3HBQA

Structure of recombinant chicken liver sulfite oxidase mutant cys 185 ala
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
373
structure length
373
Chain Sequence
b'QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQAAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulphite oxide
molecule tags Oxidoreductase
source organism Gallus gallus
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
total genus 99
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbqA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbqA01
3HBQA 3R19A 3HBGA 3R18A 1XDQA 1XDYA 2BPBA 1SOXA 3HBPA 2CA4A 2CA3A 2A9AA 2A99A 2A9BA 2BIIA 2BLFA 2XTSA 1OGPA 4PW9A 3HC2A 2C9XA 2A9CA 4PW3A 2A9DA 2BIHA
chains in the Genus database with same CATH superfamily
5I8CA 5HJGA 3RX7A 2V2XA 2CD0A 3QIWA 2X89A 4F7MA 4GRMA 4PIRF 5IP4A 2DLGA 2EE9A 3QUML 4QR7A 2M26A 3RWEB 1SFHA 3HZVB 3GZKA 4NQDA 4XCFL 5DUPL 4IBYA 3T1WA 3WN6A 4W9CC 2OMYB 3KDMB 4G8EB 2XETA 2ZYIA 5AWNH 1ROWA 1LDPL 2XIBA 4OLWL 3PWJB 5D5MB 4LVHC 2DIEA 4IBZA 3UJIH 1Q9WB 2BZ7A 4N2KA 1MPAL 4TNVF 2AS5M 3UPAA 2VRKA 3M1OA 4XBPA 4CC4C 3R1GH 5JQHC 2DLFL 4L8CB 4U6YA 4JPIA 1NAMH 4GSQA 4HUWA 1A7QH 1YMMB 5M95B 2JTDA 2Z3FA 5KYXA 3KDPB 1XGQB 2B39A 5CWSB 1NLDL 1UM4H 2C3GA 5I73B 4S1DC 3D2UD 2W9EH 3CCHB 4HJ0D 4E9VA 1XF3B 3D39D 3DBSA 1PAZA 4I13B 1OGPA 2BVTA 4QXGL 4AM0A 5JHDD 2EYSB 3GKWH 3IDIB 1F6FB 5TGBA 3RY5A 3ZE2E 4YLCA 1L5GB 4G7RB 5DZPA 1MIMH 2V37A 4QHUA 4GUPA 1N67A 3QNFA 3ULVL 4HGKC 2DKUA 3IGKA 2WNXA 1YYLH 1NH6A 5TD4A 1TJIH 5GGQH 4KKQA 3G04A 3JSSA 3K0YA 5D1ZA 3T0EB 4KZCA 4MCZA 1A47A 4ZXBD 5A2BA 8FABA 4NKDA 4QNPF 5AYUL 5FM4A 2F54B 2ZOTA 3O3AA 4U4IA 4O4YL 1J87A 2ZSWB 3FSVA 3WMPA 5FHAL 4JLRB 4FERA 4FA7B 1AZUA 1BM3L 3HNSL 5DXWA 3MXVH 1D5RA 4WO0A 3T4YB 4CGUB 3L5XL 1XGRA 2AEQL 4PJAE 1WFOA 4HIXH 1BA9A 3NFSL 2EUWA 1D6EA 2WV3A 5E4EB 3SYCA 3BVXA 3OVUB 1OPGL 2PPFA 3L1OL 2AQ1A 3NCYS 4W9LC 1PLAA 2DYSB 1JZFA 4PLNC 4ETQA 4KI5C 4X7CC 3G6AA 2YJLA 15C8L 1OCCB 1R6VA 5FS5A 2AFNA 1B2WH 2BSDA 2NNRA 3D39A 4MSWB 3EO1A 5FOBA 5I16B 4O2FA 2Y4SA 3OAUL 4ATWA 4NQEA 1V3JA 1XMWA 2PXYA 1HHKA 5HGGS 3RWJB 4LCCA 4B7IA 4ZTOL 2NY4C 3EOYG 4BCXA 3X13A 3DA0A 5FDYA 4ODTL 1Z66A 3VMNA 3EXLA 5DQ9B 2JQZA 1AKJD 2H2SC 4B9CA 2PXYB 3LKNB 1HE8A 3B2DC 2VQ1A 3C5JB 1SHXA 2ICWA 2VM9A 3QE5A 3M6DA 4E9RA 3LAFA 4N22A 2A6KA 2VDPL 4BD4A 3W0WE 3W82A 1NC4D 4XX5A 1HEJC 3FT2A 4CN6A 4Z7UE 3BKYL 4F2MA 4PTTA 4JZOB 3OLEA 4I9WE 5JOEA 1BZDA 4OQ1A 5CN1A 2ZXAA 2CMRL 3ULVE 4QJ3B 2UZXB 1VZIA 5DFWH 5T5FA 5D7LE 4TLKA 3T6QC 5I30L 1GOHA 5LAXA 2GBVA 1LM8V 1NFIB 1FFOA 1U93B 1U95A 4XRCB 4OLZH 4GS7B 4QLWA 3JTSA 3EH2A 4IKNA 3NMEA 4FKHA 4NPYA 4HFWB 4N0CD 1SLVA 4OM1H 1LE5B 2K7PA 1YQVH 1N6UA 5JA8B 1LQSR 3K2UL 2Q7YB 4FABL 2ZNXA 1FN4B 2MCG1 1R46A 2ZKWA 1MCHA 1MJ8H 4KK9D 4M6AA 3GZOA 5CINL 2WYTA 5DJXA 5DRNB 1XF5B 3VXMD 1MXDA 3O4LE 4P57A 4XVOA 2VXQA 1ODAA 5GZNA 1GGBL 3TBCA 5DFTA 2Q7YA 1F8TH 1OV8A 1UUSA 2JLPA 5EOTA 3UG3A 4DP1X 1G7MA 3GSNH 4KRPC 4DEPC 4BWTA 3A6CH 2JJWA 4NO0B 3RUGA 3PQYD 3RX8A 3WN5B 3FQTA 4ZSOA 1JUFB 3PFUA 3GXIA 5TK2A 4Q4EA 1DQML 5EUKB 3GDBA 2UWEB 4IQHA 5ITBH 4H7VA 4F7PB 4D3CL 3MBED 1NBZB 3VFWB 1K8IB 5I1AA 3JV5A 4FTVB 2JE8A 3MRFB 1EFXB 3QJFB 4Q0XL 5D1XC 1BAFL 1IGCL 3T4AC 1MFEH 3WUWG 3WDIA 4RWYL 5B8CB 1A7OH 2NY5L 4KV5E 2GC7C 3WFBH 1AE6H 1NEPA 3JBG7 4MJIB 2BSBA 3V5DB 4S10A 3GZPA 2EDHA 2A9DA 3GZQA 4WDIA 3IFNH 5FYLH 2Y06H 1Q72H 3TVMD 2XN9A 5FF6B 4AVKA 5CP3H 4OLXL 3FBQA 1ZV5A 5FYJH 3O6LH 3HPLB 3ULSB 1OF2B 3ISRA 3D48R 1UD5A 2QKIA 5DDHA 3A4EA 4DK6A 3GTVA 3AG2B 2AABL 4HMEA 4GIAA 2EADA 4X5LA 1YEKH 4XP6L 2XPZA 1XCQB 2NX5D 2O5YH 4YWGL 1LEGA 1NCCH 1S9VA 2H0JA 4ZQKB 2NY3C 5EO0B 3IMSA 5IB4B 4S1SH 2H5UA 1XB6A 4ZMOA 3LZQA 4MA8H 4ZFGL 4AOFA 3BGMA 3ARBB 3PL6D 1TJGH 2H2PC 3DUUB 4XXCC 4JFPA 2E7LC 1EBAA 3PCYA 4WTZA 1N64L 4OGAC 2VQ4A 3FJTA 1WCBB 3GRWA 1FG2B 2DJSA 4OZFH 1S4IA 2X4NB 5FKAB 5GS1A 3OXRA 1E4WH 2NLJA 3KYKL 4LPUA 1NICA 1AGFB 3WOVA 5HHQB 1ZANL 2YMXH 1MQKL 3ARGD 1FVCB 1FC2D 1JWMB 3I75B 3OWRA 4R7DA 3RI5K 4JM4L 4Y19E 3UO1L 3ZE2F 3ZRSA 4DZBB 1Y6NR 3KNBB 5HI3D 5AYQA 4K71B 5F7BA 4OGQC 4XB7A 3ZTDC 3SDYH 5FA3B 2W80C 3V79C 4PY7A 1RI8A 2L04A 5HHMD 1RPKA 4FLOA 1CR9L 3N85L 3OF6D 3VAEA 1NFAA 5I2IA 1GGYA 1YNKL 1NLDH 1UM4L 2R1XA 2UUDK 3NUKA 5AOKA 1MJ7H 1TSHA 4OQTA 3EG9A 4JX0A 2WQUA 4MAYC 5D7IE 1V27A 4M7LL 2XPGA 1UURA 9PCYA 3ZDZE 5E0QA 1ZLVH 3H9SA 5T3ZD 1CO1A 2IGFH 1I75A 1XR9A 1EEYB 5FECA 3NQIA 1FO0A 1X4YA 2RACA 1VFUA 4X6BA 2E8ZA 1KGIA 1QBLL 4JMNA 4PV8B 2XPGB 5JOFB 3TPKA 1QW9A 4HUKB 4KI5D 2W38A 2ZOOA 1Y1DA 2LFGA 2WLJA 3VD7A 4YBLC 4CW1A 3FB5B 3AREB 3U0WL 4F27A 4P23D 1N5YH 2VUYA 5CJBA 4ZFOA 3WKYA 4LMQI 2H7WA 3NGBB 2EIJB 1NCWH 