ZHBB 2ZPKL 1E4KC 1CCZA 1I7UB 2XKNB 3S48A 3T04D 2VH5L 4M6MH 2X2UA 4HV8A 3D2UB 3GT6A 3LDBB 1P2CA 1UD6A 2ISDA 3Q3GA 1BVZA 2C9UA 3A4AA 3ZZSA 4E9YA 1A7OL 2P52A 4YC2C 2KLSA 1ILUA 4LLDB 3SY0B 1PIFA 4WUKL 5DZ9A 5HHQA 1RCYA 3RDTC 5HYFA 5T1JA 4PJXB 4AENA 1DHKA 5KVDL 1E9PA 4P3WA 1KLFB 3ILPA 3NQIA 1XCXA 3K91A 1DUYA 1JDAA 2AMUA 4ICWA 4JHVA 4DKEH 1O6SB 4MRBA 2EO9A 2X87A 4P9MH 2YBRA 1S9WB 3BKCL 3D34A 5KSUB 4R83A 5IEKA 1WWBX 3BLBA 3GRWA 4G8GA 4WWKD 1NFIA 3D18B 2E27H 4DN3L 1BEYL 1CE6B 5D5MB 3KLLA 1YEDA 1KIRB 3CHPA 1FNHA 3K2KA 3LKOA 4ZUSB 2J1WA 2E4FA 4FRWA 5ADPL 4N1HB 4L8BA 4PY7B 4K5LA 1HZHL 3RWFB 2F08A 3KYAA 4K71C 1XDYA 1HE8A 3ZQ9A 4AEHL 1QLRA 4PD4K 3BKCH 2WYTA 1S4IA 3DX8B 3HHSA 4L0PB 2OZNA 5B38G 1QI4A 2IFGA 3S3BB 3FTUA 3QYMA 2PW1A 3CSYA 3LMJH 4JFFB 3W81A 2AQSA 1XVSA 1LILA 2WBXA 3L4CA 1GZPB 2ICWI 3T2PA 1DANT 2NUPB 2PETA 1A1MB 2X4NA 4QTHA 3SYCA 2WMPA 1UB5B 2Y24A 3PXLA 1A6ZB 3T2NH 4BBWA 2B16A 4IS6A 1VERA 2CO6B 4XPTH 4OCSH 3S9DB 4NUPA 1TJGL 5EUOB 4P2OC 1B4TA 2IOMA 1LK3H 3IKCB 4E41E 4YHNA 1VPOH 3DJZA 1MWOA 5C70A 3EDEA 2WOBA 3ISWA 1SLUA 4Z7QB 3ARDA 2PO6B 1F6FB 2ZICA 2KZWA 1S7XB 4BFIB 2XG5A 3QP3A 1C16B 2OL3L 3HLAB 2PPDA 2OULB 3I74A 2EQDA 1IILE 1E28A 2OAAA 2NSQA 4KRNA 4JDEA 4PIRF 4A2GA 5C07A 2YPVL 1W0WB 5TE4H 3ZOAA 4CAGA 4W6XB 3EG9B 1F86A 1EO8H 3TJHD 3ZW3A 4UTAA 2OCJA 3T8XB 5DLML 2DWYA 5E08L 3MNVB 4BFJA 5IOKA 2X4OA 4HSAC 3AS3A 2YOCA 3O2DL 43CAB 4EAEA 4FXKB 5CJXC 3M7FB 1MCBA 2WBJB 1Q72H 1P7KA 2BSBA 2Y36L 5K5YA 3LZRA 3ZXAC 2OR8A 3IWVA 4JG1H 4X80H 4DK3A 3O0RL 2EE9A 3BFWA 3D07A 3G5VA 3NFNB 2BERA 1G6RH 5I0DA 3TIEA 3L3KA 2V8LA 3IU3A 2IWGA 2IDCA 1DBAH 2LTQB 2G0LA 3DMMA 4P2RA 1YC8A 2BSED 2C9RA 4JVUA 4Y9BA 3W82A 1WV7T 1LP9B 4RWYL 3WKQA 1GKOA 1VLXA 5AUMA 2GIYA 2DWTA 4AJVA 1GSMA 5I17B 3BSGA 4LCYB 3SKOA 3GS0A 4EI0A 4ZQTA 4OV6F 4UU9B 4EUPA 3GUTB 5HYSG 4TUKL 5F93C 1HSBA 3SGDI 2W07B 3U7YL 2H8PA 2R29H 4A67A 4UIKH 1YYLH 2I27N 1WD8A 2V7NB 3PNWA 2O5XL 4U1NA 1MVYA 3HI1A 4Z7NF 4MB3A 5AW0B 4UQ2B 5FKPB 5TFSL 1D9KA 4HJGA 5J9PB 1RLBA 3CFEA 3QUXB 4D0CB 3GD1C 3B3BA 4OGXH 3EUDA 4L8SC 5F3HB 2XVKA 4LBAA 3REWA 4B9PA 3I6GA 4WNQA 1K9TA 2ZONA 3FT4A 3IE9A 1TJIL 4AKQA 2YRBA 5IB2A 2JJTA 3S4SB 3PY9A 3PJLA 4JB9L 4ZUTA 4JFYA 2NNAA 4CC1A 1F1DA 3RNQA 2DLFL 1OOAA 5GGUB 3D52A 2HWZH 1AMYA 1XGPA 3IDXL 4PJBA 4ZFFB 1T03L 3I6LE 5C09D 1LE9B 3O3EA 4P4RB 5LGYA 3H9HB 1M42A 5F6IC 4BSJA 2ITCB 2QKIB 5IJDC 4FFWD 3C6LD 4RMVA 3U0PB 5I74B 3QIUB 3WN5C 1NAKH 3ULUL 2R8SL 2C4XA 3KPSA 5CP3H 1TU2A 4B0MM 1L9MA 2P5EB 2YO3A 2R9HC 1LTXA 4NN5B 3TH3T 3L3JB 3IJEA 4MJ6B 4QRRA 1G7IA 1T4KB 3MJWA 1NCWL 2J8UE 2BY0A 3PWNA 4NRXA 4P2QB 4AMXA 2F5BL 4M03A 3OGCB 3U2SB 3WIHA 3PV6A 2X2YA 1Z9SB 1BOGB 4F7PB 2R4RH 1M2VB 3RG1C 3MREA 4APQC 3T0EC 3L7EA 5KVFE 1C5BL 4N6RB 2NY3D 3HZMB 3BD3A 3IPBA 5DJYA 1GOGA 7FABH 4FQXD 1P4BH 4DPCX 2HX7A 5GRZA 3ZYOA 2QPDB 3L5XL 1A3ZA 3GKWL 3SPVA 2PO6D 4YFLI 2O6DA 1HESA 1OL0A 5LWYL 2XRAL 3BDYL 2ALAA 3KD4A 5FV2A 1J8HB 1FJ1B 1I9IH 4X6CB 1PTZA 1GOHA 2A83A 3TF7C 3HW7A 4AC4A 1YNTF 2VYRE 2XOTA 4WF7A 2A73B 1DBKH 4HIJB 2Q3XA 4FFYL 1NA8A 4URTB 4B9FA 1NIDA 1DBBL 2CLRA 4QRPE 3V4LA 4L8SA 4YBLB 5D2LF 5EO9B 3UBXB 4HUCA 4MD0B 1LK3L 1UXSA 1EDQA 5DUPL 3QRGL 5D71H 4N5ED 1UZ8A 1IO4C 4LL4A 3RZCB 3TZVA 5IHHA 1T1ZB 1I8KA 4NQED 4PS4H 3BWUC 5FGCE 1MFDH 5T1DL 3CLFH 2AJXL 3UZVA 3TZVB 3RZCA 1HH6B 3P9LB 2VXTL 4L48A 5EO1A 1ZT7B 3ZDXE 3US1A 3MHZA 1MCCA 3SGKC 1UXSB 2WB1A 3UBXA 1GYVA 5D55A 4GKNA 4MQ7A 4G7QB 4XXCA 4Z95H 4N0RA 4YDJA 2AJZA 1MELA 4G80A 4QYOB 5J56B 3QUMB 4KHXH 1QSFB 3U82B 5KYXB 1DQTA 1A47A 2V33A 1K6QL 1UD2A 1XAUA 1QFWI 5L2KB 2WTPA 3AY2A 1G7LB 4XNUH 4GRWH 4R3SA 1SXZA 4W6WB 2WCPA 1EGJA 1P4IL 1ZPLA 1KDIA 3NAAH 5JLZA 2XZQL 4FFVC 4HJSA 2K4WA 1SF3A 3QR1A 2J8HA 3IDYB 4YSQA 4B50A 2ADFL 5DWPA 4E5XB 3UCQA 4XB8A 4LU5L 4NNXA 4J1UB 1TZ8A 4JO1H 1J8HD 3K1DA 3U2SA 1OP4A 3IDGB 4BQCA 3MBWA 5F9AC 5FXCH 4Q0XL 1AOHA 1VEMA 1H19A 4Q9BA 3S35X 4U6YA 1FUNA 5DHVB 2BINA 1X9QA 3VTTA 1TU2B 2J88H 3FN3A 1MUJA 2BP5M 3NCCB 1B3JA 2CBOA 1A3LL 4HCGA 1O9ZA 1CE1L 3KPRD 1OF2A 3R8QA 3VFWB 4JN2A 4U3HA 2VJ8A 4UUJB 4YHLL 3U0PA 2W9EL 1LO3H 4XT1C 1JHTB 3BUDA 3CH8A 3U30C 2QKIA 4YHIA 4JK0D 3LH8A 4PRPD 1QSEE 1DQIA 2J25A 3H9HA 4IDLA 3ASWA 1D3CA 5JDJA 1CF1A 4OQTL 3WIFA 3U4EA 2IAND 1N2RA 1PQZB 1MW1A 1JHLH 2NNAB 1JDCA 4MVBC 4LVEA 5F2FA 