3HBQA

Structure of recombinant chicken liver sulfite oxidase mutant cys 185 ala
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
373
structure length
373
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQAAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulphite oxide
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 99
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbqA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbqA01
2A99A 1SOXA 2BIHA 3HBQA 2C9XA 2CA3A 2A9BA 2BLFA 3HBGA 1XDYA 2A9CA 1XDQA 3R19A 4PW3A 2A9AA 4PW9A 2BPBA 2XTSA 1OGPA 2A9DA 3HBPA 2CA4A 3HC2A 2BIIA 3R18A
chains in the Genus database with same CATH superfamily
5E5MA 3WD5L 1MFUA 4NO3A 2DBLL 3TBYB 3F6LA 4YHIB 1T5XB 3OZKA 4TQEL 2GEEA 2R59A 4NSKA 3KLQA 4ELDA 3B1UA 1GW6A 5EZLA 4YSEA 5H37H 1QSEB 5BRPA 4W70A 4FG0A 4HETA 3VWJB 5C08B 1N5AA 1VRSA 5LAPA 3VDBA 1K9TA 5E6YA 2GSGA 3AG1B 4YHZL 1CQKA 4PR5B 4KHXL 3ZDWA 2Y2YA 5K39A 3SBWA 4X4KA 2DL2A 1OM3L 1GRWA 5DZPA 4UT7H 1UM5L 2EEAA 2HT2D 4GSDH 3KZ8A 1W91A 1XX9C 1MH5B 1MDTA 1T0MA 2JXMA 1S7VB 2LLNA 2NPLX 3JWDL 3PHSA 4ZDHA 1NGQL 4QKTA 3LN5A 5ALBH 3IE4A 1KCKA 2YPVL 1TENA 4LZKA 1R34A 4PW3A 2ZYRA 3T4YB 4OF8A 2DQCH 2WY3B 3L5WB 1W16A 3VG0L 2ZJSL 3KLHC 5TJWK 4N68A 4R2GC 3IU3A 2ADFH 4I2XA 3DMMA 2J5LC 2W07B 3V5KA 3ZY7A 1PY9A 4L4TB 2R2BB 3GBML 1Y6NR 4M43H 3VRLF 1CICD 2IIJA 1CDGA 3ESOA 1HCYA 2QV4A 4YXLH 1EAQA 2WOYA 3QZBA 4L4JA 4KJQD 3PHQB 2XWBB 4XMPL 1MEXH 3UGXA 4KUZL 5GSRA 1RJLB 3T5WA 3RILA 4AIEA 3JWNG 4HEME 1KELH 5MI0B 4G7SB 3CU7A 5J56B 4G9FA 1ND0A 1JGVL 2BHZA 1G94A 2XVGA 1N8ZA 2H8PB 3DK0A 1YY8B 2ZXGA 4PJGB 2VXVH 4GBXB 1BGXL 5D1XD 2XBDA 1JSYA 4XPBL 1HYSD 5DDHA 4XVSL 2GSIA 5E7FA 4BZ1L 3BPNC 1ZOXA 4TYUA 3MR9A 3EXJA 1ZHKB 3QZPA 4JRYB 4MXVE 3U9WA 3BPCA 5IUCA 3C6LA 5LG6A 4Z7QF 1G7MB 5D2NC 3QJXA 5FM5M 2ALWA 1RXLA 5F9OL 2ORBL 2Y7LA 5A2BA 4S2SB 4K3HA 1GYCA 3V2AR 4MD0B 3ARGC 1FAIH 3EO9H 3OR7B 5J1AA 3SE8H 4DP5X 1B2WL 3TWCL 1A4AA 3NDYE 1SQMA 1UVQB 5DJCB 5EO0B 3HZVA 3ZR6A 5HI5C 5KBDA 2NUTB 2RCSH 3BZ4A 3QI9B 2ERJC 2ZKWA 1MCOL 4HJEA 4DGIL 1OSPL 1W15A 2L04A 4EN3D 3N0AA 2X0VA 1AIZA 5GRJH 3THML 1J1XL 1EO8L 2CO3A 2F74B 3SDAD 4BFIB 5C07A 1N0XH 1CI5A 4YAQB 2LFEA 2ZICA 4KUCD 4FABL 3ULUH 4LBAA 4MZRA 5ITBL 5FYLE 5L9DL 2ZKHH 4KKAC 3NGBC 3RNQA 1FZMA 4M1DL 5KOMC 1SHMA 2DY2A 1BD2E 3PGCB 4IDJL 4JUTA 5FV2A 4FLOA 1YYLH 4NUJA 1G7IB 3D1MC 1BLNB 1HIMH 2J8OA 4N90E 3GEWB 4NWUL 3MRJA 5DFVD 3B4NA 3DK2A 4RZCB 1ZT1A 1X6LA 2YPVA 4X7EC 2NUPB 2N0KA 4J2XA 4ZUUA 1DE4B 1CF8L 3Q13A 1NBZA 1QLRB 4IRJA 1OP3H 3NN8A 5AW1B 3GUTA 3RJQB 1CU4H 3QQDB 3HG1A 3MRDA 1PZUB 3BW9B 3MLUH 2VDRH 4PWEA 4G59C 4YSRA 2WKLA 3FT0A 2MNJB 1T83C 4FNQA 1MAKA 2AXGB 3RB7A 1X5FA 2M8XA 4ABVA 1IAOA 3S35H 1CICB 2NXYC 1ZTXE 4RFEA 1NDGB 4EDWL 1I7ZB 1ZLUH 1AFVL 1WITA 2COQA 5BZDA 3KPNA 3M7FB 1O75A 4NQCE 4R7DB 3IDUA 3MUGB 4WKZB 4FERA 5BW7A 4FQLL 4P49A 1VF5C 2JV6A 4XPTL 3ZE2F 3OKLB 1MLBB 1NUNB 3P0YL 5I17B 2DQMA 1J5OH 4QRRD 3ZQWA 2F19L 3NYKA 1A3RH 4ODWA 1MW3A 1PZ5A 2IPUG 3IJSB 3HEIB 1XEDA 4HXBL 5CINL 1RZKC 5HGDA 5D1XB 2GHZA 2X9WA 1CL7H 1MHPL 1DFBL 3CFCL 3HHRB 4WO4A 4I48A 5KJ4A 4K9EL 5E2VL 4C4KT 4WK2B 1U8IA 3S88L 4UMGA 3TO4C 3ZRCC 1HILA 1IBZA 1RI8A 4POYA 2AEQL 2Y3NA 3QQXA 1Q38A 4XMZA 2C3VB 4QXTA 3HE6A 3PPEA 5DEFA 4M7LL 2ZXDA 3OKEA 2NR6C 3FFCA 3GXFA 3E3QC 2XA3A 2HVKA 5J5EA 4G6AC 3GSVA 1GTNA 3NZ8A 3HR5A 3WFCH 3C5JB 3BWUF 4PS3A 1JGIA 1SMAA 4EN3B 3LKRA 5L6YH 3PAVA 3RWCB 1UB6B 1AGBA 3DSFH 4IMLA 4JKWA 2VXUL 4OI7A 3SDAB 3TBWB 3MTXA 1HWWA 1FFNA 2ZWLT 3HS0A 2SODB 1BBJA 2VQ1B 4Z7UE 5IB3B 5EU6D 4FQXA 2Y07L 2EVHA 4J3VA 2YD1A 4KZ0A 3EYOA 1KPUA 4X0KB 4JM0A 2AJVH 3ARYA 4AYBA 4NKQB 1LP9F 4HLZG 3O11B 2AZAA 3QUXA 3SDCC 3EDJA 3CFUA 5D7SH 2D7TL 4AEIH 3RHWF 1KXVA 4Z7VE 5F1KC 2PWGA 3QCTL 4I89A 2FO4A 4AUYA 3BPLB 3B3BA 1OE1A 1HNYA 5HTSA 2AQSA 3ZTJH 3ZHLA 1JIBA 2H2SC 5F1NB 2B1HH 3GJFK 3QHZH 3EG9A 4ALAH 2X89D 4AVIA 5H37G 5IG7A 1EHKB 3OF6D 4RA3A 1LD9B 1AC0A 4GINA 4M5SA 1KGYE 3KPSE 3PP3K 4Z3EA 3GHPA 1WBZA 4PJFB 2VQTA 3RWDA 3ZX1A 1LP9A 1X5LA 1XGPA 2VE6A 5KAQG 3RVUC 4ODTH 3L9BA 4NN6C 1P6AB 2VN7A 5E00A 5I1EH 1I1FB 2N7SA 4MKTA 3OXRA 4R8WH 2Y6TE 5BQ7A 4JFVA 1DBJL 3HPLA 2H2PC 4YO0B 4XN8A 3M17B 2J1ZA 4Y5VA 1HK6A 1M2VB 2VDLL 2OPCA 1L9OA 5AL0A 1NL0H 3CHQA 3PHOA 4JR9H 4OIIH 2CBTA 4PJAE 4WEUD 3UAJC 4QWWC 4BQ9A 3AU1A 5KJRH 4QXUL 5K9KA 2QADC 4N2KA 1X9LA 1FQ9C 1TPXB 1L9TA 1G7HB 1PD0A 4QRRB 1BQRA 1JVKA 2BC4B 3ISYA 3LPPA 3QWQB 4ZO9A 5FECB 3SPJA 5KYYB 4R5XA 2F5BH 1OTTD 4KQ4H 1ODAA 4TXVB 1TLMA 4LP8A 3D39E 1GH7A 3JVFC 2VNCA 3L3OB 3F01A 5CM1A 3MXVL 4F5CE 1RK0A 3D2TA 4OJAA 4POUB 4RWHA 4PS4H 1XGZA 2DB8A 2I7OA 1BMWA 1K85A 1OB1A 1CG9B 1U8KB 1TNMA 1O9VA 1TVHB 2OLDA 3ECWA 4L8DB 1PYWA 2DQHH 4ONFH 4MXWH 1CVRA 4IBQA 4PRBA 3KH4A 3NIFB 4UOW0 5LO7A 2X12A 4QHNA 2D73A 2VM9A 1KLFA 3LDBC 2YOCA 5FYJL 5HGAB 1TT6A 3T0EE 1SVCP 3SGEI 2YC1A 2YEZB 2O5ZH 2CUIA 1MWAH 3GXTA 3P11L 1XF5B 4BH8A 4X4YA 4NRYA 3RWJB 1X9QA 2LU7A 4LO9A 1P2CB 3VYPA 5DVMA 2ZOTA 2VMEA 2XA8H 1HEJC 3FO9A 4Y19D 5DJYB 2GYSA 4MXQC 5FXCH 5T5NG 3CZSA 2WXKA 1CTOA 2DWEB 3V0GA 2MH4A 3HAEH 3O0RL 