2ZX6A 5T3ZE 4TNWK 3TN0A 3D12B 5D7LD 1CDGA 4I48B 4EXPX 4FYSA 1E9PA 5K9QI 1R5VB 4I1NB 5JPMC 1I7TA 2CO6B 1CDJA 3QORC 3NIFE 1J0ZA 1A7BA 1A7NL 1OY3B 4NXSA 4HIJB 3TBYA 4NUMA 4X9YA 4HH9B 1F58H 1B6UA 1WICA 2W88A 3UTTD 3JVGC 1EMTL 3IFPA 3QZWB 2R39A 4ZW8A 3DWTA 4X6CE 4XP9L 4W9GC 1BQRA 1VAHA 4N8VA 1WC7B 1INDH 1M7IB 5GJSL 2YGVA 1Q9KA 1KB3A 1OTSC 2WW8A 1DYZA 2YR3A 2O5XL 1F4YH 5HPMA 3QZWA 2Z0UA 4G7SB 2A9NH 2VZ1A 2Y7QB 3X1NA 4IOFC 1UWFA 1KV3A 5GRYA 2N7SA 5MEQB 1V3KA 1QQDB 3UAFA 2AXGB 2F5AL 4QXTA 4WUUD 1N9PA 5CO1A 3ILQC 5KTEH 2P45B 3TYFB 4R96B 3BHBB 3KPRD 4HIIA 3IKCB 3O4OB 4NC2B 3GWJA 3R1GL 3RZCC 2V17L 3BOVA 4LLVA 4NYLB 1CFSB 1R17A 2HH0H 3QIWD 4GO9A 2AXGA 1BD2A 5D7JD 4E0RB 1UJ3A 3QDMD 4PJEF 4PGBA 3DHUA 4GKLA 4HIIB 4L5FL 2GB2A 5I6XB 2PW1B 3BQUB 2A0LC 4GP5B 1X7QA 3BPNB 1HAWA 4N68A 3GKWL 1BG9A 3U2SB 2OMUA 3EJRA 3U9WA 5FB8A 2XA8L 3WY3A 1Z6JT 5BV7B 3QUZD 5BMFL 1J88A 4YFLI 4OZ4B 5BRZA 3WJJC 3CX2A 4ZMAT 5DU7A 3MU3A 3OKLB 3QR2A 1ND0B 1OCOB 3MKGA 3FPXA 2FK9A 3WUZA 2R1YA 1ZK9A 4Z5RA 2VLKA 2VLLA 3I84A 1KACB 5DEFA 1F4XH 5AG9A 3SKNB 2XY1A 1IO4C 3OJDA 4RLDA 4NDMB 1QSFB 2VE6A 5EWIH 3LMJH 4XCEA 4G70B 1E3XA 2BSED 3L6FA 3BH8B 4GAAA 4XNYH 4YHYB 3U30C 1SOKA 2IPKA 1TJGL 2XFXB 3BEWB 4NSKB 5J56B 2YD8A 4D0BA 1BXAA 1XGYH 3BUYA 4X8JA 4HOWA 2O93L 3WJLC 2LVCA 1N59B 3D2TA 2EYRB 4L4TD 1KN4L 4XCCH 1OHQA 1YJDC 3CSGA 4G9DA 2EDRA 1AZRA 3MV9A 5A2CA 4PVBA 5F1OB 3KR3L 4NKIH 3VRJA 4CMHC 4P0DA 3LQAC 4J1UB 4QRBA 2VW4A 3FT0A 4ZW3A 2DEYX 1XEDA 1G4RA 2ZWYA 5MHSE 4NC1E 4OAWA 2Y07L 3CNKA 3L9BA 2Y7SA 4HPYL 1FZKA 2PTVA 5IB1A 2G3MA 1B0GB 4K9EL 3S35L 1L7IL 1JRHI 1OT4A 3EO9L 1AHMA 3ZSTA 2ICWJ 4JDZA 5CILH 1PMYA 1I4FB 1UT1A 5J13B 3ARGC 4NQDB 3MRDB 1I7RA 5KSAC 3B8SA 1BEXA 3K6NA 3NJJA 2QR0B 4JFEE 3NRFA 4D0CB 3G7TA 1E4XI 2CO1A 5CS7A 5SWZD 3KBPA 4NRZB 2XIIA 2A77H 4L8BA 4NB7A 2FLRT 2VITA 3SDAA 5IJVA 4K9JA 4JAMB 1WZ1H 1OAUH 3D87B 1AACA 4FQXB 1IVLA 1UXWB 1U92B 3WAKA 5HYJE 5E70A 1X5FA 2HB0A 2UYLA 5LJYH 3OMZA 4NQXB 2C7UB 3DXAD 4XHQA 3H4FA 2ARJA 3I9GH 1U58A 4LSTH 1D5MA 4P5TA 2D9CA 1J8RA 3D18B 1MCRA 4RZCB 1N26A 4UOZA 4FYQA 4U6XB 4OD1L 2I27N 3EFOA 4NZUH 4MLSA 3UZVB 1TNMA 1GIGH 1CLCA 5E8NB 5BVPL 3SQOL 5JW4Q 4DJMA 2MFNA 4IGBB 5HYJD 1TOXA 4YSTA 1CVRA 2NW3B 2EXSA 5SV4A 2VRQA 4L48A 2WPGA 1AQKL 1G6RB 2K45A 1HSBA 3ZIMA 3B9KA 5D1ZB 5K9OB 1MFDL 2ZUWA 2V4LA 4PIBA 1J5CA 3HCVB 3P9MB 2VDLH 2WXLA 2X7LB 3OM3B 4B3EA 3MJ7A 5FX3A 2CQVA 4XVSH 2PCPA 2HYMA 2LR4A 4AEEA 3S6CA 1IGYA 1AYRA 3F58H 1SEQH 5I0XA 1VEPA 3VFPB 3EDFA 2AQSA 1EJ6A 2JQAA 4KOCA 3IVKA 1MHHA 1N0XH 1RU9H 2ED8A 3GI8L 1G5GA 4PY8I 3T6ZA 4K7PY 3IFLL 1AG0A 4JY4B 4YHIB 1MI5D 2P5WD 4P9MH 4FXGC 2YIHA 3GK8L 3W0WB 3GSUB 4R8WL 4XP4L 2BNQB 1OTSD 2QPEB 2VC2B 3ATAA 3D5OF 1JV2B 5F93C 5C09B 2XTJB 1IGIH 1K4CA 4KKLD 3ARZA 2OYMA 3LDBB 1XGTA 3QB7C 4JL1A 1FVDA 4BZ2L 2MTAA 4AYEC 3U1PA 4U3CA 1THCA 4NNPH 4RMQA 4N0UA 3DOIA 2R29A 4UQ3A 4X4ME 2K1MA 3K72A 3QG6A 3M7OA 2K3TA 3L3HA 3NSCA 5DK0A 3U1SH 4XTRC 2XNAB 1TJHL 3DX8A 1JNHA 1P9MC 1JHLH 2AK4B 4M5YL 1MWAH 2ADIA 4JDTH 2A0LD 4BYHA 5IOPA 1I8KB 2VZUA 4M6OL 3HN8A 4JFVA 5ENWA 2BY2A 5D1XD 4K9EC 4GXFA 4IBTA 4W9EC 4UCFA 1JZ6A 3HAEB 4PBDA 2HLEB 5HD8C 1DBKL 1FSKC 1X5ZA 3HMWH 3WKMH 4BSWA 1T83C 4GW4B 1SUHA 4I5BB 4LLUB 5BO0D 1KCBA 1KJ2L 1CR9H 2X0VA 4MJ5A 3P0YL 4QHMA 4QRQB 3WS6A 4L1DA 1MFDH 4DGIH 4WW2C 3AGVA 2BSRB 2KPWA 4Z78B 1WUNT 2J6EL 4KJQC 5IREA 5F2FA 3VW3H 2H2SD 2DF3A 4G9FA 4YSAA 3LRLA 4M3KB 1YN7A 1RV6X 1ZT1B 5CUSL 5MHSD 5GGRY 2GJ6B 1KBBA 3S34L 2H26A 4ELMA 3UPCA 4LLWB 4P4KD 5EZJB 5DURD 2PW2B 1MOEA 1MVUA 4K3HA 1BX2A 3OG6B 1KBVA 3WHXB 5LXGL 2NY2B 2OSXA 4GG6B 5MI0B 2L8AA 5IWLA 4YHNB 3V4UH 5GGRB 3O6KL 4LIQH 4UQCA 3CSTA 5J1SC 5CEZL 1JSYA 4QNPE 4K7PH 4OR1A 4PS3A 4E2OA 1XH1A 1ZVNA 5LBGA 1XFPA 3QZWG 4FLQA 3GIZH 3O6FD 2BOCB 5KSVB 2N3JA 2N1TE 2BY1A 3RURA 3GXTA 1PKQA 4PGZA 1EDYA 4P3CL 3CSYA 5HVFB 1HINL 1OP5K 4CN4A 3FH8A 3FQRA 5F7EH 5KSBF 5KS9E 1S9WB 4JKMA 4Z95L 5EIVA 2VUKA 4IMKA 1NGPL 2HCZX 1DQQA 2Z64C 4R90H 3SCMB 2GG1A 5C0BE 3PL6A 1JHTB 1QFUH 4PHZA 3HA0A 5IVZB 1J0HA 4ZI8A 4C56A 5F71A 5IW6B 2J88H 1JVLA 1EDQA 1KYUA 3ZZLA 5E6IB 4MAYD 4O02A 3KBEA 1BD2E 4OI8A 4Z7WB 2F6AA 2ZYHA 4LHJB 4BWUA 3ILPB 5J13C 2G0KA 2JJSC 4D2NA 1JHTA 3PLYA 5F7NC 3PXLA 1SYVB 1H3GA 2FL5B 3LIUA 4WI5A 5C0ND 2V2WA 3I6LD 1E0OB 4H1LA 5CFHA 1T0NB 2E9GA 1I8MA 4IYKA 1PZBA 3C6SB 4HAKA 4OJFL 4X5WB 3CU7A 3D25A 3ZTCC 4FFYL 1KCUH 4JVWA 4NQDE 3IM1A 2VW7A 1JE6A 1KIPA 3DO3A 4F33A 5HDBB 2AERT 1U8QB 5G5DA 3L17A 5AKTA 4LSUH 5C0JB 4X4KA 3IMWA 4P2QE 5FFGA 3GB7A 5GS1B 2MNWA 2QSCL 3PV6B 5IQOA 5KW9H 4HAFA 4WHYG 1FE8L 1XAUA 4OB5H 3VYNA 1KBWA 3NAAL 2AZAA 2YUWA 2WZ6A 4OF3A 5B39A 2F7OA 5C0JA 5ICXB 4HT1H 5AYUH 3AG1B 5JDSA 1P5VB 4EI5B 