4XC1H 3RIFK 3FDWA 4RMBA 4XMZA 4Z78A 3IXAB 4HJ0C 3ZKXC 1AO7A 4M62L 4EIGB 2OSLB 3T6XA 3UJTL 1T7YA 4RH4A 3LXBA 2IJ0C 3APNA 2Y1AA 4HEMA 2EZ0C 3E8UL 5DQ9A 4D9RE 2EDTA 5IF0B 2QR0A 4UDUA 4KY1L 1ED3B 4HJGB 3TBYB 4BSWA 1BVOA 2WN2A 5FYLE 1SQ2N 3W39B 5GGVH 3IGFA 2FNBA 3CHSA 4GLRI 5LG1A 2E9GA 3WNJA 4MA1C 2HT3D 1X5IA 3VI4E 1GW0A 2AFNA 4C8XA 4LLYA 2FBOJ 1HSBB 3BD4A 1OP9A 1MI5D 4DP6X 2JXMA 4FL4B 4M5YL 2WK2A 3AAZA 2NYZA 2CK2A 2DQJH 2X4TA 4IIQB 1L9NA 3GDCA 3TT3H 2FATH 5I19H 1XMWA 1J0ZA 2EACA 1T04A 2DMGA 5A2KH 2ESVB 1E4WL 1W16A 5AUMB 2VDNH 1KACB 3COOA 2YQBA 1ET7A 3HG3A 2VMJA 4FG0A 5ALCH 5F6HJ 5SWSA 5HDBF 3LXAA 1IAOB 2E4TA 4I5BB 4OKVA 4NKIH 1NCUA 4D3CH 2J72A 1PPIA 1SGKA 5AVYB 1BYNA 2EXYD 4HZ1A 3WY2A 3DX6A 2HA1A 2FQEA 2QZ5A 5B3JE 4UV4H 5DCCA 4CADA 3T0WA 4BWUA 4MX7A 5LBSA 1PLGL 1QZ1A 3U4AA 2F7QA 1GAFL 3LS5H 4YH6A 5KBPA 1YECL 2VM9A 1YZZA 4HMCA 4PV9B 4FNPA 4TXVB 4CC4C 2PYEB 2IBZY 3KLQA 4XWOC 3TESA 2J56A 1XF2A 3FL7A 3ATDA 1A7RH 1WEJL 2CUIA 2WXFA 2DIEA 4U3XA 4ACPA 5E51A 2V17H 1I7ZB 5HHXL 2ZOUA 3BEWA 4JFZL 1PYWB 1GGYA 4P5RA 1E2ZA 1LP9E 2AJYH 3EJTA 3VDBA 1U2CA 3MLTA 5TE4L 4N90D 1KGCD 1T1XB 1NKGA 5C07B 3HKFA 4Y4HA 2QGBA 2CDFA 3BRFA 3GS7A 1CLYL 1ODAA 3EGSA 4NC1C 3RJOA 4BK5A 3BFOA 3GI9H 4A7GF 3U1QA 2PO6A 4YHOL 4N90E 2NZ1A 3QEHB 1IL1A 1C7SA 2X1XR 4M8UA 4QR7A 2OZ4L 4HIXH 2XQBH 3V4UH 43C9B 4YIQB 4QRTA 4HD5A 4CADB 4UV4L 2H4EA 5I1JH 1D2PA 2BWDA 4WFFE 2F53B 1KYOK 2WMPB 3W9EA 3BSHA 3RAJH 1VSCA 5DJ2A 5JIDA 4JRYB 4J3UA 2HPOA 1PZ3A 1GZPA 4HGWA 2FH8A 1IAOA 1BWMA 5I2IA 4Q6IA 3VSUA 3MX0A 4L4VA 4UYQA 5E2TL 3GLEA 3O6FB 4GG8B 3NZUA 1LEGB 4P07A 4WDIA 3VH8G 4PY8J 3N85H 4JFDB 1QVOB 3D85D 2WP3T 2QGEA 3VFOA 5IQLA 2G9KA 3QRBA 4PY7A 3FSOA 5FYKH 2D4FA 3FQUB 1AR2A 2LGNA 2B2XH 3MTRA 3LZPA 2PWFA 4BZ1H 4ZMYA 3P2DA 1CE6A 1JVOA 4QXUL 5DK3A 2AANA 5DVMA 3IYLW 1MEXH 5SWZD 4NPYA 4GXVH 2YAPA 1SLVA 3SE6A 5IEKB 5I6MA 2NYKA 2YBRB 3ILEA 5TK2A 3QHFH 4Y19A 3T6ZA 2YD4A 3KHQA 1YVLA 4IBYA 5KSAB 4LVHB 4P59H 2QR0B 2JIXB 3SPCA 2L4OA 3VG9C 5IF0A 1BVKB 4GUPA 1N5YH 4OCXL 3SODB 4MWFB 3VWKD 4IOIA 4AENB 5EEWA 3IMVA 3F7VB 4F33A 5D7JC 5KANI 4JM4H 4Z7UF 3CG8A 3QZOA 4OLZL 1A7OH 3AS2A 4P2QE 4X6EA 3ZDWA 3X3FH 1BLNB 1BIIB 2KKQA 3F5WB 3O3AB 1H15A 1WWWX 2E56A 3EOTH 1P2CB 2WUBL 5KVDH 1KB5A 3MV7E 3BP4B 1FNEA 1JUFA 4MNGB 4U3CA 3ULVF 2B59B 3C6LC 3WIFB 1ZHBA 2XA3A 1TZOA 1UJ3A 3FFDB 2EVIA 4YX2H 1OGTA 3MNMA 1KXHA 2V7HB 1W6WA 1L5GB 4PJIF 3MRDB 4A66A 1OF2B 3VMNA 4LVOC 2NY1C 1JTTA 2HKHH 4I88A 4M3HA 4Y1AA 5J57B 2BNRA 4TLSA 1YPZB 2BP8B 4NNPL 3IMWA 4PRPE 5SV4A 4Q6KA 1SXCA 5J06A 5BRQA 2LQRA 4AUUA 3MBWB 1BMGA 3OSKA 3SSGA 5DRXB 1OAXH 4J1UA 1QRNB 3AU1B 1F4XL 3CLEH 3QNFA 1YDPA 9CGTA 4A2DA 5AG9A 3QUML 3FTXA 2VQ1B 3HNSH 4GINA 5I0WA 5L6YH 3S36H 2HB0A 1ZGLM 4H0IA 5BRPA 1EJ6A 3OKKB 5LDSA 2W60A 2PWHA 5DVPA 4PQXA 3EJRA 1MHEB 5FHBH 3QDGD 4DVRH 5CR8A 1G7LA 3EOYG 4KQ4L 2JV6A 3E1F1 4BCZA 2IPTL 5IB5B 1EBPA 3BJLA 4Q6IC 1F45A 1AMXA 3QYCA 4AQ1C 4PJBF 1IEBA 1SVCP 4MXVE 2K8QA 5KYXA 5I16B 3Q43A 4RFNC 3WUWA 4MXWL 5DJZB 4I18B 3TJEH 1E4XI 2XX0A 5KBNC 3VXRE 5DI8B 4TVUA 3IJ9A 4KQ4H 3CIAA 3LS4L 1J87A 5IQ9B 2P5ED 2VXQL 4BZ1A 1FNGA 4NWTL 1TSHA 2WNGA 3VXPB 2P47B 1J88A 4GG6A 1EAPA 3W56A 5L2JB 4WK0B 3D6GA 5ETUB 1Y0LA 1NIBA 4GMSH 4WIQA 4JE0A 3ESUF 4WAFA 4NM8L 2FK9A 2F7RA 1F4XH 4LP4A 2HJKA 4N26A 3M17B 4Z7VB 2EYTA 4NQEB 2FT6A 3EDJA 4CILA 3I6KB 3MV8E 5L0QB 2EE2A 3FQ1A 5TGBB 2MPAH 5DJ6B 4PLNC 3I02A 2KZ1B 4BINA 1QR4A 5C7XH 1KG0A 1DVFB 1IC5H 2OBGA 1KIQB 1I8IB 2F18A 3SCMC 4JX0A 5BO1L 1UOVA 2AV1B 3FBKA 4JQIA 2X0VA 1JS4A 1J8HA 1FJ1A 1U8HA 2EIDA 3GHBH 5FGBC 1B0GB 2DI7A 3FCBA 4NO0B 4WTXA 5HSFA 3DYMA 4M62H 3SPVB 4OBRA 3UERA 2AQ2A 2BWQA 2QQNH 4TVPE 4UAOC 4MSWB 5E1AA 2NQ3A 5L4JA 4LSVL 1N0LA 4HX1B 2K0RA 5HHXH 1KPVB 3F85A 4HU8A 2FJGB 2V5SA 3H85A 4XMWA 5DRWA 4PWKA 4E9XA 1I82A 2HFEA 1FN4A 1J05B 2D3JA 1U36A 1HQRB 5HDWA 3D9AH 1NL0L 3QCUL 1Z1WA 3L7EB 4KKBC 3BSZA 3MV9E 4PRPA 5I74C 3GSQA 3QG6A 2V4LA 2IQ9H 4OB5L 2DQIH 3CFKB 4Y1AE 4P2RD 3SPIA 3OGCA 2F5BH 1QRND 3U1SL 4PW4A 4MZRA 2YN3A 4IU2B 5L8KB 3SGKA 4NN5C 3NCFB 2D0FA 5FUCC 1ZSHA 2NY5L 3AADB 1EWHA 2DBJA 3PHSA 3ZTNH 3A67L 4LCUA 1KXQA 4DO6A 3U83A 1Q0YH 4MRCA 3NJVA 3LXUX 3QIUA 3E9UA 2VTFA 4KQ3L 5DJDB 2V3FA 2DQTH 2F7IA 3HS0C 3H3PL 4K9EL 3X11B 1GR7A 2FQFA 3HHMA 1SOKA 3MV7A 4G71B 4X6FB 4X6BA 