1TG8A 5EU6B 1J5IA 3MRHA 3KR3L 3OQ3B 3DHMA 1F45A 3KPRA 3VH8G 1PSKL 1WFIA 4P3CH 3LPFA 1OM9A 5FYJU 1DLHA 5AB1A 3IDMB 4DQOL 5BRQA 3WTWA 3ABKB 4E9QA 2X6BA 2CIIA 3O2VH 2R56H 2ZX5A 1G6VK 4O51A 1F4YL 4GW1B 2F8XC 2FQFA 4YXHH 2B08A 4Z77A 1S3RA 4HGMA 5C70A 3W5MA 1VFUA 4ZFQA 6FABH 1AQDA 3O4OB 4XWOD 2APSA 2P8PB 4NUMA 1LO5B 4O9HH 5GHWH 3ZIMA 4XMXA 2VDRB 2IDCA 1QBBA 4ZW8A 3GSOA 5D1ZD 3UYPB 3Q6GH 4OCXL 1PD1A 3WIHL 1NUGA 2HFFA 4IBTA 4RDQF 3MBEC 4XVTL 1C7SA 1I9RL 5J1TC 2XJLA 2FEDD 1PAZA 2WLLB 2FVNA 4MB3A 3EYQD 5HBBA 3MV7E 1CBVH 3RX7A 3WTSA 2UVFA 2BMKA 5CBAB 2G5UA 4OZ4A 4QTHA 1ID5I 1YEDA 3KHOA 2X1QA 4PV9A 3OKDA 3ULVL 4J6RH 3UP6A 2Z65C 5CD3B 4PGEA 1AS7A 4MYWB 3GI8H 3KGUA 5GGTH 1ORQB 1SPDA 1DUZA 3OJVC 4PIRF 4FQ1H 4OI9A 2JI1A 3ESNA 5IMOB 3HG0A 4GB9A 3O3BA 5FYLD 3ZE0E 1S78C 3CC5A 2N7BA 4H8VA 2X6UA 4G8IB 3M1BA 2HX7A 3N42F 1BD2D 2OS7A 2WQ8A 5DMGD 5DJ0A 1KTKE 4X9YA 3V0WL 1A3ZA 1YEEH 4BRVA 4MJ5B 5CILH 1UEMA 4Q6YA 5FR3A 3SGKA 5M95B 3DX7A 5J13C 1JRHL 1GXEA 2NT1A 4MAZA 3GM8A 4U1IA 4N90D 1JYXA 4MMZC 2RIKA 1JPFB 5E8PB 3RQ3A 4JO3H 1FZJB 4PGCA 3PP4H 4P5MB 2YQGA 3LS5H 3O3EB 1B9ZA 3BIBX 4LK4A 3VGBA 4L2LA 5L4JA 3EFDH 4FLHA 2X2JA 5IVZA 1IZJA 1H3VA 3HC0A 3RVTD 2O72A 5DD3L 3DO7A 2XQBH 3G5ZB 1YN6A 4UINH 5K5YA 2VUYA 1B4LA 4YHNA 2X6VA 2PKDA 2BIHA 1JE6A 3EOTH 4IK6A 1SEBA 4MNHB 2QFRA 3QUHA 4Y19B 1EFQA 2W9DL 4U1LB 4XPAL 1I1AC 3V4UL 3HJEA 3OZ9L 4M5TA 5FGBA 4OGZA 3VFUB 4UV7H 4F2EA 5C0AD 4WTQA 4NQCD 4JG9A 3TN0D 4JJ5B 4MS8D 1FL3A 1EWHA 4YDIL 4DIXA 4P2OD 4GO9A 3OQRA 1Q90A 1ETZB 2C3HA 1F4HA 1ZLWK 3BRDA 1QFWH 4M93B 1KGIA 5E56A 3CJJA 1LMIA 4HEPG 1HJCA 1IUZA 3PF2A 3D8MA 4UB0H 3AM8C 3ARUA 4A55A 4ZO7A 2DYPD 2OQJB 2EXSA 1JFHA 4KVPA 1CXIA 3GI9H 3DDFA 1AY1H 1NGWB 3HRZA 3ULVF 1CK0L 3RU8L 4DW2L 4LOFA 2LT9A 4PAZA 2YA0A 4JHVA 3LEYH 1G1YA 5C9KA 4WGWB 4Q97A 3NESA 3S9DB 1IFGA 1G9NH 2JK5A 4QRPA 3SZKC 1UENA 4FFVC 3D69A 1B4JL 1T1YA 3WIHA 3L48A 4X5WB 1TCMA 1KGJA 2FSEA 5D1ZB 3MRRB 3SOBL 1GAFH 2YGOA 3SGDI 3OB0K 3CZJA 4GKSA 5CN1A 2BIPA 2G0KA 1X7SA 2B5IC 4PRPE 5F7KC 3MLYL 3QDJE 1EXHA 4YSDA 3UZEC 3L16A 4A39A 1OP5K 3KAAA 2H6OA 4MAYC 4EMZA 3QQNA 1M7DA 3O41A 4LVNC 5T33H 3VFOB 1R19A 1V5JA 2ATKB 3HNTH 3F58L 1EHXA 1RSFA 1I8IA 3GHBH 4ONOA 5EB9A 2E74C 1EHLH 2FGWH 4GQQA 1N64H 1OTSD 4B6ZA 4ONGH 3MODH 2BCKB 2IGTA 1IM3A 1AJ7L 5IW1B 4XBEL 4ODUB 2BSRB 1MCJA 1ZA6A 3A23A 1G1KA 2VSMB 4QHLA 5F9DC 4HIXL 5SX4I 5KYNA 1BD2B 5DRNB 1FNSL 3WN5B 1T1ZB 2WJ7A 1T0NA 4EO5A 2R69H 4KC3B 4Z8FL 4L8CA 3V4LA 2CCVA 5IMLA 4K23L 4RMBA 1NEUA 1D5ZB 3RLSA 3TS8A 1NIEA 4OSUH 3NFNB 3K8MA 3FMGH 4NKIL 1CGVA 1AOHA 3F7RA 1MVUB 3MRCB 4TNFA 2AQTA 4WHTB 3AWEA 4JQIL 5CEXB 5EBMB 1J5DA 1A9EB 1HT6A 3KPSD 4IRZH 5GGQH 2VZOA 2BW5A 5F7LB 6PAZA 3D4YA 1MWAB 4NQXA 4OZFH 1JTOA 4Q58C 5TFSH 2F18A 5KVFE 3H9HA 2XZQH 3FCBA 3BQUD 3MJ7B 4I8DA 2AABL 1W0WA 3HCVB 2EO1A 3STZA 5I2IB 1L0YA 3QIBA 5SV4A 4JB9L 1H5BC 1EZUA 3BIKB 1MJJB 2XN9E 4FTDA 5C0AB 2VZ1A 4NQCB 5FO7A 3TN0B 3QAZB 4YHYC 2QPEB 4KITB 1QR1A 3HAEB 4L1HA 4UWQB 4P2OB 4U1SA 1VCBC 2VDOH 3KBHE 1T89C 3RAJH 1UD3A 3C5SB 4LCUA 3FTZA 1B6UA 1S7SB 2DYPB 3E0GA 3UGEA 1DEEB 5TH2A 2DWDB 3FU6A 4ZUSB 3VGHA 1ZT7A 2GUOB 3D39D 4HCRL 1EV2E 3DDGA 5C0DA 2Z4QB 1LEIA 1FAKT 2ITCA 3FN0L 3UO8B 3OM3B 4GKOA 1UCTA 4CVXB 3O9WD 3AW5A 3HAEG 5IMMB 4XN5A 5GGVY 3QDAA 2IO5A 4OVVA 4W68A 4RAUB 4G6KL 3S4SB 1G7JA 5GJSH 5JR1L 4ELKA 3IBEA 1XH2A 1BMZA 4BM7A 4IU2B 1V7NH 3PRZA 4F2FA 3T3ME 4AGMA 4J3OF 3STLA 4CGTA 3QWNA 4KX8A 1C5CL 1DQLH 4ZFGH 2GC7C 4WFGE 2Y7QB 1I4FB 3T0ED 5I82A 2IBZY 3U4EA 4O00A 3EYFA 1F4AA 2NY7H 5DVLA 2JIXD 1O5DT 1DVTA 3TBSA 4EIUA 2GIYA 3QFDB 4JPKL 4FTVD 5I9QC 2F54A 5I66A 1HDMB 5LJYH 4PRHE 4JY4A 1XSIA 2ICEA 5J8OA 4MJIA 2OSYA 5GS0D 4XPGH 4UMSA 2K7QA 4Z7UB 2NY5L 2EO7A 2IPKB 3DUSA 3BPOB 1YEFL 3RDTA 5BUAA 1X4YA 4LB8A 4P2YA 4JE4B 2XV0A 4C83A 1U91A 2OL3L 3PV7A 5CNHA 1XCWA 1GYAA 2BHYA 1H15B 4X99B 5E08L 4Z7VB 3GJEB 3S6CA 2OMUB 3KD4A 2DH3A 4MZ3A 4XP1H 3VXME 1GY2A 3Q7JA 1OY3B 4TV3A 4XNMA 1Q0XH 4JQIA 3TVMA 2BP3A 4FFWC 3FW6A 1X5YA 3GJFH 4J23A 3ZL1A 5JDSA 2PO6A 4FYRA 1K3IA 3ARDD 3R19A 5T1LD 2ODHA 3KPSB 3VXRA 4YGAB 1KIUA 3ARQA 3UTZB 5C86A 2VITA 1VPOL 2BXYA 1GR7A 3II2A 3GIVB 3IDIA 2BP8A 3VGAB 4G5ZL 4BZ2H 3BQUB 5C7ZA 5AAMC 2UVEA 1TJGH 5FCUH 4FXKA 4B9PA 3KJ4B 5ACZB 4HJTA 4N2IA 3O6ML 3BZDA 2I85A 2K0RA 3MRLA 3DYOA 4PJAB 4BKSC 5HYEA 3BWSA 5AW2B 5ERWB 2NY3C 4F57L 1KYDA 2DQ6A 3DPBB 4ZS7L 5F93C 4LNRA 4M1GL 1OQXA 3DHUA 5EOCJ 4TSCH 2LR4A 3VD7A 5TDOB 4HCRA 2OTUA 2GPZA 3P3YA 3MRNA 3AGWA 5EBLA 1IGIL 4O02H 2IMNA 3Q48A 1X5HA 4XNXL 3D39B 3QPKA 4KK5D 2W92A 4PP2A 1YMHB 2PPFA 1EQWA 4WJKB 4O2CB 5T3XL 4GP8B 3O9WB 3I3EA 4HD5A 1YQ2A 4ZUWB 4DH2A 2P8LA 4KJPD 4YHKH 4GSRA 3RGVC 1BVLB 1DQDH 4U2ZA 3RA7L 5DS1A 3GSXA 4PG9A 1IE5A 2XV6B 5IGXL 4BE6A 5JOEA 1IJ9A 1DL7H 1R24B 1JZ4A 1B0WA 2D7OA 4Y4KB 4OIBA 3T0EB 1QLEB 1QA9A 1VCAA 3MREA 2XQYK 3DV4A 1ASOA 5D7KE 4CN6A 2WC7A 5C3TA 1LDPH 3ZHNA 1U4FA 3JXAA 4IOIB 4M5ZH 1QZNA 1T5XA 2JIXB 3EKCA 3NAAH 5KVFH 4JN1L 2YAQA 4QGTA 2DBJA 1A6AA 2QPSA 4FTVB 1BG1A 4Z95H 2EDEA 4M29A 2MNWA 4GG6F 3SYCA 1QSEA 1F4WH 2PCFA 1OCZB 4GRWH 3V7AG 5EEUA 2PTTB 1CD1A 