4AITA 4OCXH 2RBLA 3V5HA 2XJLA 1ET5A 3EKCA 1Q90A 1W72L 1TU2B 3ECBA 4XCYB 4GRWE 1MF2H 2AV1B 5EU5B 4UZGA 4P2QD 4HOXA 1BV8A 2C7FA 5C07A 1OK8A 1YEHL 3QARA 2VW6A 2DD8L 2O26U 4MHHG 3U0PB 2FJHB 1ZLUK 3GTNA 1PSKH 4QTHA 2H47C 1VFBB 1EAQA 5DJZB 2Y2TA 2G5BB 1AD0A 5I1EL 4H40A 1A4CA 4GKZA 1F45A 2X4OA 5GGTH 1IJ9A 2CIIA 1D7CA 3TNNB 2AQQA 5LNEA 3RWEA 4P07A 3HE7D 4I1RA 5FUOL 2YRPA 4TVPH 3V0EA 4DHLA 2BM3A 3VXSE 2OI9B 4PWJA 3OSVA 4QJ4B 2K7QA 1H6TA 4FRWA 4OJCA 3QDJB 2CUIA 4XMKL 2XXGA 3NZ8B 3U30B 4XAWH 4C83A 1PD1A 4E9WA 1T1ZA 4LCWA 4MXVF 2KERA 2YBRB 3SY0A 7CGTA 2DWDA 3G6DL 1LP9A 5F9JB 1G0XA 3G9AB 5K9JH 3FH5A 3WTUA 3BIKB 3CN1A 3TEWA 3MUGB 3K91A 3ZDYB 4FEMA 4KDVA 5HYSA 5DRWA 5ERWA 1UZ8B 1E42A 1IBDA 4JHWL 2V6HA 3MVSA 3NAAH 3NCMA 5HYSB 2AK1H 4XOCA 1I1CA 5E95B 5EUOB 3K7UA 2OL3A 4O2EA 1KLUB 2CO7A 1PGRB 3DROB 4HT1L 3GIVB 2IDSA 3EJJX 4GMTL 2OMNA 5DJDA 5C0IA 4ORGA 4OKDA 1QQDA 2YPLE 4UT9A 3G04B 3D0VA 2Q87A 1CQKA 3DIVA 3JWNC 4URTB 5E2TL 3TYFA 3MJ9H 5DMIH 5HY9B 1IAOA 3BQUC 4PRDA 5BQ7B 4ORGB 5IBUB 2C1PA 3WIIH 4Z76A 3N55A 4WI8A 3JZYA 4JANA 5DHXB 5FYJU 2ZKYA 2NY5C 1JRHH 2YUXA 5F6HI 3PIQA 5IM7A 5ADPL 4MS8D 2ENJA 2R0LH 3C5ZB 2FX8H 1I8AA 5BW7A 4NM8L 3LRKA 1KYAA 3DXAB 4PUBH 3ZSSA 3UTTE 3VD5A 3UL4A 5GGVY 4K5OA 1DO6A 1BQKA 1E4XH 2YRLA 3MJGX 3ARFD 5AVVB 2NTFB 1QBAA 1Q9LA 3U0TB 3I50L 3EO1B 5JORA 3DO4A 2OXHA 1CBVL 4UT6H 5IBTL 3DKHA 1F02I 3D4ZA 2B77A 1BJ8A 3AS1A 4PGCA 3FK3A 2FT7A 3B5TA 4XWGH 4HEME 2ZKHL 3LRGA 2DDQL 3V4PL 1P7QB 5CJ8A 1UOLA 4JPWL 2CJSA 2IEPA 4NDMA 3MGTA 4OCSL 3RWGA 3X3GL 3CFMA 6TAAA 3OAZK 1KEGH 3QWRD 1NM9A 3MNZB 3E38A 3B37A 2WYIA 4WWKA 2XFXA 3LH8A 5FYJE 5T1MA 4EI6B 3B9KC 1LK3H 1QW8A 1TVHA 3DMMC 4BXSV 2BOLA 2A9CA 4LGSB 3OKYA 4H5SA 3ZHDA 1RJYB 1FE8H 1RP9A 4OB5L 2X6MA 2I07A 3G5WA 2VN6A 1H9DA 4LOVA 1YPZE 1I8LC 1U8CA 3QFJD 3QO1A 4G9DB 2WINA 3T0BA 1V05A 5HI5C 2WCGA 3QO0B 1BFSA 4BINA 3HNVL 1ZK5A 4AWJC 3K2KA 5GGVL 3AU1B 3MDJA 5H37H 4I3SL 2MCPL 2AANA 5IK3A 4Q52A 3P3UA 1RUML 4R2GD 3S48A 1UKSA 5EB9A 1D5BB 3ZW3A 2Q7AA 4UM8A 1IBZA 3MLZL 2DBLH 4EDXA 4WJG3 2IPUK 3V5KB 1Z5HA 4UINL 4O2CB 4NXKA 5EO1A 4KQ0A 2BFGA 3VVWA 1H3TA 2F2HA 4ZMZA 4QI3A 3S98A 4G9FE 3V5KA 2HWZH 3A6CL 2ZCHH 1JZIA 5EC1B 3WMQA 1SFDA 3DX6B 4JG5A 1Z5LA 3VB8A 3IDNA 1U36A 3FRPB 4U1MA 3U2JA 1I9RH 3MV7A 4D3CH 1I1FA 4EIGB 4TSCH 3QEHA 4GXVH 5IJVB 3H0TA 3DX7B 1JG9A 4PRPD 4X6DB 1BECA 1FGVH 1P6AB 2W0FB 4JAMA 1FG9C 2YGOA 1MFEL 3MCLH 3PHSA 1JZ5A 2NR6D 2NZ1A 4HBCH 2HAZA 1QPKA 5JQIB 3DX7A 5IIEA 2RGSA 5DI8A 3OV6A 7FABH 2XN1A 4QXUH 4GW5A 2N01B 2F9BT 3KW7A 4UDUB 2J25A 1KXHA 2XLLA 4N90E 5ESAA 1O9VA 3V4VA 4DO6A 2YFNA 3AMKA 3RP1A 2RAMA 5F3BB 3ZO9A 1KG0A 1YQVL 2BHUA 2IFGA 4QYOA 5F1KC 1CDBA 3VFTA 2QVKA 3VA6A 1IC5H 3U6RB 2EEFA 5EZOL 5I24A 4JO8A 3APDA 3BVTA 3DHMA 4U05A 3HRZB 4YWGH 1JFHA 3OHXC 3LD8C 2FO1A 1SQ2N 4BH8A 1KG0B 2E74C 4QYOB 3ZT6A 3FO0H 4A6YL 3UIZA 3EJSA 3NPSB 5F7KC 3W81A 3T0DA 4A37A 4OT1H 3RLSA 2GAZB 1JGUH 4C54A 3LXCA 3HFFA 3FB7B 2P46B 4A1RA 2EDQA 4CC4A 1HH9A 3G6JB 2H0FA 1FG2A 4EDWL 4AEIH 2BCKB 4JFUA 3F7YB 4BDVB 4EOWL 2GI0A 4GBXB 4Y5YC 1P84J 5IVXE 1NEUA 4LP5A 2YPLB 3WJLA 5DYFA 3FB7A 2J1WA 4ODHH 4Y1AB 4IRZL 1P4LA 3CFDB 3W0WA 4XMKH 1FNAA 3T3MF 4GEIA 4M5TA 5CR8A 2ILLA 3FO9A 1EXUB 1YEJL 2R83A 1MW3A 4ZFQA 4E41A 1UFUA 4FA8A 2ZJSH 5DVOA 5GGUA 1NAMA 5B39G 4HKXB 3I2CH 5JOPE 3OD3A 1AR1D 3DGCR 5CU5A 2CLRB 3OKKB 3ROOB 1YUKB 1JIBA 2HN7B 3F7VA 1R3HA 3CBKB 3DURB 3H2PA 1H3VA 2FHBA 2N1KA 2XKNA 3HB3B 3HN5A 4R7DB 4YSOA 3D9AL 1DVFC 2CG9X 5AVTB 1Z9PA 1VPOL 5DK0B 4F57L 1IBHA 2XNAA 3RWHA 1KGJA 3QZLA 1RUKH 1YUHB 4HFUL 3ZJAA 3FRPG 3GBEA 2CKBH 5ALCH 3SKMA 1AQHA 3DHPA 2GABA 2VN3A 4H1LG 1OARH 1G94A 4FFWD 5E9DA 5FGBA 5CP7A 4OY9A 4PJ8B 4POUB 3GQFA 4J2XA 4P59H 4WWKC 4AX3A 5C92A 4F9LA 5FW6A 1AY1L 2WWOA 3F7QA 2YD0A 1NSNH 2VJXA 2R9HD 4IKJA 4XT1C 1EUUA 2QSTA 2CA4A 3HAEA 3HI5L 4OCXL 1N5YL 1FBIH 1GSMA 4GOSA 1BMWA 3KCWA 4GT7A 4ZXBA 5DHVB 2P5ED 3CK0H 2EZ0D 1HI6A 2WUBL 3FOLA 4ZSOE 4IJTA 1SPDA 1FFNB 3S2AA 2FBJH 5G2NA 4LOEA 5C0AB 3JVGA 5M94B 2DOCA 4PPTA 3GNML 2IXQA 2C8NA 4NIKB 3HBGA 1WFNA 2OS7A 1S78D 4KDWA 3P40A 4X50A 2IALB 4Z7UF 2XUWA 4FQJH 4IOFD 1OM3L 2Y25A 4MZ2A 5F44A 4GUQA 4XWOC 3WIHH 4Y2DA 4P2OA 1JK9B 4GKSB 5KVFH 4I0PA 1TLMA 1X9UA 3MACL 3VWJB 3EZ8A 3AGWA 1MAML 4QDGA 2BJMH 3MR9B 3PPEA 5TDOB 3PP4L 4XWGL 5GRUL 2XT1B 2LU5A 2BC4A 2ZNWA 4IMLB 5DMJB 2YQ2A 3QAQA 4S1QH 3VWKC 1PDKB 5CZRA 1DVTA 2X6UA 5B1JA 1JDDA 2C3WA 3CDCA 3F12A 3U48A 4Q56A 5TDOA 3SCMC 5IJBC 1KCVL 5DJAA 2AHIA 4Z7WF 4LLVB 4NYLA 1FH5H 2E5EA 2NY7H 4NUJA 1BHGA 1T7XA 1HWGB 3TT1L 3ILQD 4PWGA 2HG5B 3PWLB 1A9EB 2GEQA 1CD1A 5DS8A 3LS4L 4AVIA 4I9XA 4WV1B 2GTZB 2FIKA 5DRZA 2QBWA 2HT3C 2VDNL 1ADQH 3GXMA 1YEGL 4QRPB 4AKOA 