4XB3A 5T3XH 4K4KA 3ZE0B 1LE9A 1UYWH 1SQMA 4PJBB 4BXSV 4EBQL 4RGOL 2D3VA 2WZ5A 1YCSA 4IGBB 4NUQA 1DCEA 3WEBA 1TETH 3H53A 1VADA 3BAEH 3EDDA 4N2BA 2FR4B 1JGLH 3SCMB 4ZUTB 1D9KD 4NKOB 2D4DA 2OJZH 1CU4H 2XXGA 4NLAA 5IB2B 1AGBA 4OZFB 5C0BD 2WQRA 3PWJA 5SX4H 2Z35A 1MF2L 2CO3A 5F3HA 4N8PA 1KCSH 3UTPE 3VGEA 1KY6A 5GHWL 3QUXA 1DP0A 4N68A 1TT6A 2PPAA 2ARJB 2YD1A 3EJJX 3ZHKA 5IFHL 2EVJA 3L4ZA 3U79A 2P8MB 4EXPX 2ENQA 2ZF9A 1U8MB 2JKRM 2OYMA 2QEJA 3FYIB 3HI1B 1IC1A 3O9WC 3S35L 4DGIL 2AK4B 1IAKB 4B9JA 1YMMD 1SLWA 3DX7A 3GI8H 4CW1B 4JRXD 4JFUA 4Y89A 5DD3H 3GJEB 5AKRA 5H35A 1A4CA 5I75C 3TNMB 4HLJA 5ICXB 3KGSA 2V2WB 2QHRL 4AM0A 2CUHA 5DTFB 1BAWA 5INCB 3MLXH 3DJTA 4WW2F 2CM5A 3FC8A 4YHYB 1H0DA 3BUPA 4BH7A 5EF3A 4Q9QL 4KTDL 5EO0B 3PXHA 1JWMB 3O45A 4RLDA 4Y9CA 4LQFH 4OIIH 4R5XA 1REIA 2VC2B 2ORBL 5GGVY 1A4KB 3P0VL 4XI5D 4QHPA 1S7WB 2GABA 1P1VA 4NCDA 4CBZA 2YD8A 4K7PY 1U41A 3RVVC 2O5NA 2AKRB 5IHWA 1DL7H 4I3RH 1CGVA 1IAMA 1R24A 1XGUA 2GC7C 3QXAA 2GSMB 3NYKA 4FFTA 5TQ0L 4NO3B 5KW9H 1XGYL 3O6KH 1OAXL 1CXKA 1RJYB 3K6SA 2EE6A 4KKQA 2CK0H 1ZXQA 3VA6A 4DTGH 1N0XH 3GZOA 2YAQA 1NH6A 4NN6C 2XTLA 3UZQB 4AYEC 2J55A 5L7XH 4K8RC 1UEMA 2OW7A 4JDEB 4M1GH 4OU3A 3RZCC 2YAHA 4HS6A 3UAFA 3WL9A 1H3XA 1TQVA 2J3SA 4NZRL 3VU2A 4B0MB 4WU7A 3H42H 3QDMB 3QI9D 1AIFB 4XN9A 2Y7OA 3SIKA 3UTTA 2P8MA 4PCTA 4OZFH 2YD6A 5E5LA 4YLCA 3T77B 1JPTH 1A6TB 2VABB 4KNSA 2ARJA 1J18A 2RCSL 3CE1A 2FAUA 2HJLA 4AY0A 3TWYA 5C0AB 1WAAE 2XHNA 4IS6B 4RSYA 1DQJB 2NCMA 5J7CC 3E8UH 2CSPA 4GMTH 4F8NA 2ATPA 1CGYA 2VDQB 1UB5A 4J4PD 3PWJB 2AQRA 4QTHB 5CJ8A 4JHWH 4GXUM 1Q1JL 1EV2E 1Q1PA 3RVWD 2X6CA 4FQHB 4NQXB 1T2XA 3EYOA 3HB3D 3MLRL 4HMDA 4I0KA 4X99B 5E9AA 4Z7AA 4KNQA 1OLLA 1ZWIA 3CSYB 4G6FD 4YSUA 4JGUA 1FGVH 2E7HA 35C8H 2ZKXA 3H3BC 4JFQA 4PVMA 4Y19D 3HHSB 3P30H 3RPIB 3NIGE 3GTTA 4YZWA 1NGQL 2VDRB 4WV1C 4PI0A 2E74C 2LFGA 2XTJD 3GZKA 4ZO8A 2VXUH 2Q7NA 4Y5YB 3VWKA 2PYFA 4A7QA 1UKQA 4X6BB 2HVKA 5B7EA 3V6BR 4L8BB 4MNGE 5HDBE 2EEXA 3OMIB 3PP4H 1KIRA 2DIAA 2VKWA 2X7LA 5D5MA 3HN5A 3UJJL 5I82A 3PAVA 2WWKO 4DP7X 2IMMA 4V33A 5D72L 4PB9L 3T3MB 2MNUA 3ELAT 4R7NA 2KI6A 2R29L 1NMCC 1PZAA 3MRFB 1EO5A 5D7JD 2X3BA 5AZEH 4P0DA 4PJ8B 4DGYH 1EUUA 4NO5B 3MVSA 4MA7L 1T66C 4Z76A 3CFKA 1Q0YL 4PJXA 4OZIB 1BD2B 1U8OB 4L3CA 5F7BA 3GSQB 1E5YA 2XKSA 2AJUL 2UY6A 4PGEB 4LLDA 3SY0A 2NY7H 2CIIB 5FUOL 2H2PD 1KPRA 3N1GC 3OG4B 1FN4B 1GZHC 5LGKA 4KXDA 2D9QB 4YUEH 3JWDC 3RIAF 4OSUH 3VFGH 3HG2A 3BFQG 1XSKA 2QHLA 2X53A 3U1SH 3T0XA 4K7PH 2AQQA 3D0VB 4P3DA 1OP5H 1L9RA 3GO1L 3C2SA 3MAWA 3RUGF 4X4MA 4JPSA 5T3ZD 4KAQH 1PY4A 2EIJB 4IJ3C 4UINH 1B0GA 4NO0A 4XMPH 4I3GA 3KBEA 4IRZA 4F1ZA 5E2WL 2FD6H 2WQXA 1MWAH 4ENZA 2ICES 3O2VH 1I8IA 2ZG2A 3GQFA 3LRSB 5JOFA 1JV5B 2DD8L 4L1TA 2C7FA 3N43B 2YOAA 3ME0B 5E9DD 4H2CA 1HHGB 3VFTA 4EDWL 1J1OL 2IAMC 3SDXB 3KXFD 1UXWB 3WV0A 3QUGA 2EXWC 2NXZC 1E27B 1U4EA 2OPCA 2K7PA 2A74B 3ECBB 3H6AA 2YEZA 3M07A 4NQEA 4X0KB 3VXOB 2MNJB 1CURA 1IC5L 3S98A 5CR1A 1AZRA 1YN6A 3KLAB 1LYQA 1TVDA 4AV5A 5CJOH 5HHPA 3STLB 4FZEH 4QXTB 2G0KA 3IN0A 4UZUA 4ZBJA 5C0CE 3OF6D 3CFNA 2VMEA 1PGRB 2BVYA 2HT2D 3D39A 3BE1H 4Z7UA 5E4EB 1IGIH 2WLHA 2ZUXA 4L1DA 4H88L 4N9OB 1FNGB 1N10A 3I6LD 4G7YL 5F1NB 5FIEA 5C09E 1I8LC 4N9GB 3OKOA 1MHPL 3SGEI 5JXEA 1LO4H 3HR6A 3US9A 4N8UA 2CG9X 2NYYD 3MA7A 3TV8A 5IW6B 5JOPD 2WXOA 3RFZA 5DJZA 5JIIA 1BYPA 4D94A 3A6CL 2DIBA 2CLVB 3BESR 4LARH 4G7RB 1ZGLB 4YC2B 4QOKB 1TJHL 4PJ5E 5AZ2L 2DL9A 3DDFA 3VJ6A 5I1GL 3V79C 1RUPH 3IEAA 3B9DA 3ZT6A 1I4FA 3RVXC 1QO3B 3DROA 3SEPA 1IAIL 2JMRA 4AQ8A 5HPMA 3W0WE 5F7EL 1DSFL 1G9HA 3CC5B 4UQ3A 4S1DD 2XWZA 4OFDA 3ZDXB 3OWEA 5AAMA 4XCFH 3ZY7A 1CLCA 3TN0B 1UZ6E 4AQOA 4G42B 4XNZB 3EXLA 2YAEA 5E5RB 5HHMB 1HHJA 3HPJB 2BC4B 3T71A 3S3DB 1E6JH 4UTCA 3V5KB 1RZIA 3B7SA 3C87A 5K39A 1YPZA 2BP8A 3GC3A 4ODXB 5CFAA 4Y1AB 4L5FE 4X42A 1YY8B 4C59B 1TTCA 3TIDB 4XH2A 5HP5A 1OCWL 2Q10A 4OF6A 1XCTA 1OAUH 1RULL 2EJ1A 5IW3A 3FU7B 2V7HA 4QRQB 2J20A 1OGTB 3ZZLA 3ARDC 3FFDA 1P4LB 5B8CA 3CSBA 4XN4A 4GAFB 1CTOA 5CD3A 4TLKA 1JRHH 6TAAA 3OJVC 1NBYB 3OVUB 4MJHA 3F6JA 2ZKMX 4BV1A 4Y5VB 4HC1A 5FYJD 2YPLD 3QPQC 1UCTA 2ZSVB 4PRNA 3ET9F 4I87A 3MJ9L 1BLNA 3WYRA 3S35H 4X8XA 5GGRY 1ADQL 4HKZB 5EC2A 2J88L 4RDBA 3NIGF 2ADYA 1G7QB 2BOBB 1MN4A 3P02A 4PGDA 2VW4A 1UQSB 3GBNH 1A6AA 4NERA 1EJOH 1WVZA 