4LRNH 1QSZA 3AT9A 3DX0A 2OL3A 2R2HB 1AG6A 4QHPA 4AYFA 1NBQA 1WK0A 3BKJL 4QRBA 2HXAA 2ZCHH 4LRIC 4PS7A 4W9HC 4CKQA 4Q52A 5C0JA 4W6YB 1VFAB 4RFOL 3IMSA 5EZJB 4OFKA 2ENSA 1W8EA 4DSYA 4XNUL 5I15H 4APQA 5B8CC 1M1SA 1WT5C 4MJ6A 4ZAKC 4GG6A 3P3SA 1HSBB 5CJQL 2RAMA 1KGCE 4JHWL 4K94C 3C2AL 4H8QA 4RFNB 3K71A 1CIUA 4LVOB 1CJYA 5E6IC 3ARDB 5T1LB 4I0KA 4M7KL 3J2PA 4CU7A 4JMNA 1Z0MA 4YH6A 4PG2A 4PJGF 4I3SL 1OCWL 4XCYB 1CLVA 4MTMA 4JFEE 1JZGA 1HSAB 1EGJL 3ARBD 1OTUC 1QNIA 3N5AA 4UANA 2G4GA 1CXHA 4PRPD 4YX2L 2Y23A 4NO2A 2W38A 3QDJD 2XWBA 1ML0A 2Y0SA 3JWOL 5I30L 4FJ6A 2FWSA 1NAMH 4WI3A 2WLIB 3CZEA 1KSRA 1A6UL 1FCGA 1FBIL 4M00A 4IRSD 3UABA 5IY5B 2V3DA 4DGYH 5F7HA 4NERA 5HHOA 2CHXA 1NGZA 3ZT7A 3MMEA 2CSPA 3NCFB 1M9WA 2ICWB 3KPQA 3GZPA 4YQXH 2H8PA 4YHOH 1XGUB 1YY8A 5D72L 4OZFG 2OA9A 4PJGA 2P47B 4J4PD 2IH3A 2Y1VA 3R8BB 3Q0HA 4POZC 5DLLA 4YGVA 2IBGA 3U0WH 1YEGL 3KMDA 2FEEL 1FN4A 2WAQA 4JRYA 2NDFA 1JZIA 5TQ2H 5I0VA 2IV9A 3SBWC 2R4RH 4M62H 3P4NB 1U8HB 5JXEC 4FZEH 1EA9C 4MD0A 1AXSA 4IU3B 3SY0B 4BQ8A 3E6HB 1ED3B 2CLRB 1NGYA 3U9PL 1A6VH 1RKRA 1E6OH 4PRDA 5DJCA 1FDLH 1GZQB 4LSPH 4RISH 1ZT4B 3X3GL 1N67A 2QELA 4LSRL 1UZ6E 5T3ZL 1QLFA 2OZ4L 4GIPD 1R5VA 4NNPL 3LZFL 3C8DA 1I1RA 2BZDA 4H88H 4DUVA 2E27H 2EZ0D 5J6GA 3LRGA 4UIMA 4CC4A 2VWEE 3DRTA 4FX5A 1EJ6A 4XZUB 1U2CA 1U8NA 3AS1A 2VIRA 5EBWB 2CA4A 2CDFB 3ZKND 2DLGA 2NLJB 1XB3A 3D30A 3PGDA 4NCDA 4L0YA 2XN9D 3QJQB 5K9OA 2DDQH 4TNEA 1OLZA 5EFIB 2VJXA 1VEOA 1VESA 2P49B 3RIFK 3PGCA 4Y9GA 3VFTB 4E9RA 1G9MC 2WBJA 1NUFA 2XV2A 2WXLA 1UWEH 1G7IA 4WU5A 1TYEB 1ZLWH 2DQGH 1NPJA 1IQDA 1RIHH 2H32H 4ZTPL 2B1AH 4G2AA 4HIIA 3F83A 4ZQKB 3CSTA 3AITA 4RZCA 2QSCH 1WISA 3FOMB 2NUPA 4AYSA 3QHFH 5IK3B 1TZHA 4PJXF 3VFNB 4UT7L 3S35X 2A73B 4GSDL 4NLAA 4OLUH 3QQDA 4JKMA 4TL4A 3BW9A 5IJVB 1D7FA 3C6LC 5ALBL 1LK3H 3GJFB 1Q9LB 3MNWA 4GKZA 4HAKA 2YRBA 2X41A 4DCQB 1S9XB 2WZPA 4RESB 1EGJA 5L0QC 2DQCL 4WY7H 4PP1C 5DZOA 4ENZA 3GMLA 3K72A 4IBLT 4KDTA 3CSFA 2ADFL 3ARBB 1QTSA 3EJUA 3OB0H 3FT3B 5KYXB 2HT4D 3HLAA 4PRPB 1AGFB 3UZVB 3K80A 4WHDA 3FRPB 3QDJB 4R7DA 2VCOA 4PJXA 3RURA 4RAVA 1Q0YH 3T8VA 4QRSB 4YXLL 4NQQA 1OP5H 8FABA 2UYLA 3KS0H 4IRSB 3LZRA 3OKLA 1MEXL 3BLKA 5D4HA 3D3VA 4YE4H 5IP4A 3ASWA 5I17A 1KGXA 2XLLA 4WF7A 4BEIA 3B9AA 4HW6A 4PJIE 4OKVB 4PRHD 2D0FA 4L0ZA 5JQ6H 3SDYH 1NH6A 2BHUA 5CP7A 3QORD 1NCOA 3DV6B 4YSTA 3FRPG 2R0LH 1E4XH 4JO2H 4Z7NF 3BRGC 3T77B 3CSYB 2I24N 2VXVL 5D6CB 3SBRA 4MA1B 1ZSDA 1Y0LB 3ILQC 3DTUB 3V9FA 4KU1A 3QAQA 4DKEH 3GSQA 2V8MA 3BWZA 3JWDC 3MBWA 3D51A 4FE9A 1FGNH 1D9KD 4MMYA 2OXGB 1XH3B 1LK2A 4OAWB 4WIQA 2QPFA 1QWNA 2F9BT 3PS6A 4IRJC 1UA7A 4KY2A 4BKLB 2EDKA 3AGVA 4PYGA 1QHPA 3UMTA 4WENB 6PCYA 4G8FB 5D1QD 3I9GH 1NC4D 1FAIL 3EO9L 3WEOA 4WWKD 5D2NE 2DW5A 3CFEB 3WG7B 3SE8L 2DQFB 5KAQF 5TDNB 3EJZC 3IFNL 4TL5A 4GO8A 2LQRA 1FFPA 1PZAA 4EN3A 3GGWA 2CG9X 2SEBB 2RCSL 5IMKB 1YEKH 2H47C 1NANI 4LLQA 5FKAA 3QIUA 1E7VA 1CDCA 3S5LG 3WL9A 5TGBB 3EO1B 2FHCA 3BESR 4PJDF 4QRUB 3VXOB 1A14H 5GRJL 2ZUSA 4X5XA 2BOCA 3UROR 5JZ7D 5IB3A 2XN9B 5H37A 1FIGL 2WIMA 1N0XL 5BW7C 3T0VA 4X0KA 1DDTA 3S3JA 2MCAA 3ULUL 4HUWB 3O11A 3GMNA 3K2UH 2ZKHL 2JTYA 1E5BA 1NIBA 3NJKA 3LXUX 2B1OA 4KJWC 4L29A 1PX3A 3CXFA 4UDUB 3SE3A 5GRVL 1AHMA 1YYLL 2LGNA 5FA3B 3HJ0A 4PY8J 5D7JD 4QYOA 5I1AB 3C8KA 1HIML 3DBXA 1HXMB 1A3LH 2H45A 5F1NA 3SY6A 2HA1A 4CA4A 3FQXA 1CDJA 4PJDA 3VGFA 4B9CA 4WO4C 3RGHA 1KY7A 1CGXA 2DLHA 2X2IA 1X9UA 5BJTA 2VDKH 3SCMD 1BIIB 1GSMA 1CU4L 4DP4X 2XPZA 1E9QB 2JQAA 3MLUL 4RWYH 3QDGE 2VDRL 2XWTA 4K7PX 4QRAA 1I1FA 1RZGB 3HE6C 1NEZB 2ISDA 3T3MB 1JUFB 4WWNA 4IIQA 3O2DL 2UX6A 2J57A 2X4PA 2XKNB 5ISZE 2B2XH 3VD2A 3C6SB 3AZUA 4KXZI 1MKFA 4OD3H 4AKOA 3W82A 1M2VA 2Y5QA 1SJMA 1ES0A 1BP3B 4N1CA 4TQ8A 2V7NB 2X7LB 4NKDA 5D7KD 2X40A 4H26B 3L7FA 4P46A 5J12C 3TO2B 1WWBX 3KVPA 1G7HA 3NEEA 5CHNB 5T5NF 3ESPA 1TF4A 3B1TA 1CXFA 4JFOB 4LARH 5B3JE 1Q9OB 1HXKA 4KO6A 2BOLA 4PRHB 3QDMA 4YBLC 3GLZA 3VB8A 1J5OL 3HS0C 1YMMA 2Q2EB 3CIQA 1OP9A 2ROXA 1A3RL 3WY3A 4FQXC 4UOZA 3RJDA 3QORB 3FF8A 2EYRB 3F6JA 5AZ2H 2O6DA 2TAAA 5HYJA 1CIDA 3IXTB 3QUXC 5AVRB 4JQVA 4BFNA 1DZ0A 1CDUA 1H0DA 1CL7L 3BWUC 1KXVC 2IDQA 2F7OA 2R9HC 2BP0B 4L8DA 2BVQB 4PW4A 5C0EB 1U8JB 3Q2NA 1D9KB 1S6NA 3P02A 2FJFB 2I26N 3ULUF 1KB5L 2ZYIA 2AXJA 4LQ1A 2DIJA 3FQ2A 5AFAA 1KGCD 4H1LH 1GMEA 1JK8B 1B6DA 4HFUH 5D1QB 1UT1A 1NC4B 3ZKSD 2YEZA 4WWKB 4Z18A 3VH8A 2XWXA 1SJEB 1QHQA 2EIBA 5HGHB 1C8PA 1K72A 1F3DH 1E4KA 4NQTA 3RWJA 1JNHB 1J11A 1UM6H 1CLOH 1FA4A 2CJSA 4L48A 4JFED 1QSFE 3UTOA 5DJYA 3WFCL 3TF4A 1AKJD 3WXVH 4R83A 5L6YL 4WI5A 2DWEA 3KBEA 2NW3A 2CK0H 3DSFL 3I6KA 4Y5VC 1DJXA 1PNDA 5D9SA 4U31A 1KENH 1MXDA 2CDEB 3W9DB 4OGYH 4UNVA 4AENA 3VW3H 1JI1A 2XWDA 1M6OB 3IDMA 3RZCA 3N1PC 2GW5A 2CIKA 2VLKE 3V9EA 5JIPA 1OV8A 3QWOA 2AJVL 2MOGA 3L9YA 1IBHA 3L3JA 4P48A 2GBUA 1KTBA 2MQGA 4PCSA 5B1BB 2H32B 2Y3AA 5DTFB 2QL1A 5D7JB 3VXSE 3LKNB 4S0SD 1A25A 5F3HA 1WAPA 2X89A 2VLLA 2BS71 4A7UA 1L5GB 2E56A 1LO5A 4LOVA 5GRWA 4EDXA 3V4VH 2B1HL 1S7RA 4ALAL 2V9UA 5AOKA 3L3KB 3SCMB 5FDWB 2Z31A 5AYUH 4H8PA 1E2WA 2VAAB 2OCFD 3O2DA 4FNSA 3WN6A 3BGAA 1ZJAA 