2QVFB 4FNSA 3FULA 2IBBA 3RU8L 4Z23A 4Z7WA 1HWWA 4WV1A 1UOWA 1P5UB 1U8KB 5D4HA 4F91B 3VX0A 5JHAA 4LQFH 1BD2B 2BVUA 3IJYA 3DPBA 5BZWA 3U1QA 2Q8BL 1J9RA 4XPAH 1GS7A 1KENL 1YEIL 1ZA6A 3AUVA 1CLYH 2XG4A 4PJGE 5L6YL 4NHUB 4PBWD 3ROLA 3CK0L 4E42A 4LP4A 3GSVA 2WQAA 1CC3A 1JXGA 3CHRA 1AGCA 4JE4B 3UBXG 4OTXL 2ATKB 4PJGB 3QEQD 4H8QA 5T33H 2YD2A 1SOSA 3V8OA 4UANA 2HT2C 4YUEH 4N8VG 1B4JL 4OVUA 4ZUTB 4ABWA 1M42A 2BK8A 4W70A 1AR1C 2Q8AL 1LO0L 3VYOA 1ZSDB 1R33A 1S5IH 2XTJC 5IHHA 4AGPA 5ICXA 1A1NB 2VMEA 5L9DL 1ANUA 3CFCL 4I88A 1QYGH 2X40A 4LPYA 1F1GA 3FCBA 3E3QC 4OLUH 5FUCE 5DR5H 5MEPB 3O3DB 3FAXA 2Q2EB 4EE2A 2ZAGA 3L6FB 4QEGA 3UC0L 3BT2L 4L9LA 2GJ6E 4NO3B 3GI9L 2ZJSL 5C1MB 1IFRA 4GRMB 1CFTA 4NBZB 5DT1L 2B5IC 1DN2A 2C9VA 4IHBA 1S2EA 2DQUH 2RMNA 3LHPL 4LHUB 5D1ZC 2XG5A 3QDGD 3TU6A 4B7LA 3BKJL 5ICZB 1M7DB 1GKOA 1NCGA 2EIZB 2N7BA 3ARQA 2FE0A 5EMYA 1BREA 2OM5A 1BOGB 5LLIC 1R3KB 1Q9WA 1KYOK 2DAVA 1X5JA 4HK0B 4LARL 2EDEA 3N40P 1M57B 3L3IB 4G5ZH 3RWIB 3NESA 3CX5K 2ZSVB 1QUPA 2WSPA 5IHUH 1EQWA 3VDCA 1JYWA 4BZ1H 4IRJA 4I2XE 4U33A 5E8PB 4TTDD 4DKAA 3HMXH 1X6NA 3DO7B 2WWMC 1FYTA 1FFRA 5AENA 3F6IA 1FNSL 4AYBA 1MUJA 5FYKD 4DW2H 4N25A 4PJDE 5IJDC 1KELH 3FUHA 2G2NA 4NT6A 4AZ8B 3ZDXE 3OB0K 4OFYD 3TA3D 4TRPL 1JNJA 4DVBB 1DBKH 2YC1B 2PO6C 3HMWL 4OD1H 4U6YB 4WZ9A 3FTZA 4Z7AA 1U6AH 3SDAC 4NT6B 1PPIA 2I5YH 2QQKL 4BCYA 2I9LB 1OD9A 2A2QT 4BUHA 5CMAA 2F54A 2YJQA 4TUKH 1ZHNA 2R7EA 4LFHG 4FQ1H 4G6FB 1K6QH 4QKXB 3T77B 3P4OB 4MMXC 2EZ0C 1IAOB 4PRDB 1QEXA 2ZCLL 4ERSH 1EJFA 1OARL 3QAZB 4AQEA 3NCBB 3S36L 4UMGA 4Z77B 4YGVB 2LT9A 4NKDB 4EQ3A 1A0QH 1SDDB 3GMRA 5LDSA 2BH0A 2JB6B 2GJZB 1JF5A 2JELH 1UACH 1A6AB 4LCIH 5C08D 2X1XR 1WZ1L 1CICC 3DVIA 4GRLC 5F88A 3UYRL 2BXYA 2OXGA 4FZEH 1RPQA 2ITEA 2O5YL 3S5LG 5IMMA 4NS0A 2J1ZA 3C12A 2O6FA 3G6JE 3ZDYF 1TCMA 4DKFL 4XI5D 4CGTA 5LCVA 2DKMA 4RGMB 4ETQB 2JH2A 3AAZA 1JZ3A 3CIAA 4JGJA 5HI3C 4QAMB 5HHOB 3ABLB 1GZHC 3L3OB 4BCZA 4OZHA 2ZUQC 2X4TB 1XF4B 4DPRA 4ZNEA 3LVTA 3P0GB 5T8IA 5D70L 1P1ZA 4HETA 3KYOB 1TKWB 2Q76B 1WBYB 2RH0A 2COQA 2LVEA 3DBXA 1MQKH 2ICES 1YY8B 3L3OA 3QISA 5T1LA 2Z93B 2VLRB 2PTTA 5I17A 1VGEL 1FVDB 2ESVD 4UWQB 3X1BA 3TEUA 2EXWD 3KVDD 3VXRB 1NPNA 2ICEC 1QLRB 3FQUB 3JT0A 1KN2L 1NGWB 4CADB 4ANXA 2NX5B 5CEYB 1MFBH 1O6VA 3OKDB 1UHVA 5DHVH 3ZGIA 1XH3A 3HFMH 1UT9A 2NZ9C 2E59A 2X6BA 3R7QA 1WD8A 4HK3J 2BMKB 5KS9A 1KGWA 3RFZA 3P0YH 5G4MA 1X5MA 4HFWA 5L7XH 5HDQH 2EC8A 4KNSA 2EDFA 3VXSA 4NN5B 3KYMA 1KDJA 1IIKA 5CJ5A 1NINA 3LIZL 2VKXA 1HX0A 3K5SA 1YN7B 3BVWA 4P4KC 2ADFL 2ESVB 2YEZA 3GBNH 4B9KC 4X5XB 3TEXA 1JZHA 5DT1H 5GGQL 3NP3A 1TQWA 4IRSA 3CVHA 5I66B 2UUDH 1GOFA 1BLNA 5LXGH 1BX2B 4DAGL 1T6WA 4M43L 2ZAHA 4B9IA 3UYRH 3CZNA 4W1TA 3UJJH 4ALAH 3JYCA 5I15H 1N5AA 2WJ7A 4PJIA 5IB3A 3DYPA 4KK5C 1P53A 5E51A 4HIXL 5EZLA 3TIDA 4ZMLA 3ABZA 4ECNA 2C9SA 5DGRA 5BW7C 3NQKA 2DQJH 4PLJC 5BVJA 2B08A 2V5TA 2WWMD 4M7JL 5JPNC 1KSRA 5KBMA 4KKNA 5L4FA 4JQIH 1ZVHA 3MCKB 3Q48A 1NDMB 2AXFB 4G8GE 4MJIA 5CZVH 3T3PF 3T3ME 2XZCH 2EDLA 4QGYA 5EZPA 3HI6L 3C5SB 2YAFA 5F0JB 1KJ2H 1ZMYA 5C0FA 5DJ0A 4NFCA 2QGBA 3IBEA 3HPLA 3Q13A 4FTVA 1ZJAA 4Q97A 5CJXC 5B22A 3SGDI 1MCNA 3E80A 4X7EC 3FFCE 4HWZB 1UD8A 1FNSH 1Z0NA 1V5JA 4TMPA 3KWWA 1UG9A 3VFGL 5GS2H 2XWDA 5EO0A 2IANE 3QI9C 1E3FA 3ZN6A 1MEXL 4FNRA 2ZCKH 3MLSH 3PNWB 3ILEA 2L3BA 4JR9L 3F3HA 5K9KA 2VMJA 1JYVA 1T0NA 3MJ8B 4MJHA 5C2BH 1IZKA 4FC3E 3VGAB 5J6GB 3VDBA 1V7NH 2EEBA 5KVDE 1KB5B 4JFHE 5L0QC 1XDQA 1BF5A 2IWGA 3U36B 3VCLA 1CBJA 1WAEA 3NABL 4Y5YB 2EIEA 2OX5B 4L1BA 4OFYA 2C34A 4KXZH 2F19L 5AOJA 3OKOB 4EUPH 3DX4A 2OMWB 2AJUL 5CAYB 1JV5A 3C60C 4U1KA 4KMTH 1PG7H 2AJ3A 2X2JA 4GBXA 3LPFA 3SDDD 3U36A 2WLIA 5ABZA 2NNCA 3MRMB 4H1LB 3UH8A 1MZZA 3SDDB 2QPUA 1LP9F 1TQBC 4PRHB 4PRID 1F41A 2OV0A 3SEPA 3WFCL 4Y7OC 4ZUSA 1PY0A 5FM8A 2MKWA 3HZYB 4TVSa 4WTWA 5KYUA 2PPEA 1JWMA 4YR6A 4M6ML 3VQ2C 3VWKD 3VI4A 4HUXB 4IS6A 1O6TA 3QWNA 2EIDA 4IHOA 4PRHE 5HSFA 1PLBA 3Q2NA 3TX4A 5AYTA 3ELAT 4L3AA 1IAKA 4HS6A 4X9IA 3RVTD 1FO0B 5ABDE 4RAVA 2XZCL 2ZXGA 4RFOL 2CNZA 1U9KA 1U6AL 3SKMB 2MMXA 1RZJC 4MCNA 4OJFH 1KLGB 1YNKH 1KTKE 4MNGB 2Y2YA 2CXKA 5T3XL 1G9MC 1LHZA 1VACB 1DE4B 2ORBH 3BXNA 3JWDC 3D3VD 3NEXA 4NAJA 5I8CB 3ELQA 1UYWL 2CRIA 1NIAA 4HUVA 1A1MA 1U91B 4P46B 3FTSA 3C6LB 4X7FC 4Q89A 2FR4A 5DJZA 1KJ2A 3QUKB 3EZJB 5JXAH 2DKSA 3QDJA 1KCSL 3MA7A 3HNTL 2JMRA 2I7SA 2Y7LA 3E0GA 1JPGA 1ETA1 1T1ZB 3OAZH 3QUXC 4MBOA 2AJYL 2X44D 1RIHL 2PXYD 4MB3A 5ISZA 5BUAA 5E8DL 1NUFA 3SY0B 3NT0A 1L9NA 5DVNA 1G84A 2L7JA 1KFAH 4WF7A 4B27A 1P7HL 4JFDA 1IVTA 2JWYA 3UTTA 3O0RL 3ULAB 3WS6C 3V9EA 1DJZA 3V10A 4BSJA 5IFJA 3NABH 3R19A 4FMKA 4LCUB 4PJGF 1XB8A 1EEZA 4ODVL 2OMBA 4I4WB 3KZ8A 2AXWA 1G4MA 3CVHH 