1OHZA 2ZOKB 2IEPA 4LCCA 1CFTB 4NQCB 1R3KA 4PJ8D 3ZRSA 5DT1L 4EUPH 4UDTA 3CLWA 2LFEA 4S1QH 1A14H 4MVBD 4M4PA 3SJVE 1AP2A 1JZHA 4NPYB 5IKCB 2H3XC 3O6MH 4J3OC 4HPOH 2ADFH 2EP6A 3GLAA 3VXSE 4BUGA 4EUPG 5JYLA 3FHQA 3MYJB 1HWWA 5A3ID 1G1OA 2Q2EB 1EH9A 4PGZA 5D6DC 3W38A 2WNWA 2DWSA 4HU2A 2NX5E 1RMFL 1ZANH 3NFPB 3GSNH 1BQUA 1FBIL 3O4LD 5HTSA 5GGTH 3EJCA 5EUKA 2YK1H 1TCMA 2UXGA 5D5MF 5LGJB 4PMEA 3UAJD 4BSVA 4I3RL 1LEGA 5JZ7C 5K9QI 3O6FA 4GG8A 2Z65C 3ULVD 3MX0B 3VE0B 1YAIA 1IT9L 1EX0A 2QLYA 2GIXA 1Z9LA 3KLDA 5C0BE 2ERJB 3GUFA 4YO0A 3TV3L 4MXQD 5DJ2B 2XVGA 1GGTA 4DKAA 2EXSA 4XXDB 4AQEB 2YMOA 4UT9L 2MOQA 4XTRC 2GQHA 1R5WB 4A55A 1IC7H 3II1A 5DHDA 3TFKC 3VRIB 2Y06H 2ZCKL 5I5MA 2I9TB 1KN4H 1OQXA 4DEPC 3BN9D 4YIQA 4YPGB 3BAYA 1YMMB 1HU8A 5D1XC 1AQDA 1LEKA 4RIRB 4L4JA 5GRJL 4N87A 3ULVL 3E3QE 2OMYB 5E6IC 5ISZE 4Z7OF 2UVEA 3FQTB 5LUMA 4CBPA 1U8PB 3SKJL 3QULA 1FFNB 1P7QB 3KYMA 1W9XA 4OGQC 3IGKA 4HGKC 1QW9A 1VZIA 2FO4A 2CDFB 4M6ML 1W80A 2E9BA 3NOIA 4AVKA 3P4NA 4YSSA 1T1XA 3WFHB 4PUBH 3HC0A 3HS0B 5TDNB 3IS1X 1DVYA 1GXEA 2OXHB 4Y4HD 3BO8B 4LLVB 3I75B 1PYWA 3BCFA 3HS8A 2PR4L 1I7ZA 4UM8B 5DRZB 3U6RA 2IPKA 3DKHA 3VG0L 4P2RE 4V1DE 1G9ML 4KZEH 1UUSA 4KK8C 5KYWA 1R3HA 4PB0H 5D1QA 3IJ8A 3FTYA 2X1QA 3PPEA 3P2BA 5EIIA 3QG7H 5F89B 4Z7VF 3NG5A 4AYBA 5CCKH 3RWGA 4AZUA 3D69B 1OAKL 3RI5K 5B1JA 4DP9X 4XE5B 2W9DH 3BZFB 3MJGX 2XY2A 1MJ8L 2BRRL 3QUYB 2DTMH 1NCDH 1A7PH 2ICCA 1GGBH 4LSTH 5GJTL 4DFIA 4KGLA 3SYAA 4P4KA 4M6NH 2OMXB 3IJYB 2VIRB 4Z7NB 3W5NA 4F5CE 4GSRA 2APBA 3LNIA 3P11L 4I48B 4DFHA 4F7KA 3N40P 4IBUA 5C07E 4YNYA 4HA1A 3S0PA 1UB6A 2CR6A 3HNTL 1KB5L 5GGRA 2YD3A 3AAZB 4NPKA 3FO2B 1SBSL 3BI9X 3SYPA 2JXMB 1P9MA 5DJ8A 2PO6C 4MXWH 1B0WA 2APXA 3HCVA 3ROLB 4D2NA 4PSRA 3MOQA 4TULL 4Z0BH 2VSCA 5E5UB 5EF1A 4I1RA 3B9VA 2V2TA 3POHA 4WU5A 1NICA 4FEMA 2Z0BA 2WYIA 1DQKA 3FOLB 2P24B 1FBIH 4OJCA 4U0RB 2QFRA 2AEQL 3B3IA 2BVQA 3S37X 3TBYA 3IXTB 5FW6A 2VDPH 3BIKA 3P69A 5GSRB 3N9GL 4BEIA 4E9SA 1ZHKA 4UDUB 3R1GL 5HHVH 1DQLH 5JXAH 3C5SA 4PTTB 2EUXA 2C3GA 1SHSA 5EF0A 5CCKL 1QFOA 4HFUL 4J5VA 4PWIA 4JCMA 3K6NA 2GTWA 1NIEA 4G1MA 4O02L 4G8IA 5IT2H 1GY2A 4HS8H 1R1CA 4MGXA 1QNZH 3QJRB 3BLKA 4OGXL 3DOSA 2JKJA 5CJBA 2G5BA 1SOSA 3DDGA 2GEEA 4IEFB 1OZUA 1PQZA 4H13C 2FX7H 2X89A 3DVGA 3LPGA 2YIHA 4IGBD 4ODBD 4F7MA 4M02A 4N2KA 3VH8A 3HI6H 3UXFA 2FWUA 3HI5H 1DDHA 4KDVA 1JN6B 4AVIA 3QH3A 2YPKA 4GQQA 4MQTB 4JN2B 1UWYA 2Y0SA 3KL3A 5EZOL 1T83C 2OMVB 4JM2F 4A37A 5IMKA 3PWVB 5DS8A 2ZCZA 1JPFB 3QDHA 1P5UB 2R2HB 4HCRA 2DQMA 5DHVA 3EJYC 2FBJH 4K23H 4X6DA 3HE7D 1OXYA 4POUB 5LVEA 3LX9A 2C9AA 3NTCL 1B6UA 5B1BB 4YE0A 4FABL 3IBOA 1MSPA 2MCAA 3GIZH 3V52H 2GB2A 2MOGA 5AVWB 2PP8A 3QQ9C 4JQXA 2G75A 5DDHB 2Y4SA 3G04A 3ESNA 3FSWA 3DTUB 4U0RC 1JK9A 3N42F 3V7AG 1CTNA 2DWXA 3FFCB 3MXWL 2ZZUT 4JKWA 5ERWB 5JLZB 4L37B 4FQLL 4MNQD 2N56A 1C7TA 5TE7L 4XTRD 3MV7D 4QHLA 3SHSA 3J8F7 5PCYA 4WV1B 1MJ8H 2BRRH 5DQDH 3N06B 4HS3B 2CK0L 1KTRL 5FKAA 4NZTH 2FWOA 3IGAA 4KRPB 2E8ZA 2VERN 1QSFA 2HP4A 1MLBA 2YPLE 3B8YA 2AJZB 2ZXAA 2Y1YA 4J3TA 4HJIA 4LDLB 1F2QA 3BH9B 3TL5A 2CIKB 4M4RB 4N4YB 4J27A 2J1ZA 5H37G 1JVLA 2IGFL 2Y5QA 2DQFB 4ZW7A 5IVOA 4URKA 4W68A 5AB9A 4KJQD 4Y1SA 5AW7B 4K23L 3BIBX 5JNYB 3I85A 3FXIC 1AHWB 5KVMC 3O4LA 3NJGA 4YEFA 5H37H 2I85A 4HJUA 4PIBA 2G5UA 4DZ8B 2EKSB 4JG9A 5D7LA 2JI2A 1I75A 1ZTXH 5F88B 5GSVB 4LQFL 3FCTB 4N2NA 4JNXA 3LB6C 4W9IC 4KH9A 1UT9A 3EDFA 2QQLH 1RHHA 1UZ8B 5ESQB 2E7CA 2BHZA 1PZBA 4Z8FH 3OHXC 4PJAA 3HKZA 3UGUA 3WOVA 2Z31A 4XGZA 1DBML 2H2SD 4X4YB 3PWVA 1MFDL 4L1BA 4FNLH 1X5ZA 2AK1L 3QQXA 3OMZA 5ID1A 2K8MA 2OKMA 4Q52A 4UQDA 1GZQA 4Q7DA 4N5UA 5LN4A 1KN4L 5KVFL 3QI9C 4OLUH 1BJMA 2HKFL 2XLLA 4ZPVB 4M5SA 1S6NA 4UT6L 2FL5A 4X7SH 3HRPA 3INOA 5GJSL 1BM3L 4UV7H 4CSPA 3AS1A 4CMHB 1KPUB 3HG1D 5FLUA 3EJSA 2VISB 3TYFA 4R97B 4IEFA 5D4HA 1ACYL 2WXIA 1TQUA 2D7TL 4ZFZB 3KXFB 3LAFA 2GUOA 2JE8A 5T1LB 3MZTA 5HYQB 3GMNA 4P2CG 2ZXEB 3BP5A 4PJFA 3HZMA 4WNSA 4ZT1A 3QZLA 4FQJH 4G8IB 4YDVA 3WDHA 4FLSA 1O9VA 2BK8A 2PXYB 2B4CL 3QQ4B 4KROB 3HZYB 5F1IB 1AGDA 3MV8B 5EOCJ 5KVGE 3VXME 1S78C 1J9SA 4H26A 1LO2L 3ABKB 1EJFA 2NNCA 4S0TD 3TCTA 1JGLL 5DURD 4JEGB 2R4SH 1G7IB 4QRRB 4LGPB 4BFGA 1QX1A 3VFVA 1RPQA 4OFQA 1SBSH 3E2HB 2CU9A 4J3WA 4FA7B 3MRPA 3S8WA 3N1QC 2ITFA 1CFQA 2A6JB 3L3OC 3ZGIA 1WFJA 