2GTZA 4ZPTA 2ZOUA 3CN3A 4U49A 4JG0H 5C0NC 2WLLA 4H5SB 4ODTL 3T6ZA 1KOAA 1T6BX 4MWFA 4AM0B 5I1EL 1GGBH 1XHHA 4LHUG 4R8WL 4XCNB 2J12B 1KCRH 1BQHG 4V2BA 2ICES 2F6AA 3DGGA 1SXNA 4F7EA 1HCVA 3TEYA 2V7HB 2W0PA 1J8RA 4GIAA 3AVEA 1SJVA 2DTMH 1NL0L 4JR9L 1V54B 4GP4B 4OIIL 4N2LA 4TNVF 4XTRD 4RMRA 3SDXE 3ZYOA 1LILA 1ORQA 2I7SA 4YVUA 4XPFH 3L5HA 1H8OA 2O6PA 3MROA 4UZSA 1TKWA 4EZJA 1LE5B 3I6SA 2WVVA 5B1AB 9CGTA 5LXGH 1QABA 2CBQA 2J1WA 4O4YH 3OKNA 1CR9L 2F5BL 5CEYB 3UIZA 3DGCR 5FFGA 5F0JB 5J6SA 2UZIH 3L9RA 1P53A 4P57B 5I74B 1UB5B 5LB1A 1I9IH 3KYKL 4PTTB 5B1JA 1RH8A 1PTZA 4DKDC 1NUDA 2WO2B 3AB0B 2F7PA 4EXPX 2ZUQC 1KB5A 1PDKB 4BRJA 3LYRA 4PS4L 4F7KA 1I9JH 2HFEA 5IIEB 4FXGA 4K5PA 5LXVA 2XXFA 2AQNA 1IGCH 4G72B 3TBTA 2DQHL 2QPUA 1LYQA 3KCPA 2DQUH 3S3PA 5JLZA 1AP2B 4OGAD 2MMXA 2JELL 1KCSH 1HTYA 3OAYK 4PWJA 1KWKA 3JV0A 1EBAA 2ZX7A 3T2PA 3G5ZA 3KPPB 3QFJE 4HEPA 1LO3H 4P23A 2V3FA 2NT0A 2O5ZL 3ZSTA 1MHEB 3BZEA 1MWAL 4MNHA 3QZLA 3MOBH 3MRIA 4JFEB 1JRHI 4ANUA 4X7DC 5IJKC 1UT2A 4ORGA 1THAA 3PWVB 4OLEA 4Y19A 1AKJB 4LLYB 1P1ZB 4IEFA 4FKEA 1ADQH 4N2OA 3VFUA 4IOSA 4A7QA 2K8MA 5GRUH 1IMHC 2XOTA 4F3FA 4MA3A 4YK4C 5I8CA 4KTDH 2DZEA 2AEWA 4QHKJ 3LD8C 4GAJH 1X5JA 2R39A 1YEJL 2MJWA 3DXAA 4P3CL 2OQJA 2G2RB 3ML8A 1N18A 2PCPB 4NIKB 1P1VA 1EX0A 3O2VL 5ICZB 2R56L 4KWUA 3ZL4L 4YFDB 3D7PA 3RTQC 4JBSA 4G7YL 1KCLA 4YXHL 3V9CA 3WHXB 4NI3A 4PY7B 3SGKC 2B0SH 6FABL 3QXVA 1HINL 2BM3A 1VERA 4X5WA 2VDKB 1BW8A 1JJUA 1RUKH 4LCCB 1WFTA 3JT0A 3AABA 3PYCA 5GHWL 2HLEB 4ZMVA 4F2ME 4ZMOA 1I1CA 2C7UB 1UXWA 3BGMA 1SYSA 2DIAA 3Q6GL 3RE0A 3L4UA 3JV4B 4NQEE 4BFBD 2B39A 2AJ3B 4U7KA 3HI6H 2ATKA 3BH8B 2AQ3A 4F58H 3ASOB 5I6LA 4HGWA 5HHQB 1CBVL 1XEUA 3ARGD 4DK6A 3VAEA 1QEWB 3FTYA 1I85A 1MZZA 1H19A 2PF6A 5KSAC 4M3JA 2F7IA 2XWEA 4TUOA 4J6RL 1U8MB 5HI5D 3QZOA 5FGBC 3IFOA 1BVZA 4N0RA 1G7LA 3QK0A 2FNBA 3ILDA 1DVYA 3GI8L 3VFWA 1XWVA 1FJ1A 4DK5A 1IL1A 5GGTL 5AOJA 3RWEA 4FQ1L 2QR0B 2BNUB 4FXTA 1VADB 5I76A 5ESQB 2UZYB 3B7RL 5I16A 2WTRB 3BAIA 2CM5A 2YBRA 4LT7A 4TVPE 1OIOA 4FAAB 1YEEL 3SE4C 4P9HH 5CILL 3GXUB 1KBBA 4KKAD 4R26H 5CZVH 3NFNA 5GS1A 1AZCA 3T08A 1CS6A 2R2EB 2W80C 4U1GB 3HRZC 4PV8A 5IVXF 3TPUA 1T03H 2CPUA 5CEZE 2DI9A 4S1RL 1ZMYA 3MRCA 2IV8A 3IB4A 3MRFB 3CDGA 1QBMH 4H1LB 1A9EA 1YA5A 3ALXA 4JO3L 3ZRSA 3AQYA 4G70B 1QD0A 1FH5H 3PP4L 2GAZB 1HVXA 3LS5L 1MWAA 1Q94B 3A47A 4PJCF 4AE0A 3EOBA 1QZ1A 4HZ1A 2CO6A 2OJEA 3EFDL 1GYVA 3QDGD 4H7VA 4W6WB 1GPOH 5D7LE 2WNGA 2WANA 1JWSA 4F33B 5JA9A 2LHAA 4NDMB 4ODSL 2XQBL 4UINL 1QWHA 4BFGA 1EFXA 1URIA 4LMQI 5DMIH 5F1OB 4M5YH 5MERB 3EOTL 3BIKA 2D0HA 5C0AA 4MRCA 3FO1A 4BJLA 2L7EA 4DAGH 2B3RA 4IMKA 5T1JA 4R7XA 5IVXA 1NBVH 3HAEA 3QUZA 4P2OA 5CCGE 4UV7L 1G43A 1F41A 1IX2A 4WEMB 3T0BA 3PUUA 2CA3A 2I5YH 3RI5F 4P0DA 4XAKE 3Q1SH 4KKNA 1FG2B 2IALB 3JZYA 4PJCA 2YXMA 4PJIB 4KY1H 1B0GA 4WO0A 1QFWL 2DWDA 3CPLA 4ZUSA 3AMLA 2X1PA 4UB0L 4GXFA 1R33A 2VRAA 4NKMB 4ABQA 3S8WA 3S0PA 3GI9L 1AY1L 5FUCC 3T8MA 4CVXA 5H94B 5T1MB 3E80A 1OE3A 4D9RE 4U1NB 4HHAA 1EDHA 1NCWL 3LEYL 1ZE3H 4HK3N 4BINA 5EU4A 4OQ1A 1G9NL 4RGNC 3MO1B 1KTLA 1E8YA 1T2XA 1N59B 3CFNA 3IS0X 5E4IA 2UZXB 2PNDA 2P46B 3P0GB 1GAFL 1PJWA 4JO5A 3FFOA 3TO4D 3RX8A 1ZGLP 4HJ0C 4BK8A 2VRKA 4NKOA 3H4HA 5D2NB 5B39B 1RJZB 5IHZB 5J89A 3ZKQD 1C1EH 3FONA 4YR6A 3AG2B 3REVA 3LVTA 4LSDA 3ARGB 4WFFD 5T33L 5MEPB 2JCWA 3HNTL 4D0BB 2WVTA 4RIRA 4LCWE 3VI3F 1MOEA 3GHBL 5B38G 3QIBC 5GGTA 1F56A 1EHLL 2DKSA 4RNRB 5HJ3B 2FGWL 5JHDE 3B2DC 4LSVL 3W3BA 1N64L 4WDIA 2ERJB 4K7FB 4PD4K 1Q4NX 4ONGL 4PLKC 1A6ZB 3QEHB 2BVEA 2DF3A 3L5JA 1OAZH 4XI5C 4W9FC 3RIKA 2FATH 3ROOA 2ADIB 3KYNA 5IROC 2VLKD 4MD5B 3ZU8A 4L9LA 2YGNA 2ENJA 4UV4L 1ADWA 4P5TA 3W1ZA 2V9QA 2FJGB 2XQYG 1S46A 5KJ7E 2VR9A 5E6SB 4TLKA 2R69L 2DYRB 4FQQA 1XAUA 1E28A 4I5BB 3VXSD 3VI3A 5BVJA 3UTTE 1LM8V 2NQCA 4OSUL 3DWTA 3FMGL 2JJSC 1T3FB 3KPSA 3L5IA 1IGYB 3UTZA 4UQEA 3UPCA 3PABB 4LPWA 4HU2A 3D5OF 4L5FE 4NWTH 2ESVE 4ZBJA 1WDAA 4QOKE 4IRZL 5GGQL 1LO2L 3ARSA 1G4MA 3QDGB 4E5XB 5JW4M 3PIQA 2H2SD 3BLPX 3QJZA 4Y9BA 3FT2B 4NCC1 3BQUA 3LQZB 3CCHB 3SBPA 3HMWH 2AMGA 5TFSL 2MEJB 2PW1B 4GQ9H 2MCMA 2Z0BA 3H42L 4MCZA 2OYLA 1UKTA 2XZQL 4K4KA 3U7AA 1T4KA 3RVUD 4IJ3C 4KDVA 4YLQT 3H7BB 5CFAA 2RHEA 1MJ7H 5C71A 2I9TB 1DBMH 2GTWA 1DO5A 3KPMB 2HYMA 2Y36H 1I53A 5BZWA 2JLLA 2H2PD 1TTAA 3QS2A 1XR8B 2VDOL 5F7BA 3RAJL 1NCAL 1S9KC 3UAJD 4J3OC 4J1UB 4QWWD 3KYMB 4HU8A 3CFKB 3HE7C 3L3HA 3SEPA 3IFLH 1T6VN 4R96B 2VLRE 4JZNB 5GRYA 3RDTC 2TSBA 4ZG1A 4PVNA 5DYFA 2H26A 2HT3C 1JN6B 3DYPA 4UI2A 1X9RA 1FV1B 4ZUWA 1UWXH 3MLPA 4HWEH 1ZHLA 1BVLA 3SQRA 1DJGA 3X13B 4FOMA 5CEZH 3TVMC 3IDYC 5GJSL 3MLXH 3T6VA 4NS0A 3HC2A 5CZRA 1V7NL 2FYYA 2ZOLB 4Y4KA 2PO6C 3TO4B 3JYBA 2F7QA 1Z9MA 1A8ZA 2NZIA 1DQLL 5GGUB 1A0QH 5L2KE 1EEYA 2HJFA 3B5TA 3QFJD 5JOPE 1CFQA 5LN8A 3BO8B 4Q56A 3MLWH 3TASA 3GZOA 3KDPB 4FTVA 5BXFA 2FWUA 2NX5A 2NY7L 1KMGA 2K45A 5DZVA 3CQPA 3TYGH 5BO1H 3S2AA 5DT1H 4FXKC 3FJTA 4H20H 2CALA 2PYED 1B88A 3FQWA 3N6YA 3CSBA 3KG5A 2YD5A 5DJ8B 5A7BA 2EUWA 3AQDA 4XNZC 1KWGA 4XPGL 2GJZB 2HG0A 4OV6F 5C2BH 5EU5B 5ELIA 5CZXC 2Z9TA 4XB3A 1FH2A 4NUGH 2V0AA 2XPGA 