3D69A 3WE6A 4I0PB 4TUOB 5EUOA 4LVOB 5I82A 4F8PA 4TS6A 2EXTA 2F74A 3QYMA 2ERJC 3G5VB 5IUSA 3BW9B 3GKZA 2WO4A 4QMEA 1M9WA 5CXPA 4L4VE 2FEEI 4LPTA 1J18A 4ZO9A 3T1FB 1EHAA 5FGSA 4H8UA 2MRYA 1MAJA 5GZOA 5JO5B 1XDTT 1J9QA 2FEDC 4XP1H 3QR1A 1FL6B 5TQ2L 1A2YB 1E28B 3EOAA 4HZLA 3ZTJG 8FABB 5CP3A 3T0EA 3QI9D 1F3DJ 2B59A 3IKCA 1KXVA 5F7FA 3DIDA 2OCFD 3ARPA 1J8HE 3NJMA 1NGZA 4F8NA 4PUBL 1NOLA 4MMYA 4XMPL 4TQEH 1P4UA 1ETJA 3MRRA 5J7CC 1PD6A 3BQUA 1LYQA 3EBIA 2HKFL 5EBLB 1TXKA 4PB9H 3QFJB 4DPCX 5MERA 3EOTH 4RBPH 5GS0H 2EXYC 4PRPE 4PFEA 2JKNA 3G6AB 3ORJA 5F1NB 5DD5L 1VERA 2FT6A 5DA0B 1OD7A 4ZMYA 1NCDH 3NFPB 3GJFA 4F7CB 2H4EA 1CF8H 2OCJA 4I18A 3LOWA 3N04A 4QJ5B 3R0NA 4M29A 3QS2A 4ONOA 4LEXH 2ZG3A 2WLLB 4TNFA 3QUMB 2FWUA 4C55A 1MVYA 2Z34A 3UJJL 4F37K 4U4BA 1IKOP 3K6SB 3TA3C 5ADOL 4KGLA 5DQ9A 1T21A 3AQZA 4KKRA 4OCRL 4ODVH 4TUJA 4WI4A 2A6IB 3P2DA 5T1JA 4FADA 7TAAA 1NM4A 2OW7A 3C5ZD 2DI8A 1XIWC 4N2CA 2JXMB 2J1YA 4XVTL 3QRLA 5DSCA 3AT9A 3B2VH 4FLSA 5E9DE 1TJXA 1KGCE 4WO4C 4TPRL 5MEPA 5C0CB 1UKTA 4F9PC 3UFIA 1NTDA 4JZJA 5DD0L 1TMQA 4HXAL 1WWWX 4I8DA 1KGXA 1I8IA 1QNIA 2AMGA 2E4TA 5T1MB 4EI6A 3AU1A 1M9SA 5HGAA 4FDWA 4P4RB 3LPWA 1OGTA 3OQ3B 5C7ZA 5JHBA 1BZ9A 1CD9B 3N6YA 3U79A 4H5SB 4P2RE 3GSOA 1FFPA 1L9QA 3DV6B 3B3IB 4JPSA 5HGBB 1HIML 5A1AA 3O9WB 5T3XD 4LK4A 1BIIA 5D72H 4AH2A 1SOQA 3U7WL 3VXQA 5F6IB 1QWHA 3LZOA 3NRQA 1HL9A 4NRZA 2ENSA 3BH9A 2WNWA 4UTAH 5H2BB 3W5NA 3H4HA 5C3TA 1GZPA 1PIFA 4OD3L 5EC1A 3EJTA 3HE6C 2DI9A 1UXWA 5B1BB 5CLXA 1J1PH 4I3RH 4APQD 3US0A 2P5WA 1U3HA 2XPYA 3FN0H 1AHWB 2LLLA 1SJHA 1BP3B 2F1EA 3N0PB 4H26A 3EGSB 1FWXA 1MCQA 5KVGE 4IEFA 4ZJ9A 3F2LA 4XI5C 1OHZA 2VR5A 3JV0A 1DEEA 2VLME 1K8IA 3GI8H 1FCGA 4JY6A 1SXNA 5FHAH 2VC2L 3MV7B 4LIQL 4PLKC 2NNAB 2H9GA 1SF5A 2BSSA 3TFKC 1ESOA 2P52A 2I9LA 1QEWA 4Z8FH 5CJQL 3MRBA 1CFQA 3QQ4A 4YC2C 5IQMA 4ZS7H 5IQLA 4KROB 4N2DA 2WLZA 3ULSA 2YARA 4OUUB 3LKRA 1TZHB 1ZGLM 1M1SA 2X2IA 3MRPA 2A6JB 2YS4A 5IT2L 1JERA 2GK0A 2KI6A 4FQLL 3OHXB 1B2WL 4HQQL 5D6CA 1BOYA 3KW8A 4Y4KD 3G3LA 5K9OA 5AAMA 4LRNH 3ZIYA 3QXDA 1I9RL 4K8RD 1E4XL 1R5WB 3LKRB 4POZD 4ZFZA 5HBBA 2PN5A 2BNQA 1DQTA 1JF1B 2EYTA 1U8JA 2IG2H 1K4CB 3T2PA 4UV4H 2PO6D 25C8H 3B5GA 1J8HD 5T1LD 1CB4A 4KJYB 4P5KA 4NJAH 1KV7A 3OXRB 3NEOA 1ONQB 3V4VL 4XO3A 4G7YH 4ONGL 5IQNA 4B96A 1I1YA 3REVB 3I6GB 3SDCB 4KJWD 4JY5L 2EVHA 3P54A 2OJ1A 4HH8A 1CT8A 2AJXH 4L3EA 2CCLA 3WNMA 2JIXB 3LPGA 1NUGA 3L7FA 5D7JC 1A6ZB 5AW0B 1T0PB 3HR5B 4Y1AA 5EIIG 1TKWA 4Z3TA 2OCCB 2AJUH 4L2LA 4XNZC 3SGDH 2H32A 2CDFA 2Y1YA 3GHPA 4M56A 1TG8A 3M45A 3LXUX 1S7XB 2Z65C 1WFUA 1WFIA 2PYEE 2NY6C 4LQFL 4WW2B 3C9NB 4NWUH 4JDVA 4DIXA 3LV3A 1LGVA 2JI1A 5F9WB 3SJVB 4BFJA 1RURL 5HGDA 5A6LA 5IKCA 1NGQL 3O6KH 1EWHA 4PJEA 4Y16D 1UWEH 2HTLC 5JXED 3LPPA 1LO3L 2TSBA 5F7UA 8CGTA 4QCIB 2B1OA 2X1OA 4KXBA 3QORA 3RPIA 1W8NA 4APXA 4JFYA 2BVPA 1CPUA 4KXZI 4NNXA 2AEIT 5EU7C 3OXSB 1KCKA 4N0UE 3SQOH 5DD0H 3DYOA 4C8XA 4GG6E 3BLBA 4YLQT 3SD5A 2ZZUT 3DX2A 4RA3A 3BP5A 4YO0A 2CO6A 1T6BX 1U8OA 1XF2A 4JG9A 1OK0A 1F3DH 1GYWA 3FW6A 4V11A 2VABB 5I8KL 1X9RA 1NCNA 3HN3A 3I74A 2BNRE 4LHQB 2EDWA 4MD5A 2NTSP 3ARFA 2CHNA 3E6HA 4OKVA 4YO0B 3H53A 1I7ZA 4BSVB 3Q5TA 5C2UB 1T5WB 2JIXD 1PKQB 1S7UB 1G9NL 3C8KB 4EN3A 4Z7IA 4G71B 3VRLE 4WI7A 2XV0A 3G08A 3ZT5A 2Y7QA 3MLPA 3HI5H 4WU5A 4J28A 1B4LA 2B16A 1JK9A 4GKSA 2Q86B 3UTSA 3V6OA 1UJ3C 5KWYC 4PJAA 4NUJB 1D6VH 1UFGA 2GK2A 5IZ7A 5ITFA 3LQAL 1AZCA 3R4DA 3K4DA 4ZTPL 3UABA 1GW0A 1A9EA 3P4NB 1KWKA 4RFNC 2FIKB 3CSYB 4CSTA 4NIYE 1WWBX 2GC4C 1DBBL 3T8XB 2WXIA 3F12B 3U4BH 5EU6A 4QTIH 1UOKA 2YGNA 1X7QB 3NIDB 2CJUH 1T80A 3PNWA 5KSAB 1T7VA 3EJUA 5DWUH 3HMXL 4QIRA 3AQYA 2D3VA 2H2PD 2YA1A 3AVEA 5KVFL 3B2MA 4JPQA 4WI0B 3BUPA 3MX0A 1KPUA 4M8VA 3IDXL 4UAHA 1XCXA 2WXRA 3S3PA 4OQTH 1XR8A 5DJ8A 3ZE0E 4UF7C 1OP4A 4ICWA 3O81A 2A6DB 2QQNL 3PJSA 2GKIA 2VISA 4LCWD 1KFGA 3RB7A 4V2CB 3QUXD 1FNLA 1P5VA 4EI5A 5IEKB 2AQNA 3DNKA 4HGMA 4P99A 3T71A 5FYKU 1J0JA 3RNKA 2NY0C 2YK1H 4HS8H 2A1WH 2GI7A 1QLEL 1ZT4A 3ZVVA 1OALA 3HVNA 5I0VA 3DUSB 3U7YL 2DM2A 2FJHA 4G80A 1O6SA 5DVKA 4OZFA 1BFVH 1H15A 1KJVA 4IHOB 5ESVB 3DTXA 5D6DC 4XN5A 1A02N 2C3XA 3K8LA 3R4RA 4C56D 1TQVA 1I3RB 3QVAA 4DK3A 3MV9B 1QFHA 5C08E 4DGYL 2OI9C 4IRSD 3OJ2C 3ULUL 2F7IA 1ES0A 3QZNA 1FYHB 3WDJA 3GT6A 1CGTA 4Y8DC 5KN5B 4JREC 3MRIB 3GMPB 3A21A 4ODUA 4CILA 4DKTA 1DE4A 2KLRA 4L9LB 3MLWL 1M7DA 5TFSH 4HOZA 1B0IA 1ES0B 1FZKB 4JVUA 1A6VH 2FWOA 1DJXA 4MFHA 4XR8C 4YQXH 1K4DB 3O3EA 5LGYA 2CKBB 4R26H 5EOQH 5T1DH 1X5AA 3KPRE 4FQLH 1LJMA 4JQVC 4AEHH 2FYYB 1B3JA 1PCXA 4IGBD 1LO0H 4U0QB 1QLEB 3IAGC 3FQNA 4R90L 4MXVE 4YH6A 3TFBA 3VTMA 3B5HA 1MFCH 3MLZH 3A23A 3NJHA 4Y4HD 2CUHA 1MKFA 4IIQB 4AI7A 