2BNQD 2KS0A 4ODWA 2Q86B 4XOCA 4Q0XH 4TNGA 4I4WB 3X1NA 2ZCLL 3BLPX 3GSWA 4GAJH 5I28A 4QXWA 1M6OB 3CVHA 2FATL 4FULA 2ZOLA 5DHYB 2CKBH 4BFBD 4TNEA 4AKOA 1TXKA 3MO1B 1QUNA 4KXCA 1JXJA 5J4MA 4NQSB 4YBQC 4YHZL 1CXFA 5IGXH 1OVZA 2F53E 4XC3L 2JLLA 4XVTH 3VTMA 4PRAA 5GIRB 5F8RC 4I9WD 4AUYA 2DDQH 2YD5A 3C60A 4JO2H 1KTCA 2GK0B 4JO4L 4WTZG 4POZD 5CCGE 1JPEA 3QUYA 5IJKC 4WNQB 2EADA 2PTTB 4FHKA 2VLRE 3CZGA 2YMXH 3AVEA 1T2QL 5I6LA 1B2WH 3CFEB 4M7LT 2IMNA 3RJQB 2K1MA 5EOQH 1OAZL 1IFHL 5EIIB 1T0NA 1UFUA 1MI5E 5LO7A 4L8CB 3T2LA 3K2UL 5D6DA 1GY1A 3BZDA 3UPCA 4MD4A 1F90H 5KYWB 5IQOA 1MCLA 5PAZA 2WQAA 5KBKA 2H6PB 2BZCA 4AT6B 5DRZA 2W07A 2J44A 4F27A 3U6RB 4PJHB 3I2CH 4UM8A 3T65B 3ZN6A 1OPGL 4PJ9C 1E9QB 2XWCA 3LN5A 4PJIB 1ZS8A 4U1GC 3D0AA 2OZ4A 3SY6A 5FO8A 4GRLC 4LCYA 3SKOB 1OAQH 2BVEA 2VL5B 3KGTA 4GSDL 3VFSA 2CE6A 4M9PA 5CEZD 5AOIA 3VFGL 1S7VB 4D9RD 4LLMA 1U8JB 2BPBA 2LV4A 1O7VA 3CDGB 4NX0A 1WS7A 1RIVL 3O8XA 4HMEA 1IKFH 4WHCA 4WRLA 2B3IA 5I1LB 1HZKA 4FTDA 4G6FB 2WIIA 3VFRB 1NMAL 4XE0A 3DMMB 1B3IA 4L1LA 4IMKA 4Q89A 3KYOA 2QT6A 3S8FB 1WFTA 4UIMA 3WMSA 1NUFA 3CSTA 5ACMA 3ZBMA 1B2YA 3SDDD 4ZX6A 3PHQA 2I9TA 3G5VB 4AC2A 2HAZA 1R5WA 4FFYA 2FUQA 2MOVA 3MMEA 1D5XB 1TVBA 3GMLB 1QFPA 4I77L 5A2BA 1SOQA 3MLVH 4FXGB 3GSNA 5D7IB 1P7KB 4N0FA 1N19A 3MLUH 5HDQH 2VWEC 5JYMA 2DQUL 43CAA 2VLJA 4Y16A 4MYWB 5LBGA 2WLJA 2X09A 2IOIA 4FJYA 1W72L 2NSMA 2M8XA 5KOMC 1PJ9A 2XSKA 3LEYH 3MRKB 1FC2D 3LN9A 3OKYA 1NQBA 5EU6A 3CQQA 4PWEA 3SE8L 1W8OA 4FQLH 3NFPA 4JPWL 4QRSB 1SEQL 1YHPA 1U8CB 1TR7A 2ZE0A 3M6DA 3QEGH 3T6VA 3HLAA 1RIHH 1JZ4A 3KPSD 3H9SD 5BS0B 1UADC 1YJDL 1ZT4B 2VMDA 3OR7B 3BP7B 1BAFL 3Q9PA 5GPRA 2AJVL 5CLZA 4G83A 4HWZA 4BWWA 2GIMA 5G4OA 3GTNA 3ZHFA 1XF5A 3RB5A 5FYKU 1E7UA 2HFTA 4OLZH 2MTPA 2QKSA 1IEAA 3EZJB 4MNQB 2ZIDA 2JJSA 3KYNB 3L5WB 3O3UN 4Z5RA 3U36A 3IBEA 4W9CC 1J9QA 4H8WC 2Y23A 2G3NA 5CAYB 4Q14A 2AEPL 3ULUE 4GSXA 4WJ5B 1AKJA 1NM4A 4IMLA 4OLWH 3B7RL 1DBJL 6CGTA 3AREC 1GCYA 2NY1B 3DX8A 1KJVA 1F2XK 3GLDA 2DYPA 4I3SH 3X13A 1PLAA 4JFWA 2CPCA 3LY6A 3AB0C 5CJXA 1CU4L 4G7SB 4PJDF 4QRQA 2EDKA 4APQD 3KGUA 4JKKA 2QDWA 2Z31D 3MZGB 4OFIA 4QGTA 2Y7NA 1KELL 5C3IA 3OZ9H 2XA8L 4TTGA 4G8GB 4PB9H 3CCHA 1E90A 4R7LA 5ABAA 1YY8A 5BZDB 4AEIH 3IB4A 3QDGA 1S9WA 3TO2B 3L4XA 2Z92A 1JMXA 2VE6B 2Y7QB 1NC4B 1MCOH 1DUYB 3HPJA 5ELIA 1TF4A 1OAYL 3ZHLA 1FP5A 1VRSA 1E9PB 1UG9A 5CEZL 5HHQB 1GS6X 4PJGA 4UQ3B 3GS4A 1H3VA 4XBGA 3RAJL 3LV3B 2XWDA 4P05A 1PZ2A 1XV8A 2LT9A 2WXMA 3BYYA 1RD6A 3Q3GB 4AXWB 4DGVH 1QO3A 2DQDH 4OLYH 3U9UB 1Q38A 5C0DB 4G82A 4P2OA 2DQEL 1NKOA 4W1TA 3C9NA 4DWHA 4ELME 2VGLM 5HDBB 4NHUB 4CJ1A 2CJTA 2PCFA 1CUOA 4FERA 4PJEE 1Q1JH 4PRHA 4X7TB 2F54D 4H1LA 5SV3A 3VGBA 1QP1A 5I1AA 5SWQB 1NPJA 3KVPA 4K3EH 5ADOL 4HOZA 2R39A 4ENED 4KZCA 1WBXB 1V05A 1N9PA 5HVHC 2EEDA 1J5OH 3PYCA 4ETQA 3LXCA 1BZ9A 1Z5HA 1FFOB 3ETBJ 4FQXB 3J27A 2C1PA 2Z6FA 5JW4M 3ZLQC 1V7ML 2G60L 3D39B 5D2NA 1TG8A 2HJFA 2QQLL 4JB9H 1TNNA 4DO4A 1X5KA 1HT6A 4RNRA 3ZR6A 2O5YL 2OS7A 1O6TA 2Q5BA 2WXKA 1HNYA 3BUIA 1W6LA 3JVFC 4L9LC 4OI8A 5GGSA 4XXWA 3NZSA 1DQQA 4IBTA 4N8VA 2YEZB 3O9WD 3TXAA 4DTGL 3CGTA 4FF9A 4DUXA 3EYSL 2VZTA 3V8CA 5G2NA 3FU6A 4EN2A 4KH2A 2R2EB 2KUTA 3D3VE 3Q2NA 2G3ZA 4JE4B 5DJXA 4ZTPH 3VG9B 3EYUH 5AD0A 3GLZA 2X1PA 1FFOA 3DHUA 3NN8B 4FQXA 1F58H 4L5FH 5IJKA 2XIIA 2AITA 4X6DE 3BVNB 4OM0H 1CYXA 1QEXA 1TJGH 3Q2LA 4C4UA 5C2BL 1V3JA 1B88A 2NDGA 4WSGA 3GBEA 1NWPA 3OAUL 5ADOH 2DKSA 1IEHA 2ICWA 1J5DA 2NY4C 5BCAA 4PAZA 2AXFB 3ZKNC 3QCTL 1BG9A 2XWTA 4S0HA 1CG9A 1XR8B 4P3DB 4QXGL 1OB1A 1YQVH 1ACXA 3ZTEA 3B6SB 3CX5J 4QCIB 1XR9A 3CK0H 2ZOWA 2BNUA 5IY5B 2X3AA 4AXWA 2VL4A 1YNKL 1KFAL 3LV3A 4FMKA 4GSDH 5E6ZA 3GGWA 4QXGH 5L8JB 3GINA 1BD2A 3D9AL 4F2FA 4APXA 1FAIL 1HC1A 1J0IA 2NNFA 4Z3GA 4R4BB 2UY7B 2IV9A 1N26A 3RUGA 3EH1A 2FSEA 3PHAA 4UTBH 3FQ2A 5FS5A 3T4AC 5DWUH 4QRUB 3CCHB 5BZDA 2FZ3A 3HB3B 4OF5A 4HIIA 2HWZL 3BGFC 4K94C 1I1FA 3ESPA 2RBLA 3OX8B 4UQAA 4WEUD 4YDZA 3ZL4L 1X3DA 4WI3A 2AXJA 3HUJF 3LQMA 2BIPA 2W65A 5CZVL 2ENPA 4JFDD 1QLEB 3X13B 1WFOA 5AOLA 4P5KA 3DSFH 3WE6A 1HL5A 3PXJA 5EWIL 3MRHA 3QNZA 4MDJB 5HBBA 5C0GB 1OGAE 1PX3A 5IVXF 2HT4D 2DY2A 3QT2A 2GJ6B 3NPZB 2J2ZB 3ZHDA 3DTDA 4R4FH 5D8JL 1ZKAA 3L5WA 2YAFA 1HN1A 1XO8A 2K4AA 3KYNA 4ZSOB 4WI0B 1CT8B 4M7LL 4KVCH 5ICYB 1HSAB 4NI6A 2OK0H 1SY6H 