3NPSB 2VLKB 3EH2A 4L1SA 4LLVB 1IGFH 5ENWA 4XO5A 2R69A 1X5IA 4ZW6A 1VFAA 3FN9A 2EC9U 2GBTA 4FULA 4V33A 1H6EA 2LAGB 5C0FB 1R17A 1T1WA 3LIUA 3CTTA 3VXSB 1NC2D 5D4JA 4GUOA 4XP1L 3RKDC 3W81A 2L8AA 5CF3A 5IZ7A 3VNYA 2XXCB 3PXHA 4LL4A 3S37H 1Q0XL 2EYTA 3ARDA 4IRZA 2A6KA 3ARPA 1NMAL 2N7AA 2NCEA 4BWUA 4D2NA 3QNYA 5LBGA 1ZWIB 1U8OB 4OZFA 3EYVA 1VKXA 2X44D 4V1DE 4QKXB 1J05B 5BRZE 5FM5O 2CDGB 2AGJH 3O8XC 2YO3A 4MNGA 5C0GB 1TTBA 5E1IA 5CO1A 5C92A 3IRPX 4O2EB 3BD3A 1I3RB 5I1DB 4NQED 4BZ2L 4FCHA 3H85A 1Z9OA 1UXSB 5FCUL 1TJGL 1WS7A 2NRDA 2ODIA 5HDLA 3BWAB 1WHPA 3NJVA 3HNVL 3MBED 3K6FA 3OC8A 2QLVB 1XGUA 2WYIA 3SDXB 2YAMA 1BAFH 5AW0B 2OBGA 4YBQC 4BUHA 2NY5C 3EO0A 1QR4A 5I8OH 5I6MA 2EUVA 3KNBA 4TSCL 3NOIA 4OCWH 4LP4A 4XNQA 4TLSA 5JMOC 3CZKA 2ZAIA 3QQ9C 2G9KA 4LASH 2PR9A 1IC7H 1MY5A 1XGTA 2BIMA 4O02L 1AC6A 1FZKA 4EZMA 1MPAH 2GK0B 1CXEA 5MEOB 3K6SB 1S78D 1BIHA 2HLAB 1H8LA 4L37A 1GOGA 4M4RB 3SY0A 3FH8A 3Q8FA 4TPRH 4G8GE 4YHKL 2CLRA 3CAFA 3WGUB 5CEZD 3VRIB 1DQDL 1ZT4A 1O7VA 3JWNC 1BHGA 4N87A 4HUUB 2R7EA 3QZWB 4JPQA 1T2QH 2WB7A 4WHYH 4L5FH 4F7PA 1DL7L 2EDOA 2FEEI 4U6XA 4WVRA 3UYRH 1U3HD 3QFJB 2NYYC 4DQAA 5J7CC 1A1MA 3KPOB 3FB7B 1UURA 1GZHA 3GBLA 2Y1ZA 3JV6B 4LLDA 4K3EH 3C09C 2JB6B 4NZTH 4XZUA 1LDPL 1U8QA 3RVVC 4HDIB 5EBWA 4TNGA 5DR5L 3VD5A 4M5ZL 2Q76A 5KVFL 3NAAL 4Y4HD 1CFSB 4FG6C 4C4UA 4CVWA 2PYEB 3VI4E 5DFTA 5DO2C 2WUBH 3SPVA 4UM9D 4OCLC 4CC0A 2VDMB 3L2MA 1F4WL 1YHPA 2G60H 2OZNA 3MV11 1HXYB 5HHPB 1IEHA 1HOCA 4AH2A 1M7XA 3MRKA 4XAKD 5D5MB 4L0PB 4LRNL 4PGZA 1I1AD 1VACB 3P3RA 1A4KB 1I8LA 5F1SA 4DKFH 2ZYHA 2C1PB 4G1MB 1N3NA 4ZQKA 1IAMA 2ZCHL 5KYWB 1BJ1H 3DVNB 4HWZA 2BPBA 5I8EA 4APXA 5LGKA 3BSZH 3O3DA 3EFFB 3RPBA 4GS7B 3MKGA 1T20B 2NNFA 3FUMA 4WZ9A 1NC2B 5DRXA 2V2WB 5I15L 2DQEH 4NIYE 3IRCA 4L8BB 2QDVA 5HHVH 1UACH 4UILH 3PWNA 3GJFA 4EUPB 1Q9LA 2EH7H 3IJHB 4D9RD 3SPHA 1CT8B 3OAUH 1S9XA 2LU5A 3R0MA 4PJEF 4ISVB 5I0WA 1OB0A 2HVJA 1T04B 4PB9H 1S9WB 3QRLA 1R46A 3CG8A 3ARBA 1M1XA 3EDKA 3BYTA 5JIKA 4B9GA 1W72B 4B27A 3B9KD 2X4NB 5F3FA 4F2MB 1C12B 1BREA 1FC2D 4PRPA 2BOBA 3V0IA 1AGFA 3PWJA 4ELME 3D2UD 1N4XH 3FRPA 3QDJA 3TIEA 5KUKA 3VXUE 2A83B 4NP4H 3WUWG 5I18H 4NQEB 1DVZA 3QI9C 5BUPA 2CRIA 3QVAA 2FHBA 2LV4A 1MCHA 2VR3A 3MNVA 1IGMH 4L9DA 1EMTH 4CMMA 2YEQA 1NAML 3DECA 5HPMA 2VUKA 3RWHB 3K6OA 5A16B 5KVGH 3MBEB 3FB5B 4CC4C 5E1AA 2ZCKH 3KPLB 4PJEA 4LCWD 4OKVA 1H8NA 4E9VA 3L7EA 3N44B 4ZFFB 4XMTA 2XPYA 3ZUCA 3GMMA 3V52H 5L4FA 2B20A 5L4IA 1XAKA 4I77H 4YQXL 5JHDD 1O5PA 1IM9D 2VKWA 2A4ZA 3P69A 4H13C 5DHMC 5IFHH 1QO3B 5D6CA 1WBXA 4O02A 3C5ZD 1KCUH 2WBJC 1XTLA 3KCWA 3U0WL 1E4JA 4V11A 1IGTB 3S5LA 1J0IA 3DVIA 1GKEA 5TQ2L 4YDNA 4OAWA 3D50A 3OG6B 3TIDB 1ZVSA 2R4RL 4M62L 3LRSA 2C9XA 2PCYA 4WUUE 4FZEL 2H7WA 3UTTD 3WEMA 2P28B 4GRWF 2VJ8A 4OJEH 3HZYA 1HI6B 2J21A 1F5WA 3NA4A 3PCYA 3SB3A 3MGAA 3EGSB 4OT1H 5IHLB 4WV1A 2DEYX 2H5UA 1MFVA 4PW9A 1A6VL 3GK8H 1E6OL 4MMZB 3EZ8A 4LSPL 3BUYB 2ESVD 4RISL 3FHEA 4QOKD 4WWPA 5F2FA 1U3HB 3NCYP 4A6YH 5L8LB 3AXLA 2DMGA 1A1OA 1KIQB 2ZOWA 2WINA 4XCEB 1CICC 3D4CA 3MCKA 3QRFM 4XGZA 2HSIA 3WNNA 3PAZA 4H88L 4HKZA 5EIIB 2E27L 3VXOA 1OAJA 1IC1A 3DA0A 4KJQC 4Y4HB 2ZT9C 1RD6A 4YDKH 4DKTA 3ESVF 2A74B 1RLWA 2BLFA 4I2XE 1XZ0B 3EBHA 4UM9B 3EUDA 3CN4A 1E3ZA 3HG2A 4ZNCD 3RWFA 4HUWA 1FNEB 4W4OC 5HXMA 2DDQL 2CCLA 3S36H 4Z78A 1CGUA 4JKNA 4OCNC 5D8JH 1DBAH 2JMRA 4PCYA 3BAKA 1I1AB 1MW0A 5DUJA 5FA4B 4NPYA 3CLWA 4XBPB 1WEJH 5FA3A 5DMJB 1AD9A 1UWEL 4OD2B 2H3NB 2DQGL 1YPZF 1U4EA 2B1AL 3ZE1F 3ZDXF 1BF8A 2GJPA 1HYSC 3M8OH 2VLRD 4G9FE 4KVNL 2QSCL 1KEGH 3CH1A 4WCYH 4WAFA 3VFGH 3QHFL 1IBGH 4U3SB 2NY2C 4X6DE 4W9EC 1SN2A 3VRLE 2HP4A 1NDMB 2RMNA 4FHKA 2V9RA 1LK3L 1RZGA 3FBKA 2PW2A 1NEZA 2BSBA 3X14B 1PFOA 2MQ0A 3GMRB 4P4KA 1JHTA 3C6SA 2JJTA 2Z7ZA 2ZP0T 3B9KB 1A4BA 4WY7L 1TO5A 2GY5A 4WW1B 5IB2B 4U6HB 3D2UB 1YPZA 3U79A 1ET5A 1FNHA 2V7NA 3IBOA 1NAMA 4W9CC 5DUBB 3TNMA 5L2KD 4EN3C 2F68X 5T5FL 4JL2A 1ZGLB 2N3JA 4UU9A 2Z8SA 1SN5A 3QIUC 2IXQA 2A6IB 1NICA 4KTYA 1KLGA 5D7IF 4JFOA 4CNIA 2BX5A 5L88H 4KNQA 1WZLA 2NNRA 2X1WL 1YEHH 2A6JA 2OMWB 4LCWB 5LCVH 5B3SB 2R23A 4YE4L 1IAIH 3FFDA 4ONHB 4YPGA 1F42A 3INUH 4WWID 5JHDB 3NFSL 4LVNB 1IM9B 3PHAA 2HFGH 1MFBH 4JM2D 3JYCA 1FHNA 1N2RB 2D31B 2RB8A 2DM4A 3SKMB 3VFSB 1JV2B 3IXTA 4Z7QE 3C5ZB 1MFCL 5JQ6L 1LWHA 3SDYL 2ZZUT 5C07E 2R0LL 1E4XL 1FFRA 3F5WB 4JO2L 5C9JA 1OAQL 5L4MA 1G7PB 2YAHA 3SE3C 5DFVC 3QJFB 1PG7X 4B9YA 4JFPB 5D7IA 2FJFA 4G43A 4DKEL 4NENA 5JW4Q 1PKQB 1CFMA 3QXAB 5CKGA 1FGNL 3UTTB 1TZGH 2EH8H 5D1QA 4F7MB 5ANMA 3UYOD 2AAVA 3H2PA 4NYLA 1SLXA 5DJZB 1GCFA 1HHHA 1AR2A 4NFDA 3T09A 4XRCA 2XT1B 3I9GL 4UQAA 2IF7A 2KL6A 2AP2A 2ESVB 4QOKB 3MRQA 2GITB 2F53A 1FVDA 3B7YA 4V1DD 1CL7I 1JZDC 2ZAHA 3CBJB 1I9EA 4LSQH 4EOWH 4JPSA 4N4YB 3V8OA 3HG1E 2EE3A 4Y16A 1YEKL 4AEIL 1A2YB 1BECA 2WK2A 3S96B 1SHSA 4GT0A 2CDEA 4QXVA 3KW8A 2W0KA 4U1HA 3HIZA 5DA0B 3C08H 5CSZA 1A14L 1ODUA 3COOA 3F2LA 2QTVA 4P46C 2VTFA 1U95A 4P9MH 5H35B 4PGBB 1DUYB 1H3GA 3CK0H 4GRMB 4L8SB 1KDJA 3GB7A 1AS8A 1B0RB 3D0VB 1NLBH 1ZK5A 3K2UL 3N85H 2H32A 2F08A 3B83A 4OFPA 4ZOAA 5DRWA 4KJYB 1Z9NA 