3ARVA 3CJJA 5E6IC 3GHBL 1ZE3H 3KYNB 5DJCA 4PRHD 4FAAB 2YBRA 4KVCH 1O7VA 4BKLB 2DJ4A 1XF3A 4M03A 4IIQA 2HTKD 2X4SA 1J5OH 3FRUA 3LRMA 4IBLT 4ZYKA 3KYNA 5DJCB 3WLBA 2OTUB 1IIIA 1YNTF 3RPKA 4PHXA 4AW7A 5AVXB 1QFOA 4LNRB 3QNZA 4C4BA 2IDQA 3W39B 4PN6A 4M8QA 4Y19D 2WXKA 5KYYB 1SDYA 4NI3A 1A4JA 2D3LA 3T77A 4WKZA 3QG7L 3POCA 1JD7A 1KLUA 2CO7B 5INDA 4BUGA 3PYCA 5HHXH 3FS9A 4J3WA 4AM0B 1FL6A 1QFPA 4QXUL 3TESA 2WLYA 1E28A 1M1XA 4XMWA 1L5GA 4NI6A 3OPUA 5CCJA 4AIOA 1UOVA 2ATPA 2ENYA 3KLKA 2NYYD 4NQQA 4TV3A 2BP8A 5FUZH 1KBPA 3Q5OA 1R47A 5CHNB 1EGJH 5DZAA 1NCWL 2XHNA 3H3BC 1J1XL 1U8LB 5DQJA 3VI3E 1NMAH 4UQ9A 4ZPVB 3U0TA 1P2CB 1OAXL 2YPKB 5AOIA 3LNGA 5D1QB 1J05A 4UT7L 4AQEB 4YXHL 3BLKA 3SQBB 1B0RB 3BCDA 4W4NA 4PJ7E 1FHGA 1XAKA 4NM8H 2HVJB 3RGBA 4CVZB 1NUDA 2EDTA 4FOMA 3VRLF 4LBAA 5EHFA 5D55A 4PR5A 4LLMB 1BQUA 1IEBA 2VSCA 2Z31C 3D0LB 2Q8AH 4HMCA 4KZDL 5IMMB 3STBA 2NY2D 4FQIH 2APWA 1OL0A 2CDEB 2COVD 1RSYA 3C5JA 2EDXA 1Z0MA 2H1XA 3A6BH 5AZEL 3PJLA 5C70A 2ZOKA 1UWGL 4NP9A 1SJEA 1P7QA 4HIEA 4KNUA 3QA3A 3SGKA 4YHKH 3TONA 4BRVA 3NJNA 2P8PA 3VXRA 2CDEA 1MRDL 4ZK8A 3ZQXA 4F2MB 2ZKXA 1NGWA 1WBXB 3AB0B 3QO0A 3MYJB 2C26A 4LPVA 3OZ9L 4MJIE 4G8GA 1A14L 1WBYA 1O5PA 2Q76A 4NO5A 5DJYA 3S0PA 3QUZB 1T5XB 2XKSA 3D9AH 3L5JA 5ENWB 1ZEAL 3MJ6A 1ZLWK 5I17B 1JXDA 2DQUL 3LHPH 3PGCB 4FTVE 4OJDH 1H0DA 1U93A 3BO8A 2G30A 2BVOA 4NO5B 5DJYB 2VXVH 3MCLL 5DK2A 3KPTA 4QWWD 3VXOA 1BZ9B 5F7DA 3LN4A 2ADFH 3GBNL 4G83A 4PBVC 7FABL 4MA1B 2Z31B 5FK9B 3U9PH 3CMOL 4X6CA 1ID5I 3TNMA 3ECUA 5DUML 5C6TH 2R2EB 3RFZB 4WUUA 5C0EA 4UQIM 2V7NA 4DCQA 2JVUA 5DCCA 2DWXA 4AYID 1JGEB 1Z5LB 1G7QA 4Y4KC 1M71A 3EYVB 4G6JH 3PNRB 1DSWA 2J4WH 1U2HA 2H1PL 3CGTA 3GJFK 4X6DA 5AW7B 5J11C 4DW2L 4YXHH 4OW6A 1PY4A 2A83B 4ODWB 3BKCL 2N7AA 4PG2C 3T9WA 1A9BA 4UNIA 3CQQA 3OB8A 3BAEH 5GHWH 4PSRA 3NCXA 5EUOE 2R0LL 2VZOA 3MLTB 1KY6A 2FX8L 2A73A 2DYPA 2AXFA 1CE6A 4NQED 2OMZB 1WDAA 3AY4C 4HUUA 4KZDH 1HHIA 3N2JA 5JPMA 5C0FB 5KOMC 1G7MB 2WO3B 3H85A 3ULUD 2CA3A 4UTCA 5IB3B 2ATAA 4JGMA 5EZLB 2OL3L 3TIDB 1QP1A 1NIEA 3TFKD 1AKPA 3QH3A 3FAWA 2Z4QA 4R2GB 1XH2A 3NCJH 1HFUA 3QJQB 1CDYA 3ARED 3IPEA 5DTFA 5JNYA 2D7TL 5EULV 4WK0B 1G9EA 3C60D 3QXAA 3UAJD 4M61A 4U6HB 2WK2A 4GAYA 4ZNEE 1D9KB 3BGMB 3EGDB 3P4MB 2GY5A 3U25A 3VJ6A 5J6SA 5LQBL 2ZPKL 4H8WL 1BPLB 3KPLA 4MBRA 5HHXL 3ZZQA 5L2KA 4AKPA 5B3NA 3SZ6A 3FU0A 2E3VA 3P3TA 2H41A 4TTGA 3KLQA 5JW3H 1CFMA 1PZDA 2VR8A 2BRRH 2XACC 4PB0L 3HI6H 3TA3B 2LABA 1K8DB 1KPRA 1DUZB 4TN9A 3QUGA 3O9WC 2D0GA 5G5DB 2AI0H 3TV3H 3Q6FA 3MRCA 2BCKA 4JG1L 3CHOA 2DIJA 3CMGA 3QT2A 4G6JL 3RKPA 1NBYA 3V4PB 1P0SE 2NUTB 1JV5B 3JV6A 4Y2DD 3ZT7A 1NL0H 5E7BA 4JFZH 2EE6A 4K2UL 1QBML 5E2UH 3CVIH 5IQ9A 1MG3C 2F5AH 1B4JH 2XA3A 5B1CA 4MNQA 4W6WB 3U82B 3EADA 2WZPD 1T83A 4ZUUB 1SN5A 4ZD3L 5BVPH 1GC1L 4AIZA 1MCPL 3ARSA 3UX9B 3EBGA 4TQPA 1U8NB 5CJOL 4FXKC 1KXQE 3BVNA 4C57C 1UA7A 2HLAB 3FO2A 1KGUA 1TT6A 1RUKL 5F6IC 4H0IA 1FL3B 1M3JA 1HI6B 5DMGC 3K71A 4K94C 4AVHA 4LEOB 1ZTXH 2B9BA 2J72A 4JHVA 3L9YA 2WXFA 4CUCA 3CZKA 3NCJL 3V4LA 5MENE 1MRDH 2IDTA 1UXMA 2IXQB 2C9PA 2WXGA 2YUVA 3H9SB 3BWUC 4LEXL 4QCIA 4A7SA 3ULVF 4D0DA 3BFQG 1RZ8A 1KWGA 2WLHA 4FD0A 1KCVH 2EUZA 1E3ZA 1ZVSA 4OV5A 4J4PD 4DGYH 5DHVA 1H8SA 3HNSH 5C0BD 2DI7A 4L3ED 1SVCP 1FZOA 1W72A 2BDNH 1FFNA 2P47B 5I71B 2FLMA 3D39E 1SN2A 4HWEL 2ZP8A 4N0FB 4XMTA 2FNWA 2ZYRA 2VDNH 1OTUC 3FTUA 5K33A 1LP9B 3NA9L 1KOAA 3DMMD 3AY2A 4QRRB 3C6EA 1RL1A 4HYTB 1N0LA 1QASA 4JS7A 5AW2B 1I53A 3QEQA 3SE8H 1JZ2A 4PJ8C 4CU8A 4V1DA 5E6SB 1FZMB 3AT0A 3UTQA 5JIDA 2ZWSA 3PDDA 1YECH 3H3KA 1ADWA 1IC7L 2CPCA 3CXFA 3NA4A 3KPSD 3V0VB 4MAUL 4KTGA 2CNYA 3RWDB 1A5FH 3FFCD 3ZZ1A 1RZIA 2ZX7A 2Y1VA 4AKQA 5TQ2H 5L4JA 3QIBC 4K55A 3BKCH 1ZHBB 2CR6A 4M62H 3RTLA 2PO6A 3VXTB 4YUEL 1EHLL 3LTVA 5DMKA 2VDKB 4OF6A 5IWLC 2C1PB 3T2NH 4LSRL 3QJTB 3T8XA 3IJ9A 5DD3H 3A6OA 5AZ2H 4AIXA 3IRCA 3LEYH 4NHUA 4NZRH 3ARDA 1U8HB 3I9PA 5IW1B 5BS0D 1R1CA 5KBPA 1HYSD 1S3KH 4JW3A 3EOAB 4A2EA 1I3VA 3FHEA 2CK0L 4XO9A 5DK3A 1MNNA 3H54A 4JFOA 1AKJB 3ULVH 4WFFD 5IEHB 5L2JB 1UD3A 5D7IA 3RWFA 3CMOH 3IFNL 2OMUB 1DUYA 4F7EB 1UACL 4HCFA 4PJXF 5F7AA 3EBAA 4ZMTA 4YXLH 5CLTA 4LZKA 4ETYA 1G9NC 4OFDA 4HWBH 3V0IA 1TDQA 3TVMC 5DC2A 1NKOA 2UZIH 5ADOH 1FAKT 3IDMA 3L48A 4UUJB 3GSRB 1URZA 1TVBA 3KM2A 4L37A 1DQVA 4NKOB 4Z5RB 1KGYE 3POHA 5IFHL 3QNYA 1AI1H 5JYLA 3VXNB 4X7SL 1ZS2A 2W9DH 5F9WC 1NOAA 4PG9A 2W0PA 5EPMA 1YECL 5C0CA 2E56A 2UY7A 4GINA 1IBBA 4KKAC 4NKOA 2QPSA 5KYNA 2XTJE 2DWEA 4AUUA 2ADYA 3VSTA 3VXNA 5GZNC 5AVRB 1GS6X 3DTXB 2HX7A 3I3EA 1IM9D 1GYAA 2J88L 4XNZB 3TBVB 2BNRB 2R27A 4JB9H 1MVFA 4MYPA 2FX7H 4QTFA 1D7DA 5HTSA 4OFIA 4AJVA 1VLXA 1PVHA 2F58H 2WWKO 1SBSL 4MB5A 4V2BA 