4ZNEE 1LEIA 3R06B 5SX4I 1DQJA 1ETA1 4Y4FD 3TPKA 2FX9H 3O2WL 2HFFA 1R4XA 1A0QH 1KBPA 4P23B 3CBRA 4FA6A 3H55A 4GRLA 5JO5B 4HIHA 1AQMA 1ESOA 3C5ZA 3UFIA 2VLRB 4LSPH 3VGAB 1CGSH 1NMBL 1G0DA 1I8MA 4U1KA 4FQ1H 1U6AH 3CZSA 5E24E 2J4WH 2QGCA 3QZMA 4RGNC 4FC3E 4QIRA 2HRPL 2GJZA 1L9OA 2D03H 1GA2A 3VGFA 3KYKL 5MI0C 1VAHA 1XD0A 5IJVB 1HL4A 1EAQA 2X10A 3FTSA 1YNTB 4RFEA 2EO7A 4QEGA 1I7RA 3WFBH 3QJFB 2LU4A 1HXMB 2B4CH 2XJLA 5F7FA 3CQFA 5C0AE 1J1PL 1N12A 1FYHB 1SF5A 1TTUA 3TEWA 2CA3A 1F11A 2PPFA 1NC2A 1DVFC 2FECI 3PAUA 4WY7H 5DU7A 4ZUWA 4OFPA 3UC0H 3BUYA 2E9JA 1SHWA 5CSZB 4AGOA 1EPFA 2DQUH 4NO3A 5KSBB 3RE0A 1LWRA 1TENA 1X6LA 5A3IC 3D87B 4HZLB 3N42B 5LXGH 1TJXA 4FXGA 3JYCA 2FQDA 3L6FA 3GMLA 3HMXH 3QXAB 4JVPA 1R24B 3V4VL 1KELH 3MMEB 1JZ5A 5ISZA 4FZ8L 1FPTL 4FNSA 4WTQA 3PGCA 3ZUNC 1MCNA 1ZVHA 3CVBA 4UIMB 4JM2D 4JZJA 4KO9A 1XCQB 1GOFA 2B1OA 2JJVA 1IBYA 3KG5A 4QHMA 3WO4B 1AHWC 3O8XD 2X9YA 5E8NB 2ZF8A 2EDHA 3H7BA 4LEOB 3O8XB 4UANA 5EO0A 1CDCA 3B5TA 4S0SD 1H0DB 4UT7H 4B9IA 4UQCA 1LNUA 1RK7A 4ONGL 3DXAE 1UCBL 5INCA 2GHWB 1M05B 3T0EE 2V2WA 1P5UC 5ECGA 2OTWA 3KCWA 4FP8L 4YE4H 5EZJA 5FO8B 5F7MC 1HH9B 5IFHH 1E9QA 4M8VA 4LIQE 2OTUA 3GJEA 4GXUN 5AOJA 3WKPA 2IXQA 3VQ1C 1RU9H 3EADA 3NSCA 4HUVB 3FZUC 3DSNA 4O2FB 3H7BB 4A2LA 4L8CA 3G5XA 5CM1A 2A9CA 2VUKA 4QOKD 1INQA 3QQDA 2XNAB 3CMOH 1KGJA 3ZRCC 3CV5A 3L1OL 2DWEA 2H2PC 5CCJA 7CGTA 3GK8L 4JR9H 2O1AA 3PGCB 4M7ZB 5C07D 3S3JA 3ENEA 3RRQA 3LRLA 2W0PA 2Z35B 3WNIA 4FG6C 3D8MA 5F3BB 3H9SA 1F1GA 4ERSL 3B9KC 3Q8CA 1HAUA 3IFOA 5T3XL 2FT7A 3MR9A 4ZFGL 5HVWA 3SCMA 1I1CA 1VADB 3OXRA 1ZLWH 4G6AD 2GTQA 4NQSA 3MV11 3A5VA 3JWNE 3S2CA 2YARA 4LCIH 3CZEA 2A9ML 4J3SA 1BVLA 2OI9C 1I7RB 1ROCA 4OV5A 1M1XA 2JJWA 4LSPL 3WMPA 3GSWB 1ZTXE 5E8OA 4CSTA 3OMAB 1CI5A 2VUYA 2LU5A 3L08A 3VM7A 3QA3A 1C8PA 2XV6B 5H8DA 2AJ3B 2Q86A 4ODWB 1C5DA 2A6JA 1UZ6F 3I9GL 5C0CB 1YEGH 2IDFA 4Z77A 3EYQD 4FNUA 3FQRA 2W0FA 5D8JH 4XB7A 4X5LA 4N25A 5IP4A 2XQYA 3WELA 5EBGA 3NZ8B 1AI1L 1JI2A 2Q76B 1RH8A 3R06A 4BD4A 1MDAA 2VZUA 3EW3B 2B9BA 3QQ4A 4ZSOA 4LEXL 1JCKA 3MUJA 4FQJL 5CD5D 2WYZA 3B9KA 5GGVL 3GSXA 4PMFA 3NT0A 1EO7A 5MEPA 4J39A 3GMNB 5CHNB 2H3KA 2PMZA 2XPGA 3MJ7B 2GUOB 2EVGA 3KXFA 1LQSR 2FJGA 2R51A 4U6XB 4ZQKA 5CGMA 3ZPDA 1FORL 5B39B 4KKCC 4MSWA 4KUCF 5E1AB 4OKDA 1WAEA 4N5EC 2YUWA 5E7BA 1F3DH 3JVGC 4X6CF 5LQBH 2EDBA 2P49B 1FF5A 3FCGA 5F8QC 4XX1E 4D9QD 4K8RH 1RUKL 3EKCA 3PJNA 4V2CB 4OY9A 1XGTA 1VZGA 3CX5K 2N1TE 5HHVL 4AIXA 3MLRH 4TLTA 5CXPA 5ID1B 1WBYB 4AIZA 3QJZA 5AYQA 4MCZB 4AK1A 3A4DA 5DMIL 4GXVL 4X2UA 5TGBA 5I8KL 1J1XH 3KR3H 2RCSH 2ZWZA 2VLKD 3M17A 3QUZA 1JF6A 2QMKA 5HJBA 5DVKA 2JB5L 5EB9A 2YSTA 3B8SA 2WYHA 1IKNA 3D39E 5DGQA 3CTTA 1MCKA 1FLTX 5DMKB 2XKUA 3BMWA 1AHWA 3ARBA 4NKDA 1EAPB 4D9QE 5KYYB 3EO0B 2AJSL 3KBHE 1P4UA 4H40A 1T66D 5L7XL 4WWPA 1DQDL 2LOEA 3QJOA 2C8NA 3M7OA 3GJFK 2Z93A 2YZ8A 1XR8A 1PDKB 1JNLL 2CIKA 2BLFA 2R69L 4ORGB 3S4SG 2ZAGA 2K45A 3HC3H 5DD1L 1DDTA 2AXFA 4Q97A 3VX1A 1UWEH 2Z8WC 1XD1A 1D5BB 5I16A 3DRTB 4GRLD 1CXEA 2FWOB 1CD0A 4W93A 3ZDYE 4HS3A 4AVHA 3AUWB 3SQBA 4PVBA 5JHDA 4ZOCA 3FO1A 1MHEA 3BQUD 3NN8A 1DLHA 4RGMB 2F1EA 1DVTA 3JZYA 1JF1B 3GI9L 1G6RL 2R2EA 4Y1TA 4XN1A 4CA4A 1UUNA 1JK9B 2NPLX 4TRPL 3D50A 1TJMA 5DK2A 3G04B 2HUEA 2BVOB 2Z7YA 3OM3B 4JFTA 1YDPB 4MA1B 5AW9B 3KPRE 1QRNA 1AQKH 2FEJA 3AU1A 3MCG1 4G6JH 4K73A 4B7IA 1HVXA 1WG3A 4RA3A 1U4FA 2LVCA 2NX5B 1TFPA 3NTCH 4EQ3A 4HD9A 4AQZA 1O6VA 4PGBB 3QUKA 5GS1A 3PWUA 4PJ8C 2G2RB 1KTKE 1KXVC 1NLBH 2CALA 3DUSA 5FM5O 5DEFA 4M6OH 4KVNL 2VDNB 3FB5A 3HZVB 2PW2A 3P0YH 4MA8L 4N6QA 2XICA 4O51B 5IESH 1DDHB 3PIQB 1AVAA 1NIAA 1G7MB 3L3IB 4HISA 3VXNB 5IBTH 2IDUA 4JM2C 5I1AB 1D7FA 4LPUA 4WUUB 1CFMA 1UJ3B 1OK8A 1WC7B 4ENEC 4NZ8A 4NHUA 4MNGA 1FNEB 1JUFB 2J21A 4A6YA 2N0MA 4E41B 1N7MH 4Z3JA 2JQMA 5D7KE 2VDRL 2J8UF 3QXTA 2ATAA 3O3AA 4TRPH 4NC2B 2XACC 5DZPA 4BK8A 2TRYA 5F7HA 2GTWB 3VMPA 2XN9E 2DI9A 3NJXA 4IOIB 3DECA 1WIUA 4MWFA 2C9PA 5EULV 3V6OA 3WJLA 5JPNC 1UKSA 4OZHE 2RHEA 1M4KA 4W4OA 4Y19B 2PKDA 1H3WM 2BVQB 2RALA 1XL6A 2E7LC 1NBVH 4H20H 5I26A 1YEJL 4M29A 4RGOH 1M6UA 3QDGB 1C5BH 3O6ML 2FUTA 1AZNA 2O6PA 5E00B 3MYZA 1URIA 4HPHA 4RQQA 1PEZA 5CGYD 4FLOA 1G87A 3NIFF 4DZBA 3OKMA 5BNXD 4N2OA 2MRYA 1NLDL 5I0XA 5MENA 3FQUA 3ROLA 1CFNA 2AEPH 3FU0A 1CGUA 3ZDZB 1DFBL 3VYPA 1M71A 