5D7JA 4YHYB 5EBGA 3WU1A 1HH6A 2EIEA 3GTTA 3PNRB 4LHUA 1BQHA 4MQTB 3NJHA 2VLRB 4A2MA 1S7TB 1MW2A 2EC8A 4OFDA 1HQ4A 5GGSY 3UEQA 1A3LL 3WFHB 4JQVC 1VSCA 5DC4B 1UD6A 1YEIH 1HJBC 3QUMH 4ZUVB 5EN2B 1WWWX 4OUUA 3B2VH 4U1KB 2AEIT 1D5MA 4FNPA 3L45A 2VDKL 3MLTB 4JCLA 3Q8CA 1Y6KR 3NJMA 3KLAA 2ZG2A 4G8GD 3I02B 4H5SA 4RWYL 2XRAH 2ENQA 4N24A 4PI0A 4QR7A 4AQ1B 2Q86B 1DJSA 1G5AA 3OGOE 3OJDA 3PUCA 5T5FA 1PBYA 2B2XL 4M6OH 2V7HA 5EC2A 2C9UA 4X6FB 1FUNA 2ENYA 4QT5B 3RGVD 5L2KB 4FDWA 2XTLA 3GSWA 3HI1A 3CVIH 3VU1A 4JO4L 1ZPUA 4KOBA 3FFCE 1U58B 4RMUA 1JYWA 1KFAH 4A7SA 4P2RA 2O61B 3TYFB 4UTBH 3H53A 2CH8A 1UD4A 3BN9D 3ULUC 2JKLA 4LARL 1WV7T 4FFZH 5FOBB 4LEXH 4JM2B 3M46A 4HQQH 1L7IH 1YUHB 3FN3A 1MLCB 3US9A 5IWLA 4XE5B 2YMXH 1REIA 4PTTA 3TCLB 3UBXG 3PY9A 2GJ6A 2VZUA 5AZ2L 4GAYB 2B14A 2E8ZA 3QHTC 2HTLD 3KBPA 4YFLF 3SO5A 1NKOA 4DNLA 1HESA 3O4OC 5GZNA 3APDA 1KT2B 1S7WB 2UXVA 3WKPA 1H3PH 5K9QG 5DQDH 5DI8B 2XIBA 3PWLB 2UWEF 3Q2CA 1Y07A 2CQVA 1IAKB 5DF0A 4HFUL 1EAJA 2A4EA 4UQ2B 3QYCA 2MOQA 4A6YB 4V1DB 3PWVA 2QKIB 5EH1A 4FQIH 1AKJA 2ZF9A 4XZ4A 1WZ1L 1CLOL 1KPVB 3M86A 4QHMB 5E6ID 2ITDA 2YUWA 4PB0H 4FRWA 3VXUD 5DJ6A 3WXVL 2EAEA 5DQ9A 4HH9B 4YDJA 4E68A 2EIZA 1LP9E 3OWEA 1A65A 1JXJA 4HWBH 2R1WA 4Z7OF 1KENL 2UWEA 2XTJE 4B5EA 1OTUD 5AKRA 2DMBA 3MRBB 5CCKH 3VW3L 3FQUB 4AQAA 4GYBA 2QLYA 4UT9L 3A4DA 5FX3A 1SXSA 3T1FB 1RSYA 2W0LA 2XVKA 3E38A 5ICZA 2R0ZH 4HALA 5SWQB 1A4JA 3OZLA 3EH4B 1OGTB 2ADGB 1AGDB 4ZMQA 4EE2A 5AB0A 1J5CA 2OMVB 1E2ZA 3EJCA 1M4KA 1MVFA 3EGDA 4GSXA 4LCCA 3UBHA 3V4VL 4WUUD 1OM3H 4QHUB 3QH3A 3FPYA 4G8GB 4N0UA 4KMLB 1F2XK 1IT9L 2OSLA 4BXVA 4F7TA 1UA6H 7CGTA 1LXMA 4NX0A 4WTZA 3ROLA 1NGQH 2GIXA 3BH8A 4C47A 5ESAA 2RQEA 1W2KT 3SKNB 3FSZA 1GGBL 4LPUA 1F6FB 1GZPA 4YNYA 3RGVB 4P23C 3T6QC 1KCRL 4NOFA 3FT4B 4BA8A 1RUQH 5AG8A 3VG0H 2ZJSH 1PFCA 1K4DB 2K70A 3QR1A 3EIFA 2FNWA 3QJSB 5FYKH 5EPMB 5DQJA 3S98A 4Y88A 5F6IC 3MV8A 5MP6H 2DTML 2ZXCA 5C0RL 4FLSA 1QW9A 3VI4B 3QIWA 1EZSA 2PPEA 2Z92A 3DMMD 2UV3A 2YZ8A 4PMFA 4ZW7A 3BUTA 4OV5B 5IQ9B 1VADA 4HUVA 4NUQA 2KLTA 1OANA 4F7CB 3GPEA 3QP3A 4O4YL 1TZAA 1RUMH 5E9DA 1KXTB 43CAA 2UZIL 5IHHA 1MNNA 4JVPA 1I9IL 4JDVB 3VCLB 1CDIA 1CE6B 1JGVH 5C09A 4XP4H 1ZSHA 4DEWA 5EUKB 4DPRA 5IW6A 3GSRA 3KPRE 4Q4EA 4NHCH 2ZWZA 4G9FD 2BXZA 4ALAC 1I9JL 4XWOC 4Y2DA 5FOJA 2Y5TB 1OGSA 4BSJA 1IFHH 1YNTB 3O45A 1IGCL 3CVCA 1XCQA 3LRHA 2VMJA 4YHLL 4M7JH 4GY4A 3VD0A 4P2AA 4C59B 5D1ZC 4A1RA 1A64A 4NNXA 1KCSL 5JYMA 3SPGA 4ZMZA 1I3GH 3T8XB 2YGPA 3IYLW 3GMOB 1W0VA 2ITFA 3VYOA 5JHBA 3L2NA 1LO3L 2KZKA 2FEDC 4PJ9A 1KDIA 3EOAA 4Y5XA 1V05A 2WXGA 3EYQC 3GBEA 3MOBL 5E6IB 4ELMB 4PBWD 2D7NA 2YRPA 1LE9B 2PP8A 3VXUB 5EDSA 1WAAF 1ADQL 1I3VA 1WIPA 4GFXA 4XOAA 4PP1D 4PRID 4Q9QH 3BP4B 1ULVA 2BS8A 5JYLA 3V0AC 1I85C 2QVTA 3UBGA 5GRUL 2CWRA 1KBWA 4UT9A 3R1GH 1FL5B 4KTDL 1ETJA 1R75A 3PJLA 2HN7A 4GAJL 1SYVA 5HYQB 3QE5A 3EJJX 5E5MB 4ZQTA 5DMGC 4NO3B 4HIEA 2Y1YA 5H94A 1NSNH 5HJBA 5T1MA 3KJ6H 4JFFA 1B4RA 1E6JH 5C07D 5G2NA 1AQHA 2O4EA 5DURD 3IMRA 1WAAA 3V4VA 5EZLB 5G4MA 1NCBH 1UOVA 3QUMB 1U42A 1R47A 1WAEA 2B0SL 1AYRA 3CMGA 5B38A 2P5EA 3MO1A 4WI9A 2BY2A 1N5AB 4WUUB 4XX1E 2UZXA 4FNUA 2GSGB 1QFWI 1KTCA 1CGSH 4LDCA 3ZT6A 1TEGA 1CF8H 1H3UA 3FTUA 3ZO9A 3RVTC 3AG3B 4P5KA 1YC7A 1QSVA 5FYJE 2ICCA 1T0MB 2JXMB 4ZDHB 2J88H 2XQYA 5MEPA 3HI6L 1MNUH 1TTGA 3LN5B 3KM1A 1MCRA 3C2SA 4F58L 1DBBH 3T3PB 5FYKD 4JFQA 3W5NA 4J3UA 3HG1D 2OYKA 4C56A 4FA8A 4G6ML 4KQ0A 2EIDA 5DFAA 2OTWA 4LSSH 4BQ6A 4F93B 3QAZC 1JTTA 1UKSA 4MS8C 3IU3B 4I2XB 3DMMB 1CUOA 3QUZC 4OD1H 3BKMH 4P2OC 5EEZA 4O2FA 5I0DA 1MI5B 4MD5A 3VE0B 4YSOA 4AT6A 1GYUA 2WQUA 2XVBA 2OI9C 4QTIL 4UTAH 5LG1A 5GSRB 5JIMA 2FJUB 3LQMA 5KANG 4P9HL 1NCTA 5E51A 3H2QA 4G9FB 4R26L 4UDTA 3WFEL 2XCMC 5CZVL 1ND0B 2B77A 3VFMA 2P26A 1T3FA 1N8ZB 2AK4A 2FE0A 4KJWD 1IGYA 4XO3A 4JG5A 3MUJA 1PEZA 3M7OA 4X6DB 3PABA 4F8QA 3TFKD 3RRQA 5EIQA 4J3WA 4X6BA 5FM4A 3QYNA 4K9EH 1L9MA 2GBVA 1FH5L 3LZPA 1A6WH 2L7QA 2VW7A 2QPDB 5DDHB 2GSIB 5IV2A 1F1GA 3MR9B 1GPOL 3OAWA 1UYWH 3BPCB 4QRPE 1ADQA 2WGNB 1OT4A 1JCVA 4LSTL 3TBBA 5DMIL 4M7LH 4UNIA 4BK4A 2K8QA 4M5YL 3SPIA 5L0QB 1ZHBB 1E5YA 3HE6D 4JK0D 4PRIB 2PPCA 3UMNA 1ECZA 3KPMA 1JBJA 1NBVL 5A2KH 5J1AB 1KJ2H 3EUUA 3MNDA 2OYPA 4F37K 1DDHA 1R3JA 4N0FA 4A2LA 2I5YL 3LKQA 5H8DA 1IKOP 3Q1SL 3ULVE 1FVCA 3P30H 3BZ4B 4Z23A 4AYEC 3CFKA 4KY1L 1AR1D 3BPOC 4MQXD 1Q72H 4PLOB 3T0AA 4AC2A 3KWXA 4Z7QB 3CC1A 5HHXL 3PAUA 5C07B 2QBWA 2Y9RT 3G6DH 5DURB 4P5TC 2XVLA 3ETSA 1MAJA 2H1LM 3B6SA 4CMHB 4ICXA 4N0YH 4U1MA 3T2NH 3X13A 3GWJA 2JNZA 2A9DA 3O6FA 3RNQB 3LX9A 1QFUH 4S10A 1FZMB 4W1TA 3S3SA 3OTTA 5FUCE 3VTMA 2JQMA 3QUXD 4HJIA 5F7WC 4KXZH 4L3AA 2HTKC 4RMWA 3RIFF 5E8DH 4PUBH 3HVDA 5EC1A 4N2EA 3MRJB 4Q9BA 1Y18A 1ZT1B 3NZSA 2K7PA 3ZT5A 1C1EL 5SWSA 1NBZB 3BQUC 1EXGA 1SUHA 4EPSA 3NN8B 1BFTA 3GUTB 3KJ4C 3HG1B 2J7LA 3MRDB 2KC0A 1N6QH 1K2DA 2W9EH 2DIBA 1J1PL 3AWGA 4Z9KB 4NPKA 3GYRA 4LESA 5SWZA 1RIVH 1X5XA 4L3EA 3TC9A 2XTJD 1NCNA 1IAOB 5FDYA 3S37X 4RFEB 3DI3B 2WQWA 4LAJH 2WXIA 4PBDA 1OAZL 5BZDB 1GIGH 1I82A 1IARB 2FATL 5E8NA 3VXTA 1ET7A 2KPWA 3KPNB 3O6KH 3PXJA 3UC0L 