3B2UC 3DK2A 2E8YA 2W94A 3LNDA 5GIRB 1TTGA 3N85H 2Y2WA 2ZIDA 3T3PE 2Z8RA 1A4KB 2CCVA 1YDPA 3PU7A 3B7RL 4PW3A 4HC1L 4ESKA 1TITA 4NZRL 5I1GH 4IGBC 4K8RH 1JZ7A 4X4YB 4O2CA 2VO8A 3TH2T 2EIZA 4OFQA 4OH2A 1YMMD 2ICWI 4AL8H 2YSTA 3E1ZA 3EJCA 5CKGA 3GLDA 3GYRA 4HS3A 1U3HB 2MNUA 4PJ9D 4BELD 2HXAA 1DDTA 2XSKA 1UH4A 1KIQB 4S1RH 3SGJA 5HVHC 5SV3A 4BZ2H 4ZFGH 1HL4A 4UIKL 2AJVL 3QC5X 1CFNB 3KPPA 3L4YA 2V8LA 1QRKA 4OZGB 4F80A 2OMVB 2F0CA 3B2PA 3DIFB 4WFEE 1JGLL 2F53E 3INOA 2ED7A 5EU4A 3KPPB 1LK2B 1W15A 2PWDA 3HI1B 3VFOA 1VENA 1S9KC 1XGQA 2CGYA 1YEEH 4M6NL 4PJCF 4NLHA 5CR1A 2IVFC 4KK9C 4WNJA 4NQTA 4M8QB 1CFQB 3U9UA 4XOEA 1Q0XL 4WEEA 3BAEL 3KPSE 3Q0HA 5GHWL 1OANA 1D5MB 4P5TB 2PYEA 4IOSA 1KDIA 5I6PA 4LEEA 1INDL 5GJSH 3UPRA 1NC4A 4FQQA 4W9ZA 1F4WL 3QIBA 5E8NA 5DLMH 5J3HC 2NYYC 1W0VB 2RTTA 4KI1A 4QO1A 5I8EA 3IVKB 4Q0XH 4G6KH 2BNRD 2Q2LA 4ZUWA 2EYTB 3QIBB 3A24A 1JNLH 2Q1EA 5CCHE 4J2QA 2FD6L 4J3OG 1DL7H 3OMAB 3EGXA 2J5LB 4KTEL 5TDPB 3GEFA 2GK0B 4XP5H 4Q9CA 1YNTA 1RK1A 2HFEB 2FRGP 2X4TA 4Y5XB 2DIAA 4FP8L 4DO4A 2R2CA 5F88B 3MUY1 3WY4A 3R06A 3EDDA 3QHFL 3T8VA 2BHFA 4CKQA 3SE3C 3FCTA 1E67A 1JGVH 4GI9A 4Z7VE 4UTBA 2NZ9D 3B9EA 3S3JA 4Y5XA 3VB9A 1D5XB 5FDWA 2PTTB 1Q8MA 1QI4A 3GJEB 2CLVA 3BIAX 4JY4A 4YHIA 4YEFA 1INEH 5H94B 3GSUA 4G8AC 5TE4L 1W9XA 1G7HB 1NCUA 3WFDL 3ZY7A 5EBGA 3SBWA 3WAJA 1GCFA 1JNHB 2AK4A 2EKSA 2FO8A 2H32B 5BXFB 2PYFB 4KJPD 3DETD 3D0AA 4WK2B 1S7XA 4ELMF 5BOZG 5F21B 5IOPB 3ZO0A 1AHWC 3W11D 3DJSA 4B9GA 3KAAA 5BV7H 2MQ3A 5B7EA 4Y16C 3SJVA 3H56A 4WI2A 1AXTH 4D9RE 1VGEH 2O6EA 1KB9J 3FPYA 1NA8A 1NAKL 3KYMB 1NLBL 3VFMA 2EO1A 3JT2A 4OQTL 4W9FC 3ISYA 5IBLC 4M7JH 3VGHA 1LQBC 1HIMH 4LNVA 1XH3B 1MLCB 1R3LB 2QVMA 4U1NA 4YEEA 2FX9L 4ZFOL 3TEZA 2V17H 1BQHG 2FH8A 2UY6B 3WFHB 4AK2A 5CBAA 2O61A 3RWCA 4N1HB 3WTXA 5HGDB 1KIUB 4KAQL 2FQDA 2UZYB 4Y5VA 1D9KC 2J8UF 3LNHA 1Z3GL 2EDBA 3AW5A 3NZHH 1ZHKA 1VEMA 3S36X 3ATEA 5D4IA 1HILB 3DX9A 4HIHB 4AMWA 4LSUL 3S96B 2ICCA 3MO1B 2FD6H 3ZDWA 3RVTC 1Q0EA 12E8H 3HC3L 1XF5A 1ZS8B 1I7ZB 4NZ8A 4BSVA 5BMFH 1OF0A 2J2ZB 4A6YA 5C9JA 3MCKA 1VZHA 4PRAB 2TSAA 1H3UA 3ATFA 3L4TA 2K4WA 3UZEC 2CLZB 2H8PA 2O5ZL 3CPLA 3O0RH 4KUCD 4ONFH 5EOTB 5DJ0B 4D8OA 1KZQA 1JHKH 4QOKD 3BPLC 4KC3B 4K8RL 4TNVK 4PJIB 5KSVA 1IGIL 2BO0A 1TYRA 3ETTA 1EZSA 1V10A 3LQAH 4MD5B 5K69A 4HKZB 1KJ3H 5IR1B 1PX3A 1SYSA 1ZLWH 4WHYH 4JHBA 4KK8C 5D2NE 1C1EH 2R56H 2BNUA 3THML 5DUBA 2G60H 5JDJA 3AS3A 1FIEA 4WTXA 4WFED 1CYWA 4IU2B 5B8CA 3KBHE 2X3CA 4P46C 3CFKA 2IH1A 1UWXH 4O02B 1KJMA 3FU3A 5JOPD 4PP1D 2WIIA 3OKEA 4BKSC 1DLHA 3HG1B 5EEUA 4DQAA 4JRXA 4WCYH 3AS2A 5CZKA 5D1XA 3T4AA 1KB5A 2YXMA 1HE7A 2DQEL 3RZCD 2EDDA 1WGVA 2QKIB 1IAIH 2J56A 4XH2B 1PZ5B 4LLAA 1GJWA 4NRXB 3NJXA 4ZFFA 5I1CH 3MV9D 5KEZA 4JRYD 4PJ9C 1I8MB 2MHAB 4YNYA 4NAMA 2YEVB 4Q8BA 1L6ZA 1WE5A 2WGXA 2VLJE 2Y22A 3TLRA 2DYPD 5E1GA 1JPTH 1ZTMA 2CDGB 4RDQF 5JHDA 2FL5A 4P48A 5E03A 3EO9H 1EBPA 5H35B 1V8HA 1D6VL 2WVSA 5F96L 2OMWA 4URKA 3BE1L 1EZLA 4P4KA 5A2LH 3BD4A 4CJ1A 43CAB 2HLFC 2KBGA 3QJOA 5JIKA 3LIZH 5D6DA 1JNLL 3B6SA 1OTUD 5D1QE 4U3XA 4LKCA 1WT5A 5TPWH 1TU2A 3ECBB 3CBJB 2YN3A 2W9LA 3L4UA 3VI3B 3FQXB 2E7DA 4JM2C 1KJVB 3IE4A 5CSBA 1T03H 1P6FA 2VGLM 1QZ1A 3B6SB 2VL5B 4M5ZH 2QMJA 4GQ9H 3L3KA 3WV0A 4ELME 5GRWA 1ZT4B 1NGYA 1AQDA 1ZJBA 4Q4IA 4CRPA 3ZE1B 1BFOA 1DBJH 4F5CA 4TSBL 5KSAD 3I6SA 2ZXDA 3TBSB 4O00A 1OSPH 2O5NA 2XWJA 1D9KD 1RHHA 2YKLH 2HLAA 3BP7B 3FO2B 2OFQA 3HW7A 2QQNH 2BWQA 3GMNB 4X6FA 3UZQB 1PS3A 2XZQH 5CEZD 2IPTL 1NGPH 1IEAA 2DQ6A 3AUWB 4FS0A 3Q06A 1QPXA 3LB6C 5CJXA 3KPNB 5DO8A 5T3XH 3GGWA 4HWUA 3LKOB 4GKOA 4KHXH 4CW1B 5DMYA 3MRIA 4UQ2A 5HJBA 1LEKB 1G9ML 2DWDB 3MNVB 4JEGB 1T66D 1U3JA 1VSCA 2A74B 5ANHA 1NBQA 1W72B 2OULB 3EF7A 4KI5E 3SBWC 3N5AA 3UBGA 1FSKB 1LTXA 2PLTA 2XVKA 2IQ9H 4JPKH 2A9BA 4U0RB 2KLTA 4PTUA 4OCSH 3DETC 3QHTC 4XMPH 2FDBP 3FQNB 2YAHA 5T5NF 4HP5A 4UYPA 3JWNE 1PNCA 1NPJA 3KG5A 1ZEAH 3WLBB 1UQSA 3FBKA 2PUQT 4OZIF 3MRKA 4LNRA 4ZW6A 2YAMA 1PFCA 3FSWA 3ARWA 4H44C 2Y1AA 3X1GA 3QG7H 4WO4A 3ECWA 1J48A 2F53A 5GXBB 2WUCH 1RUAL 2Z91A 4A2DA 4I1PA 3AITA 1BZ8A 3F6LA 5HHOE 1E8WA 4LF3A 3UBXB 1DJGA 3G5VA 3RJQB 1KTBA 1KF9B 3FB8A 3NIDF 5FHBH 3TO2A 1HTYA 4YSDA 3D33A 5ILTH 3O4LB 5LG6A 2I26N 2P8LA 5TE6L 4LQ1A 4MD0A 3BZFB 5CNHA 5C08B 4ES8A 3N41F 5C0IB 5IVXA 2CWRA 2GCYA 4LL4A 1NEZB 5AWNL 2B1AH 5FO8B 2ITCA 1H5BA 3T6VA 4ZMQA 3RYMA 2XRAH 1XGRB 3NCCB 5HHVH 5KANG 3H1ZA 3FB6A 5KJRH 1E8YA 1FVEB 1E4KC 2R69L 2FWLB 4HKJB 3DGGA 1TO4A 4FQXC 4QOKA 3SO5A 1AH1A 5IFAH 4UT9H 5AB1A 3EH3B 5ITBL 5IEHA 3MI6A 4Z7OE 3CFCH 4IRZA 1ZPLA 4Q6IC 3K6SA 1TETH 1ND0A 3QIUB 4BK8A 2G4GA 3KWTA 3KLLA 3VI4F 1FLTX 3H9HA 3MGTB 3RUGE 5EIQA 3IGAA 1DSFH 4OFVA 2YXVA 4J6IA 4PS8A 