2QVMA 5HJGA 3K8LA 1O7DE 2O6CA 4WDIB 3SCMD 5EBWA 2X9XA 4JHAH 1T6BX 4IMLB 4FABH 2B0SL 4WJ5A 1FVDB 1W0YT 2HG5A 2QPUA 2H0EA 2OMXA 1UXLA 4MXVF 5F9JB 4R6UA 4HGWB 1TPXB 3REVB 2E59A 3CXDH 4X9HA 4MB1A 2J57A 3WXWH 5EUOF 4Z5RB 1PY0A 3ZE2B 5E6IB 3ZR5A 4Z7NE 1NL0H 3SYQA 4P2YA 4PM1A 4A2MA 1IKNC 3O6FC 4DJMA 4Y4KC 3VFNA 2CNYA 5AKVA 1AE6H 1I8LA 4JRFA 4X7EC 3O2WH 2FGZA 4HF5L 1WF5A 2EIBA 1JPTL 2DQ6A 4MJIB 5E6RB 5BUGA 4XPFH 4ZMTA 2ZYIA 4IKLA 1WFMA 5AOMA 4EVNB 3E80A 1CFVL 5L88H 1F4WH 3MUHL 1DVSA 4QRAA 4ES8A 1AC0A 1PG7W 3MBEC 1U8CA 3QAQA 4RMQA 4C56A 3SDCB 2NY6B 4LEXH 2J6EA 3V2AR 4PRBB 1RFDL 3DUUB 4HJJH 4KDTC 5I23A 2IFFH 2OSYA 2O72A 1CLOL 4NQDE 4PLOB 3VD3A 2Z8VC 1TCRB 3O6KL 5FUOH 3F58H 3W2DH 3QEQE 1JSYA 4N0FB 5LJYH 1AQDB 1LEKB 2DLHA 3AY4C 4PV9A 4AYFA 5CILL 5EDSA 1OGAD 3D4GA 3NH7L 4PVLA 4UB0H 4YPGA 2CHDA 3RILA 2BW4A 5DMGC 1XCWA 4BZ2L 1OT4A 3ZMEA 4N1CA 3PHQB 4YDKL 5KUMA 2VDOL 4KK6D 2WLNA 3DX6B 3GSOB 4ZFOA 1OO2A 2FO8A 2VLMD 2XXCB 2YZ1A 1TCRA 1BPVA 3RDTD 5SWSB 5I1LA 4YDKH 5D1ZI 1G9MC 1Q8MA 1OE2A 1S7VA 3TO4D 2ESVA 3UIZA 3DUUA 1T04B 4L0ZA 4BSVB 5E23A 1DVZA 5T3XD 3NK4A 5KZCD 3FMGH 2BSDA 4PRBA 2X4TB 5C6TH 1UWXH 5J1AB 6PAZA 3SDCA 4Z3EA 4HWBA 4L8DA 3DI3B 5IMOA 4EKJA 4AT6A 4HG4J 2J12B 4HJJL 3T0AA 2D73A 1ES0B 4L5FL 5E4OA 3JWOH 3T8MA 1T0NB 1X4XA 3Q2VA 1VCBC 2NY6C 3W39A 2YPVH 1ED3A 1A2YB 3LQAH 1W0VB 2WB7A 1UZGA 3LHPL 5D7IE 3MNWB 5J3HC 3V0DA 2NNRA 1GSKA 2P4AB 2OSLA 4OJEH 4UOQA 2GK0A 1N6UA 3QFJE 3IM1A 2YAOA 1ZHNB 3P73A 3VMOA 3BUTA 5DC9B 1SM3L 1Z5LA 1FVDA 2Y3AA 2O5ZH 1EEYB 3CFMA 1BXUA 5F7UA 2Q0ZX 3FN0H 1L0YA 4WZ9A 2DMCA 5I8OH 2GG1A 5C6TL 5B8CB 3Q44A 3FMGL 3S5LB 2DQTL 2BS9A 1IKOP 5MENB 3UTSB 4I4WA 4UUJA 4XZ4A 1XCTB 4JHAL 3KPQB 2VDOB 3A4EA 1HILA 4NBXB 1MUJB 1EZLA 2E8YA 1J9TA 4FKHA 4P46B 5E00A 3SPJA 4YSTA 1E5ZA 4OTXL 1T7WA 4LOUD 5F7AA 4DSYA 2AQTA 2VN7A 3EFDL 4I0PB 4UNUA 1AAJA 5K39B 3VFVB 1CK0H 3L1GA 2B15A 4TSCL 5HI4C 4JZJC 3CQPA 2ZUYA 4G42A 5D1XE 4QT5A 1QSFD 3F7LA 1FAIH 3TN0A 3WIHH 1AGDB 3CC5A 1E30A 2PXYA 5F1IA 4E5XA 1HYRC 3GB7A 5IBUG 1LO5A 3NFSH 5EZLA 5KWYC 1DEDA 4A7UA 5GISH 1I4FB 4UF7C 5T5FH 3EHBB 2D8KA 4RRPG 1S7QA 2BSSA 4BHUA 2AXHA 1FQ9C 3B9AA 1S46A 2F6AA 4HK3J 4LPYA 3RTQD 4LAQH 4G8EA 4AG4H 4H5SA 3OZ9L 1KV3A 4WUUA 4BK4A 4NQCD 4YEEA 4K5OA 3P1VA 4R5TA 1G7MA 3L3IA 4JJOA 5DD3L 3VXNA 2UX6A 1F4HA 2NY1D 2IBGA 5ESVB 3CHQA 3QUMA 1MCPH 2BVTA 1CIDA 2BIIA 2A4CA 4YDJB 2E46A 1YY9D 4OJYA 3HBZA 3EYVA 5DEFB 4P5SA 1QSFE 4ALAC 3RVUC 1AQKL 3ECQA 4G6JL 4GKNB 4WW1B 5DZVA 3WG7B 4BE5A 5AAPA 3MPCA 2Z31B 5A2FA 1R34A 3INUH 3V0GA 3QUKB 5D71L 2B3RA 4PGBA 5ESQA 3JTBA 1H8NA 2VZ1A 1XZWA 4JY4A 5BZWB 3PLYA 4HC1L 3IE4A 3QZWG 4XAWH 5F88A 5ILTH 3FF8A 4RGNB 2QSTA 1YN6B 4DZ8A 3N6YA 4X8GA 4ZMXA 3WXWL 4MAUH 3CXDL 3QI9B 4YHKH 3CVHH 2UZPA 1RKRA 2J1YA 4QI3A 3SDXA 3VWKC 3TWCL 3ME0A 4MD5B 3D2UD 4KWUA 2CLRB 1PNCA 3FO1B 4AEHH 3Q1SH 1KCUL 3WDJA 4M4RA 5JHDB 4HIJA 3DUHA 3UAJC 3BEVB 5CP7B 3MOAH 4X6CA 2G3XA 3QIWD 5E2WH 3IDYC 5F9DC 4DP0X 2BO0A 4XPBL 1NPUA 2IWFA 5F7LB 5HI5C 2Z4QB 2Z93B 4TVPD 3QEUB 2BM3A 4MMXA 3B2MA 1V7NL 2O61A 1YEJH 3SKNB 5DJYB 4KXAA 2NT1A 4HHWA 4OD3L 5F6IB 2EDMA 3MLXL 2APWA 2XXMB 2CIIA 4C57C 2OQJB 5LHDA 4S11A 1ZLDA 3VI4B 1OQOA 5E2VL 1BOGA 4DEWA 4F7PA 2JK5A 5ILTL 4OLVL 3ZGHA 4D9LH 2F54B 5J13B 2EZ0D 3QUZB 4LLQA 4PJIE 1OCOB 2VR8A 3CN3A 3U46B 3ATEA 4EIZC 3MRFA 1L6PA 1T20B 4NN7B 3HI5L 1NIFA 1XIWC 3NH7H 1JPFA 5HHNB 3VI3A 4RMSA 5DS8B 4M7LH 1T3FA 1T80A 1A7QH 3QPQD 4MCZA 1FFPA 4Y19E 4BZ2A 2VN4A 2H26B 2HCZX 3QZPA 1FORH 4LOFA 3QH3B 4IJ3B 4OCSL 4WHYG 3B9EA 2BCMA 5CUSL 2HVKB 2IGTA 2JIXD 4BKLA 3GXIA 4P4RA 2PYFB 1EFXA 1KGWA 3SE4A 4DO5A 4F7MB 4ZFFA 2IH8A 3BVVA 1MQ8A 3WN6A 2FX7L 4A68A 1BIHA 1ERNA 1U9KA 2FWSA 3LH9A 2G5BB 2G5RA 3X14B 3GSVA 4HF5H 4TVPH 5CHNA 2ZAHA 3S4SA 4KRPC 3K2IA 4FQ2H 4ZMZA 4EZJA 5DC4B 4KGJA 1T22A 2J6EH 4F7EA 1BQ5A 2NUTB 3SDAB 5JMOC 3FT4B 5EF2A 2WTOA 5DQJA 1HINH 1RUAL 4WI4A 5J6SA 1MPAH 2JI1A 3ATAA 2Q76A 3ARQA 5KJ4A 4PWFA 1TZGL 3DK0A 4AW7A 3KLHD 1FIEA 3ZE1B 3B43A 3WLWC 4U1GB 3DIVA 1MFUA 3B3IB 4N24A 3NCEB 2E5EA 5K59E 3HLKA 3VCLA 4EMZA 2FRGP 3UTTB 2NZ9C 1LE5B 4N2DA 1TUPA 4PHXA 4GBXB 2GAZA 3IETB 4L1HA 2GBVA 5MERB 1KFAH 4WTZA 5JW5A 1DUZB 3EH3B 4JFOB 1SN5A 3R0NA 3L5JA 4FYQA 5J13C 4MKTA 1I7TA 5E6YA 3NPSB 4HS6B 3MRBB 2PTVA 3LN4B 1M1XB 2IPTH 1BZ8A 3FO2A 5IVNA 