2ED6A 5AVTB 1NM9A 2KLRA 2EO9A 2GBAA 1ZLVK 4ANVA 5AOMA 1I1YA 3L6FA 4JS7A 1KGUA 1AI1H 1KTDA 4LCYA 4ODWB 3FUJA 1U41A 4B3VA 1A7RH 1PZ5B 1G9NC 4WEBL 1VFOA 4FHJA 1U8OA 3AT0A 3GMQA 3N04A 1DN0B 5CU5A 4UQ3B 2WWKO 2OMTB 4PRNB 4NWTL 1WIUA 4KAQH 3U2IA 1BVNT 4O2EA 1U8IB 5EU3A 1KN4H 2GJRA 3QG7H 4Y4KC 1SXBA 4I3RH 1NLDL 2DMKA 1HILB 3CV5A 4Z3IA 1UXSA 2YKLL 3HMWL 4B95C 3KEDA 4GQ9L 3DIVA 5JPNA 1TJHH 2UY6A 4QXTB 3HE6B 2H41A 1YAIA 2RGSA 2HJKA 5DEFB 1FPTH 3OC5A 1UKQA 3OKEB 1MJ7L 3WSQL 1DBML 1BYPA 1I7UB 2HVKB 2Y36L 1U21A 3GSVB 3HR5B 4X9IA 1KYOJ 3ORJA 4KNSA 1AR1B 3BH4A 3LKRB 1QKZH 1V27A 1AGBB 2F54E 4TN9A 2C1OB 4G9DA 4IMLB 2YRLA 4HF5H 3O0RH 3IFLL 1UHVA 5DZ9A 4YWGH 3L4CA 4MJIE 1N8OE 2CPCA 5LGYA 1VZIA 4YBLB 3OMNB 1BBJB 2A5UA 4PSRA 2HLAA 1F1DA 4J3XA 3ZR5A 5GQBA 4G83A 1OKEA 2J1YA 4M4RA 3BVWA 3GDCA 3EYOB 1KPUB 1K8DA 3NG5A 4GMSH 4H25A 4HWEL 5GS2H 2D3VA 1F4YH 5ECGA 3QUXB 4RFNC 1DQJB 4LVOC 2WN2A 4HUUA 5CEZL 2IC2A 4IBZA 3F04A 3OL2A 3ARDC 5D5MF 3MLXL 3Q6FA 4N2CA 3LEVH 1CMOA 3S5YA 2KDGA 3U1SH 2FO4B 5B1KA 4MAUL 3LNFA 3KPOA 4YL4A 4K7PY 3FB7A 2JKIS 5DA4A 1A0QL 2JB6A 4KNTA 4KPHH 3MJ8A 3LB6C 1JPGA 3N50A 3MLWL 1BSIA 1IBBA 3L08A 2DJMA 5AW6B 2PYEA 2YQ2A 4K3GA 3VXRE 5MENE 3L13A 1IV8A 1WBZB 5BMFH 3AFLA 1I9RH 4TLTA 3RWDB 5BO1L 5IEHA 1F8TH 5DT1L 3VGEA 1LP9B 2VE6B 1XGPB 4H20L 4JQXC 5E00B 4DP2X 3I3DA 4K3DH 2XN2A 5D5MA 1XDQA 3T9WA 2XTJB 3ZQXA 5BQ7B 3AAZA 1JDCA 4ERSH 2NY6C 3HPLB 4G1MA 5C2BL 2VISA 4FJZA 3ULVH 4IHOA 4Y5VB 4OQTL 2Q20A 3B37A 4NUGL 5KN5A 1IGFL 3PHOB 1T20A 5DD5H 1QQDA 1TJMA 4HIQA 3UJTH 3AU1B 1NC2A 15C8H 2VZSA 2V2WA 2YPLA 3FQNA 1L9PA 1QFHA 3WUWA 5K9KB 1F58H 1E50A 2AS5M 4Y1SA 5F96H 3SO3B 2OX5A 4ISVA 4TTGA 3I2CL 3ZMNA 1CURA 1GYWA 3S37L 1UH3A 4Z3JA 4PFEA 3F12B 1JRHH 3EOYG 1BFOB 1T7YA 4XB8A 5AW5B 3CZFB 4Z3TA 2F5AH 5I1IL 1C12A 1A21A 5FS5A 3AS2A 1UFGA 3IJYB 1DJYA 2HJLA 5IOKA 1KJMA 2A83A 2PWEA 3UCQA 3DJZA 1OB1B 3PAYA 4JANA 3VXPA 2E9GA 2PYFB 2QQKL 2QVMA 1PYWB 1SLWA 3ALWA 4HUCA 3UH8A 4PRBB 1HN1A 5FYJD 4KX9A 2WTPA 5CJ8A 2W0FA 4QHNB 2VDNH 4GSUA 1BOYA 4GPVA 4XHJD 5INCA 1KLFB 3MSPA 1D3CA 1WCQA 3IF1A 5HGGS 5A1AA 2YKKA 3N43F 4PTUA 2YC1B 3IJEA 4LLMB 4PEEA 4AL8H 1BAFL 1R5IA 4R97B 4BH8B 2LU3A 1IEAA 4NRYB 3V4UH 1CE1L 5I8OL 4JCWA 3LY6A 2X9ZA 3FO9B 5CSBA 4OCWL 1CFNB 5E6UB 1I8LC 1QSEE 2QJDA 2Y72A 4FCAA 1IC7L 1HKLH 4FGMA 2MQ3A 3QQ4A 2WCPA 4HIHA 4K0OA 3MRHB 4DTGH 2VDPH 3I9IA 5HYFA 1MPAL 3DRQB 2N1TE 2DLIA 4P3WA 2ZKXA 1DLHB 2YK1H 3NRQA 3VFPA 4JGUA 2EEFA 3RBGA 3RL1A 4TPRL 5LQBH 3UTQA 3H3KA 4ADGA 2CIIB 3N9GH 2Z6FA 3D34A 2DMCA 3B7SA 3EDDA 2QHLA 1U3HA 2G3XA 3VGDA 4AYDC 4Z77B 1HHIA 4GG6E 1T2QL 5J11B 3RY6A 1D5XA 3ARBC 3BJ91 4MJ4A 3UYRL 1QX1A 3JWNE 1BYNA 3DUUA 4OJYA 2EDYA 4Y4HA 4D8PA 4K3EL 4PVBA 1QUNA 4NZTL 1RURH 3FQTA 4ZOEA 3CMOL 2DL9A 2DWTA 5FF6A 1XZ0A 4M9OA 2VJ0A 4XMLH 4IRSC 1HHGB 3GSOB 5HDBF 1KGWA 2HFFB 2WUBL 3WO4B 4FNTA 4R4BA 4OQTA 1P7QA 1WA1X 2G60L 5H2BA 3WEXA 3TJPA 3FULA 2A1WH 1ACCA 3QJOA 5A2AA 5F70A 1CLYH 1J8HA 1ZANH 2BMKB 2VXSL 4OZ4B 3WMQA 3ULVD 4QTHB 4PGJA 1YEDB 4TSAH 4FFYH 4DKFL 4PV9B 2OW6A 1AQKH 5HHOE 3OKDB 4YK4B 4ZZFA 3GSNA 4MA1C 3BSZL 2VR5A 3LD8B 1MCPH 5EZIH 3FCGA 5GGVH 1T22A 4PJGE 4KFZC 4HK0A 2DQEL 2QFPA 1IM3D 5HHVL 4UILL 1K3ZA 3O3BB 2EH7L 2ZSWB 3CC5B 2MTPA 2E0PA 2Z0UA 1DLFH 3M1BB 5E1GA 4AMXA 5T3XE 3R18A 2W65A 3B9KA 3P1VA 4QCIA 5LHDA 6TAAA 4PB9L 5IQLA 3DX7B 4UNTA 4ZMTA 2CKNA 1PY0A 3D18A 4WV1C 1IILE 4U1IB 4WI2A 5ACLA 5F7UA 3N40P 3MCYA 1N4XL 3NIDE 4FADA 2APXA 3H9YA 5AOIA 4Q6IA 4JQIH 5FB8A 5I18L 4ZPVA 1GKOA 4PGCB 1IGML 1WZMA 2WWNA 1EMTL 5ICYA 5DJXA 3L3IA 3SBQA 4HJ0D 1MF2H 3ZKNC 1RERA 5KVGL 4F24A 2WXHA 1SLVA 2ZCKL 4XX1G 1S9YA 3RP1A 3HKFA 5IVZB 3TLRA 3FCTA 4HUXA 1JHLH 1EZVX 3HC0B 3N42B 1HE8A 1INDH 4PJ5A 3DO7B 3V52L 2D31A 1AZNA 4YHNB 2ED9A 3MFFA 4NQUA 4FL4B 4I77L 4ZMAT 4D9QE 2EIKB 1SEBB 1KEMH 5M94B 3F5WA 3B9EA 3TU6A 5IFHL 5AG9A 3QIBD 1KJ3H 2ZSVA 1KCUL 4N2GA 4KRMB 5DVKA 5EEWA 1JMZA 1U93A 2NY4C 2WSKA 2CNZA 2XNAA 1FL3B 1HZLA 2EDNA 3IEAA 1PKQA 4GJTB 1P5UA 1Z7JA 5E5UB 2CJ3A 2IQAB 3ZKMD 2NTFA 4X6EA 5KOVC 2ENPA 5IBUG 3WJLA 1JYNA 2XQ0A 4M8QA 4XNYH 4NQSA 5L2JA 1DVFA 1UWFA 4OR1A 2V3EA 4M3HA 2VZTA 3DGDA 3Q5YA 4OT1L 3S34H 3LPWA 2WLKA 1ET8A 1E4XI 2FBJH 3HRZB 2G2NA 3GK8L 3F7VA 2B4CC 3BGFC 1ICTA 3PGFH 3WXWH 2A9CA 5EA0H 4LLWB 2JJTC 3OJ2C 1BXXA 4QMEA 2K6WA 4A6YL 2HT4C 4BK5A 1H9VA 1YEWA 5DGRA 2GY7B 2JK5B 4BFJA 3D69B 4GH7B 1B0IA 3K2MC 1RMFL 2B59A 3W9EB 1C5CH 2E9BA 2FSEB 3I75A 1QPXA 3C6EA 4WJG3 4YDKL 3VSVA 3OB8A 4GKSB 4TQPA 4PJ6A 3IDGA 3K46A 1EJ8A 1BVOA 4OLXH 3IGUA 3S36L 4PJXE 1Z9SA 1USZA 2YIHA 3MV01 1DBAL 4XT1C 5D8JL 4ZW5A 1M7DB 3O41B 1ZXQA 3QORC 3Q9PA 1WEJL 3D3VE 4KRPD 1KUMA 1I8IB 1KC5L 4JDTH 3QRGH 2F54D 3TPKA 1DSWA 2AXFA 4FFTA 3LMJH 4YFLI 3M8OL 2MCPH 1KNOA 4MJID 1IVLA 4B9JA 1KEGL 4WCYL 1OW0A 3DHJA 1IM3B 1BZ9B 1KXHA 1D9KC 3MLTA 4OFYA 2FLMA 2JJVA 3BFWA 4BFFA 1Q1JH 1Z66A 3CD4A 3NRPA 4QHLB 2CO7B 3CHXA 1DTUA 3LKSA 5D1QC 2A9BA 4TUUA 1T0NB 3GZKA 4WWKC 4L8CB 3T2LA 4JFXA 5IMLB 1FZOA 1T21A 4GMTH 3UBXA 4QT5A 3BXNA 2MSPA 3GDBA 1IGJA 1J88A 2Q8AH 3TVMD 1RY7B 4FEMA 4OW6A 4A2HA 2X70A 1WFJA 1PCSA 2R83A 5T3ZE 3ARZA 2WNWA 3VGGA 3V6BR 2PO6D 2ILLA 3VXRD 4Z7NE 5MEND 5L88L 5J06A 4G5ZH 1SDDA 3AREA 4XC1H 2YPKA 3ZYIA 5LCVL 3PL6D 4NQXB 1IAIL 1UZ8A 3N0PB 4WW2F 1L6PA 3INUL 4KQ3H 2YRZA 4XBGA 4DVRH 4J39A 3TCLA 3V5DA 2HFGL 1MFBL 5KG9B 4YLBA 3LPOA 3QIBB 1KYFA 1JPSH 3FH7A 2VW4A 1HKFA 4F27A 5FO7B 4OJDH 3SGJA 5D7JC 4HJSA 3IXAA 1MCSA 4M1GH 3WHE1 1QR1B 3UJJL 4NBZB 5TPWL 4U1SB 3RJOA 1C9SA 1S7WA 3MLZH 5LWYH 2VDPB 3P2BA 1ZLVH 4QUOA 4G7QB 4ZW3A 2E7DA 5FUOH 2EXWD 4ZUTA 4YBHA 1U30A 1P84J 4WW2A 1KB3A 3CDCA 1TZGL 2EH8L 4XNXH 2CKBH 5LDUA 2OW7A 4P2CG 2K4AA 5EO1B 3A21A 3LAFA 1DSYA 1ZT7B 3BAWA 4M6AA 4RDBA 1P7HL 3P4OB 2ARJQ 4PJDE 5C0DB 5JO5A 1LEIB 2ITCB 2XZCH 3CLEH 4W6XB 2Z64C 5IEKA 1A6TA 2Z1PA 1J0HA 4B96A 3RA7H 2FRGP 1RVFH 4C58B 4LSQL 4EOWL 1EPFA 3KLSA 3ZHDA 1H9DA 3X1NA 4N8UA 2OK0H 3FO2A 3D6GA 2ICWJ 1RJCA 4R5TA 5TD4A 4ELKB 3AUVA 1UH2A 1WG3A 3BUDA 2C9SA 3FSWA 2V2XA 3C08L 3FQUA 4N28A 4FA7B 4P9ML 2ZYSA 3ZHKA 4HS6A 3CK0L 1R3KA 2ZE0A 2X6AA 1TFPA 2VLME 4G8AC 3U4EB 5BV7C 4X8CA 4QPEA 4R9HA 1M05A 3EYFB 3CZNA 1BYOA 1NLBL 1ZD6A 3TWYA 4IJ3B 4A04A 3N85L 4IKIA 4XO4A 4E41A 4KRPB 3TBSB 1V55B 4QJ5B 5IWLC 3EH5B 2F54B 1NZRA 5I66B 4HD9A 5IB4A 2XBZA 5DS2A 2KHAA 3B7UX 3G7TA 4IYKA 4JY4B 2ICEB 3QDME 1RZQA 4MJIB 2VM3A 1YMME 5AKTA 3N41F 4OH2A 4CVZA 3BKJH 4DGUA 1HEZA 3QUML 3DUSB 4B9FA 3NSFA 2AF2A 5HYJE 3WLBB 4M03A 5TQ0H 4RFOH 4C83B 1QATA 1U91B 4PWKA 1BQSA 1BF5A 3CZLA 2VGLM 3FC8A 4RMTA 2QHRH 2XRAL 1OOWA 3HS8A 35C8H 3ASNB 4JHWH 3DJTA 3HPJA 1BZ7B 5DSCA 4JZJA 4APQD 1VFBA 4XNMB 1G7QA 3TVMB 2J43A 3U46A 5E8EA 2VZVA 3X11A 3L81A 4OBRA 2PO6B 5LCVA 3CVIL 4O58H 1XT5A 1KIUB 5D6DA 3U1PA 5G5DA 3D85A 2VITB 3OPZL 3VXRB 5MENB 1KFAL 4LOEA 2NYYD 3PL6B 3V6FA 4LPTA 1B2YA 4UTBL 3JWOH 5ID1A 5FGSA 3IDIB 2BP8B 3MA7A 1Q9WA 3BC9A 3B2PA 4TLUA 4W81A 4L1DA 4FFZL 3RVVD 4LEXL 1KIRB 1VA9A 2CHWA 4FG6D 4FXKB 3IDXL 1TQTA 1L7IL 4HQQL 5E0FA 2VERA 2C4FU 1D6VH 4ELMF 2YMXL 2GUYA 3BVUA 1RZJH 3ULUE 3TESA 5EUKA 5C7XH 1JGUH 3MV9A 3MRLB 2JI2A 5HHOD 4EEEA 5AVSB 1IKFH 4WGVB 2Y5TA 3FXIC 1AYOA 1ZHNB 5F89A 1DQTA 4NCC2 3VJ6A 1ZV9A 4Q14A 1PIFA 4HC1H 3RZCD 3DVFA 2WD0A 1H3PL 4F8TA 3S3DB 4J28A 5SX5K 2OTUB 4LCCC 4E9XA 2XACC 1JYVA 3MRNB 4NAJA 5EBLB 4H2AA 2H6UA 5T3XD 1RUPH 2VH5L 2R1XB 3X1EA 2NQ3A 1N6UA 3EJSA 4JREB 5FO9A 4HV8A 4PP2B 4KI1A 4ELMA 4FNLH 4HAFA 2M1KA 2FBRA 2IFFH 4KTGA 3DROA 1LE9A 5CMAB 4FQIL 1TEFA 4JFDA 1UJ3B 3FO0H 1N26A 4PB0L 3X3GH 3GSXB 1A5FH 2A9MH 5T3ZH 2VWEC 1IQWH 4FXLA 5DYOA 5DEJA 3PLYA 4FYSA 4N20A 4NNPH 4HWBL 2X9XA 3ECBB 4TVUA 1QA9B 4LXFA 4N8VG 1E67A 2MHAA 4PWGA 3KWUA 5CCKL 3MREB 3DV4B 1WZAA 4AVJA 4K3JH 43C9A 2QV2A 1GVIA 3CHOA 3HFMH 4TRPL 4D9QD 1TCRA 1A6AB 2R0ZL 3JTTA 4X42A 4FHBD 5KWYC 3T3PF 1CVSC 1DQIA 2R0KH 2WXNA 1C08B 4JJHA 2GG1A 2PCFB 3QUMA 1N12A 3RHWK 3TTSA 1OXYA 1BZEA 2EVIA 4U1GC 4AJWA 1QP1A 5FW6A 1CD1B 5CP3A 4WUUA 1UCBH 2AJYH 2OL3B 3ZZSA 4ZTPH 2WBJD 2OULB 1PJ9A 4Y2DC 4AYFB 4RSVA 1J10A 4KHTH 4OGAC 4GI9A 3SD5A 1V8HA 4Y89A 2KZWA 5C0JB 5JUEH 1UA6L 4CN1A 2CBMA 3QULA 4APQB 4AMWA 3OLIA 4TNWK 4MJ6B 4GG6B 1MHHA 2XBTA 1TIUA 1BVKB 1QACA 2AXWA 4PJ9C 1Z3RA 4Y5XC 2X4OA 1RUQL 4M6MH 3K71B 3IGKA 3N91A 5FYKL 4UBDC 1GJUA 4UTBA 1RUAH 4OCYH 2WZPD 5AAWC 5MP6L 4X6DF 1KZYA 4FFZA 1E43A 4I9WE 3R0NA 1MI5A 3VE0A 3C09B 4Y19E 4JG1H 4ZTEA 4D9LH 2YAOA 1YNKL 1XF1A 4GRLD 3TTYA 5CKAA 4NO2B 3NEXA 1H6FA 2DWSA 1FNGA 2QMJA 1AXTH 5AKSA 1RUML 2K1MA 1SQ2N 4JAMB 5DVOA 1HHKA 3MGOA 4WFEE 1IRAY 2FQDA 3D3VD 3PE9A 4LOUC 5HHME 1NGZB 5HHOB 5I8KH 3MMEB 4U33A 4Y5YA 4XP4L 3SQOH 3KPQB 5FLUA 4PN6A 3LZQA 2FR4A 2YJQA 4NHCL 5FYKU 1NFDE 3DXAE 3FS9A 3E8UH 4X6DA 5HGBA 1RZIA 3KHQA 1XBDA 1IFHL 2AJZA 1XV8A 2IH3B 1LMKA 2YXVA 3DJRA 4YGVB 1A8JH 4M7JL 1Q9KA 5CSGA 3TURA 3MJ6A 4NB7A 5KSBF 1FN4B 1HNGA 3BVNA 3ZIYA 1I3GL 4FI6A 4A7GF 2P8MA 1P9MC 1MRDH 4J8QA 2NY2D 1SHWA 2I60H 1T7ZA 3ILPA 2XYCA 4CBZA 1ZHBA 4JRWA 4P5RA 1CB4A 1DQVA 2WOBA 3NIDB 4PRIA 3AT8A 3MNZA 1AXSB 3HN8A 3UOAB 4HWBA 3ECUA 1HCZA 3HC4H 2J6EH 3IFNH 5T3ZD 4Q9QL 1NGYB 4PRDB 2YUZA 3LXAA 5B4MD 3UL4A 2YWZA 1NIFA 2WXFA 4UYPA 5E8OB 2QZQA 1QLFB 3R1GL 4JUSA 2VRQA 1R5VB 3NA9L 5KSBA 1JI2A 1KB9J 3NJLA 5IB1B 2PTUA 1QI3A 1TU2B 4GO6B 3ETBF 2D7PA 3MTRA 4A7GA 5J6GB 4UIMB 1V3JA 3QIUD 3UG5A 3ZDZF 3MN8A 1EDQA 3DRTB 3EDFA 1FIGH 3MUHL 4PQXA 5F1IA 4D7BA 1VGEH 1U8NB 3CX5J 2VIRB 1NSNL 1UXLA 3PGDB 3KJ6L 4I7ZC 1P4LB 1E6JL 5K9OB 1AGEA 3K0YA 5F7NC 2X28A 4U4BA 5HI4D 2NXZD 2A2QT 1U9KA 2VUOA 3CVHH 1NCBL 3WI9A 5A6MA 3GKWH 1Z2KA 2LOEA 2WBJB 3IMUA 2MPAH 3NACH 3UXFA 4I85A 1ESOA 4WU5B 2OCJA 3QGVA 4P06A 1RZ8A 3V0DA 4ZXBA 1F13A 1IQDB 2CLVA 3W38A 4FP8H 4HIIB 4HOWA 2ADYA 1CGSL 3NK3A 4NLHA 3LRKA 5A40E 5HHNB 5IHUH 1TZHB 3IDNB 4BDVA 3GBNH 3W0WA 3MHZA 1SXZA 1KV3A 4P99A 4NT6A 4JDEA 4KZDH 2J88L 3F65A 2IGFH 3BVTA 5K9JH 1MNUL 2CGYA 3MNWB 1DBBL 4GKZB 3O2DH 2WZ0A 1IZKA 4YDZA 4GNKB 3PXLA 1ZDQA 4ZO6A 2BIOA 4FQCH 2F8VA 5F97E 4LSSL 3GMLB 3K72B 4D0DA 4J2QA 2JE8A 5EOTA 3DX4A 3HC3H 4OD1L 5G4OA 3BKML 2H0EA 2D3NA 4GRLB 2AQ1A 3HLAB 1CDHA 1DJIA 1JZFA 5C0AE 4N9GA 4KXAA 2VLMD 2CLZA 3MVSA 4PJXB 4RAVB 4JRFA 5IVXE 5CD5C 1YYCA 3CHRA 4WRLA 2JJUA 4P46D 1JD7A 1M71B 2HVBA 1J9QA 2UYLB 8FABB </