3OXSB 4X9YA 4LSTL 5GGRB 5A6LA 2VM4A 1AZUA 4YNYB 2LABA 3S97C 2KHAA 2ZX9A 3BPNB 3OXRB 3P11H 1IGMH 1KXTB 4KUCD 3IJYA 3QUMH 5LG6A 2RTTA 3WSQH 4JG5A 2Q3AA 2F2HA 2YKLH 3DLQR 2IG2L 3BPLC 1BFVL 3NJIA 1C8QA 5F0LB 1IC0A 4H8QA 3L3HA 4ISVA 4XNZC 3RKDC 5EWIH 5T1LD 1S2EA 4DPBX 1HHIA 2IWKA 2EUVA 3NUKA 1INQB 4BA8A 1I9EA 4FXKA 4PJDB 4XVOA 3HRZA 2F5AL 3OC8A 4XPAL 1X5FA 3DSNB 4BH7B 2WZAA 2IXQB 2IPKB 2Z64C 1MCQA 2HH0L 3LNFA 3QDAA 4HAFA 1VENA 3SE9L 4KK5D 5DTFA 3T3PB 1GIGL 3TN0D 3RL1A 5HYIA 4AM0B 3UO8B 1VZHA 4DF9A 4TL4A 1MCSA 1I3VA 5SWSE 2OXHA 1XSOA 3AT8A 3FQYA 4N0YL 3VW3L 2C9XA 4OZHA 1E42A 3EUUA 2CJ3A 3P4NB 1M05A 5C92A 3K6SB 1PKQE 2ITDA 4XX5A 3QJXA 1LNUB 1RU9L 1U8QA 3WMQA 1DFXA 1C16A 4HK3N 3VFUA 5FO9A 1ITCA 3QNYA 1G4RA 4XO5A 1B0RB 4NGHL 1AKJD 2OMYA 1KJMA 3AGWA 5AWNH 3TO4A 2XVBA 3VW3H 3H2PA 3A23A 5AOZA 2N7AA 5F0PB 3WY3A 5J11C 3HHRB 1XCQA 3VXSA 2JJSC 2DQEH 5EUOA 1BREA 4M1CD 1F3DJ 1H5BC 2YMXL 5CLXA 3NJFA 4GSQA 3EHBD 5CS7A 1SJXA 5ACZB 4IRSB 2DN7A 4YO0B 4KOBA 2R23A 5BMFH 4TNVK 3P9MA 3FRPG 1CICB 3B2PA 2JELH 4G1EA 4HEME 4QKXB 3QE5A 5CSZA 3BPLB 4YSRA 1WAAF 1NC2B 2BNQE 4IGBA 4YHZH 4Y7OC 3NGBB 2WXRA 4TSAL 1AYRA 5LGJA 1QLRB 1AJ7L 1FZOB 1O5DT 3MLUL 5E2JA 1UM4L 2H45A 3MV7B 4X6FA 2E7LA 2NXZB 3RWFA 5JZ7D 4K9EH 5DK0A 4GO6B 5DJDA 2Q3ZA 2WJ5A 1QRNE 1S7TA 4EOWL 2WZPD 5I8CA 2W1NA 3SDYH 4XP1L 5EBLB 4LEEA 2ZWLT 3D18A 5JHLL 4U1KB 1NFIB 4FJZA 3JTSA 3O11A 1HI6B 4G3YL 3BH8A 4HEPA 4MFHA 3HE7C 1K3IA 4ERSH 5DMGD 4HIHB 1XGRA 5JQ6L 4RGND 1G7PB 1JZGA 4GRLB 1CFTA 5JO5A 3QIWA 5C0EB 1OTTC 3MJ9H 5C1MB 4GQPH 4KNUA 1J9RA 2VT0A 4U6VL 2JLPA 3K8MA 3BSZH 4AIOA 4PGDB 3C5JA 3HG1E 4LHQB 4GRMA 1IM3D 1U6AL 2A5UA 2YGPA 4KROD 3LQZA 2IH3B 4C83A 4HKZA 1CT8A 4P4KC 1KUMA 3EYFB 3JWOC 2GFBA 4AZ8B 1HQRA 2DLGA 2J2ZA 3IK2A 3FW6A 5D1XB 5T5NF 3TURA 3VI3F 5C0GA 3FUNA 1H3PH 4MMYB 3WEMA 1MCPL 1OK0A 3IAPA 4HX1A 4WHTA 4LGSB 2XKNA 5JW3H 4AWJC 4B9GA 1RK0B 1IVLA 3LIZA 5AL0A 1C5CL 3G9AB 1P4LA 1IFHH 3LNDA 3ESOA 1U8HB 4NKMB 1SDDB 4PRIA 1FRGH 3NP4A 5F96H 4QHKI 5C97A 1H6EA 2NW2A 1ACZA 4NZFA 3FU7A 1NOFA 3GMPA 3M86A 1KIQA 1H6FA 1E8YA 1MF2H 3MC0A 4FLHA 5C0NC 4L9LB 2X6AA 3MBEB 1VESA 3EBHA 3TIDA 3WO3B 1IU1A 2VLKE 5DJ6A 4G7VH 4QRUA 3G3LA 2Y6TE 4TV3A 3TPUB 3VGDA 6FABL 4KTYA 4Y8DC 3I6KA 2AXGB 4FI6A 2UY7A 3MJ8B 1M3IA 2VLKA 3QUZD 4GKLA 5DHVH 2BC4A 4BZ1L 1MRFL 3R1GH 1U93B 5A2AA 2LVEA 2HJKB 2NXYB 2ZOTA 3Q48A 3GTVA 4NCC1 4F15C 1NM9A 3O6LH 5DHEA 4EDXA 4FXLA 1Y0LB 3QUYC 3S8GB 1E8WA 2Z3FA 4LBEA 5IREA 4CC4A 3M8OH 5FYLD 1VEPA 4X98A 5FECB 3QEQD 3LH2L 3FONB 2YC1B 1OB1B 1I3GL 4MMZB 4WVRA 4WNJA 3WXVH 2WQSA 2XWTB 5DI8A 4N28A 4JJ5A 1W91A 2AMGA 5E8PA 1IBDA 3WY4A 2ICWB 2HTKC 1I85C 4ZSOE 4XN5A 5EIVA 1A6UL 4G6KL 3P2TA 4EXKA 1NUGA 4GY4A 3EGXA 5A7EA 1OSYA 1MIEH 3BVNA 1T6VN 3BQUA 3PREA 3VA2C 2N01B 4ZDHB 1WT5C 2FIRT 3UABA 1MCWW 2J6WA 4N9GA 3N41F 2UYLA 1FL5B 1QEWA 2G9HA 5IMLB 2H1LM 2GBAA 2ZJSL 1ODUA 2WLLA 3OKKA 3HN3A 4X4ME 4Z7UB 1AOZA 1RZ7H 4JUSA 5T3ZL 4AIEA 1CVRA 2C5DC 5C0ND 3LPWA 2XZAL 4YVUA 5JPNA 3KLAA 4JPQA 1M7XA 4FOMA 2YUXA 3TBBA 5E2UL 1GIGH 2HKFH 4TUUA 2QTEA 2HJFB 3LZFH 1MWAL 4H44C 4LCCC 4A1RA 4XZUA 2VDPB 4HWEH 1HHGA 4NOFA 4G72B 2NY3B 1BZ9B 1CXLA 2DLIA 3BIAX 1JV5A 1IM9A 5I5RA 1NGPH 4CVZA 1L5GA 5E6ID 2KDYA 1WBXA 3NCJL 5BOZG 4XBEH 4HJ0D 3AC0A 5FEBA 1PJWA 4LVNB 3CFIC 3GPSA 1GHFH 3F05A 3PPSA 4NUGH 3GO1H 3NCXA 4RCAA 3WHE1 3HC3L 1ZRUA 4NRZB 3AITA 3FCSB 1IGTA 3V4PH 1T5KA 3L48A 4P2OB 4WEMB 2OYPA 5B8CC 5GS1C 1H15B 5H4YA 3U9UA 3IVKB 2CJUH 3FJTA 5DEGB 1KPRB 5JXED 3FTGA 3VGAC 3BT2H 4PGEA 3ULVC 2CBTA 1G1KA 1U8OA 1R3IL 4L3CB 4Z76B 2Y72A 3T4YB 4EI6B 3PQYB 1BVKA 4L0YA 1TDQA 2JCWA 3L54A 4BXVA 1MNUH 1NC4A 5GISL 2R1YA 2EDFA 4ABUA 2V3DA 2VE6A 3CK0L 4KNTA 1ET5A 4X9BA 1BMWA 1ET8A 2ESVD 5KTEL 4P04A 1R0AL 3APDA 1JGVH 3DXAD 2VSMB 4OJFH 1BECA 1PFCA 4PTUB 2X7LB 4NBZB 2JB6A 1QATA 4KHXL 1BFTA 2HRPH 2MSPA 2VCOA 2ZX7A 3AW5A 3EHBC 1ICTA 4FFVD 4FNQA 2SODB 3PDDA 3UJTH 2DYPB 1BM3H 4UV7L 1KCVL 3HAEA 5BVJA 2UZIL 2X4SA 2CCLA 2A7BA 3RPIA 2UZXB 3AT0A 4Q6IB 3CFUA 3FOMB 3OAYH 5DYOB 4J3OF 3RVUD 4X99A 1M7IB 2N3JA 4LP5A 3HBQA 5F9OH 1VGEL 3ARBC 3U36B 3JQOB 4BWTA 1KYFA 2QL1A 3AJ7A 4Q2ZA 2ATPB 3CPUA 1HEHC 3WNOA 1JZFA 4BQBA 5IB3B 5C0AA 4HWZB 1UM5L 3QPXL 4HFWA 3EFFA 3L4TA 43C9A 1A6TA 1A6WL 4BDVB 1BZ7B 2J1XA 1OGPA 1V7MH 2G60H 3D12B 4ZUVA 1ZT4A 4KVC<