4YZWA 3ZZSA 4F58L 1ULVA 2IQ9L 4X9FA 1Z9SB 5E8OB 4EIZC 3TCLB 3HS8A 1BIHA 3QUMA 4C56E 4ZAKA 1TVHB 2DQMA 2Z93A 4AV4A 4YN3A 3NJIA 1IEBB 2RD0A 4G8GB 3VTTA 4JKNA 5AZUA 1KCUL 4PV9B 4DTGL 4KTYA 5IB2B 4R8WH 4N2MA 5TTRA 2GY7B 4CVXB 5KW9L 4EVNA 1X5LA 3DECA 2VB5A 2HRHA 1AZBA 3QW9A 1W6WA 2WXJA 3HRZC 4GG8B 4LSVL 4O02L 2Z7ZA 1RIUL 3PUUA 4RNRB 4E5XB 1USQA 2M2DA 4RMBA 1TTCA 4N2FA 3JTSB 4HJ1A 4X9HA 3EDEA 1AIZA 1L0PA 4NPYB 5J9PA 1LE5A 3W56A 2VERN 5DFVD 1QKZL 2IAMC 5GRVL 4LXFA 3AABA 3RVXD 1B0GA 3FUFA 1ECYA 2G5UA 5CJQH 1UWGH 1DLFL 4PRNA 2NY1B 1ZGLB 3QJXA 3VXQB 5A3IC 5I5IA 1DVQA 4PLKD 4P2QB 4AQOA 3EJYC 3NGBC 1S9XA 3GSNL 4MZ3A 2FGWH 3BD5A 3B7YA 1L7TL 3ABKB 4KVNH 3K3QA 1N5AB 4JM2D 3DX0A 3PABA 2A73B 4JQVA 2ROYA 4WLCA 5EO1B 2VDMH 1J12A 1M71B 1AFVL 2EDOA 4Y0GA 3F65A 3JWOC 4RGNC 1F6LL 4AQ1C 3WS3B 3F05A 3PL6C 1MFAH 1E4HA 4GSRA 3W0WD 4X4ZA 3J27A 5E56A 5HYSG 5I1AB 1KYDA 1HZHH 4DP8X 4LOUC 3BYTA 4F3FA 1CICD 2KKQA 4OJYA 4Z7WE 3V0JA 3E2HC 5HHNB 5KVEH 1V3LA 4P23A 3UJTH 4WIQA 3V5DA 4LAQH 4MNQE 3BFOA 1E30A 2AV7B 5D2NA 3BAKA 4OZGE 4R6UA 5DTFB 3LB6D 3UZVA 2H9GB 2NNAA 5DI8B 5IBUG 4FFZL 3RY6A 1DVZA 1OF2A 3RAJH 4XN4A 1FBIL 3R8QA 4UDUA 2PYEB 1Y18A 3CFTA 3IYLW 3MOBH 2HFFB 1WPCA 4LCYA 5EOCL 1K3IA 1NIFA 3ET9F 3O3UN 2J8OA 5BUGA 4LE8A 1JI1A 4LPXA 4YDMA 1FRGL 1RVFH 1IUZA 3VFTB 1TZHA 1EHNA 3LN9A 4MMZC 4XVTH 1ACCA 5E4OA 5IVNA 3BWAA 1QI5A 4QRPE 1QABA 3ARBA 4BH8B 4U3SA 2FEDD 4FG4A 3SPJA 3EGXB 4BZ1L 4F8LA 5E4IA 3SDCA 4Y4HC 3STLA 4XPGH 1S7SA 5D2LA 2WCPA 3TURA 1NKGA 3ARBC 2X4NA 1RZ7L 4PJCA 1XCQA 1EPFA 2B1AL 3OAUH 5FGCE 1JDAA 3MCYA 4CSSA 2Y7OA 4FFYA 4JM2B 2YLHA 4U2ZA 3R8BB 5KBDA 4HU2A 4ALAC 1TENA 1O7DE 3W5MA 2KDYA 1UATA 1J9CT 4PJIF 4DGWC 3VWJD 3GJEA 3LEVL 1JI2A 1DUZA 4RMWA 3O2DL 5JZ7D 1RULL 4NZJA 4CMMB 1IE4A 2J1KA 5AW8B 5B1AB 4Z3FA 3C9NA 5J11B 1A3QA 1OE1A 4JE0A 5EC2A 1T1YB 5CGTA 2K6YA 3QQ3B 5D4JA 2NY4D 5E6YA 1HSAA 1WIPA 2WVVB 1M7UA 5CP7B 3S5ZA 3KNBA 3T2OA 1J9TA 4CA4A 2RJMA 1J0YA 1UZ6F 4G1MA 4PJDB 3UDWC 1U3YA 3BAXA 2MOQA 2B2XH 4GLRH 3UCRA 3KM1A 4S1SL 2ZCLH 3DURA 2WUCL 1E65A 1S7WA 1GYUA 2Y72A 4K15A 5AB0A 3VD0A 4W9HC 5E1AB 4JRYA 1IT9L 1IAII 4BFIB 4FQHA 4HBQA 2WWNA 1HEHC 5INCA 2YGQA 1ZVSB 1MREH 1QSZA 3M1CA 2WMPA 4HEMA 4FQHB 4LDCA 2XTSA 4RMVA 4CU7A 4Y2NA 3L95B 3GXPA 1LILA 4ODXA 2GSIA 2IQAA 2ZUYA 1DQJB 2VMFA 1CG9B 3RX9A 3IETB 1RD6A 4IBVA 5CZVL 3ZQWA 2B1HH 2B3IA 2CBOA 3T2QA 2AK4D 1N0LB 4Y4FC 3DJTA 3C8KA 4X4XA 4ZOBA 1XGYL 5DUPH 4YC2B 2H26B 3OLDA 1FZMA 4RQQA 5DEJA 5BO1H 1KTCA 1P5UC 1R5IB 4FULA 3BSZL 1JN6B 4Y1AD 5EZJA 1K9TA 1S5IL 2A9AA 2VR4A 2KHAA 4RGOH 2O5XH 3HG5A 4YHMH 4ES9A 1QNZL 1CU4L 2IH3B 3IJEB 5GZOC 1EAPA 5FW8A 1L9TA 1RZIB 1AIFA 1R5IA 1XB3A 3FC8A 3G5YB 4HD9A 2J73A 1ZTXL 4HIJA 1FV1B 4W9KC 3ZR5A 5IHZB 2HJKA 3HTLX 4DEPB 4N2BA 5IMLB 5JZ7C 2HJFA 1EHLH 1VFAB 3EAKA 5IR1A 4R96A 4A2FA 4W81A 3V6BR 4U1LA 2XCMC 1MELA 2BHZA 3UTSB 4P46D 1L7IH 3Q2CA 4MJ6B 5LXVA 3WFEL 5I19L 2FBOJ 1VFAA 2QDVA 2IH1B 1N68A 4JKWA 4ADIA 1ZHLA 2WB7A 5C07D 4JHWH 1OAZL 2Y3AA 3FU6A 3MX0B 3Q1EA 3WYRA 4AQAA 3U2SA 3ARRA 5DVMA 1XCWA 1C5CL 5DD1L 1ILSA 5E6IA 2VDOH 5EU6B 3VD1A 2WBJD 1JF6A 3SE8L 1AKJA 2M83A 1YN6B 4R0LB 1U41A 4I18C 3KWXA 3RWFB 1I9EA 3LZFL 3IJHB 3Q8BA 5KG9A 4XZUA 2ZICA 4M6MH 5KVMC 5IW1A 1Y0LA 2A99A 3FUMA 2QQLH 2VXQL 3DRTA 4EI5D 2YPVL 2JJSA 4KFMA 1RAMA 4J3OF 4N9GB 4AGNA 1IAMA 4HW6A 4J12A 2UXGA 1IE5A 2EINB 5HHVL 4FA6A 1KXQA 1KELL 2XX0A 4L37B 5CZXC 4WWPA 1ZPUA 4R4NC 3PJSB 1KPVA 1WFJA 2UWEF 4RFOH 2HLFD 4PRPB 2ATKA 4XNDA 3NIGE 4FNPA 2JKJA 5IEKA 1OSZB 1BVLA 4P2OD 4KRPD 4K3JH 3WTSA 4LDOB 2CHZA 1COBA 4Y8AA 4KH9A 3SGJC 3T0WA 2FJUB 3VO0A 4LSPL 5TF1H 4UBDD 1HVXA 3QP3A 4NHCL 1LDPH 3SKNA 1SUJA 1WJ3A 2FECI 3P02A 5KUMA 1IKFH 4QT5A 1PYWB 3HS0B 3FXIC 5C7XL 5DZ9A 1NOFA 5SWZE 1QSEE 1HDMB 1A1NA 5EU6D 4DESA 5EU5A 2P80A 4H2CA 4E9SA 1XXDC 1I8IB 4M8RA 4HJGB 3UTPE 4HULB 5FXCH 4WEUD 2CRYA 2UY7B 1K4DA 3O3EB 4Q7DA 4XB8A 5C0GA 2LTQC 3Q9QA 4R7XA 5E99L 1AC6A 4ACPA 1CTMA 4LCIL 4GKZB 4XP4H 3MLUL 4HJJL 4F57H 4X4YA 3KE0A 3KLDA 3TNNA 2V5MA 4X0KB 3TM6A 4E5XG 1OGAB 1BQLL 2CIKB 3AM8C 4Q2ZA 1PD0A 1U2YA 3ASWA 4BBWA 4JCMA 4IRJB 2GEEA 4AM0Q 3UYPB 2JCWA 3M8OL 3QZMA 2OTWB 4CU6A 2FYYA 3QRGH 1OM9A 2NMSA 3ESOA 3E7JA 4Q2ZB 4MX7A 3VD9A 3T65A 2VITB 4UB0L 4JFFE 3QQ9C 1S5HA 1AC0A 1KULA 4FQXA 4RZKA 4PGJA 2J4WL 4X4MA 4PRBB 4DP5X 1QSFD 3KD4A 3WIFA 4DP0X 3KR3H 2B4CC 1CJYA 3F83A 4NKIL 3UTOA 1C8PA 3FO1B 5IGXL 1WBZA 1Y6MR 4KX9A 4E68A 3JXAA 4D0CA 5CGMA 4ABVA 4A7GF 2LTQB 3CAFA 2NW2A 4B9YA 3S88H 2B1HL 2P26A 3OKMB 4GSXA 4MDRA 3V7AG 3C2AL 4HWBA 4WO4B 5C0RH 1W91A 2BSSB 4P8QA 2Z4TA 3BAIA 5AB2A 4J8RA 2WOBA 4C4KO 1CMOA 1NCHA 2X9WA 5EU4B 2Q3XA 1GAFL 1Z3GH 1YAIA 4M93B 4MXQD 3CLWA 4EBQL 4GFTB 4XNMA 3V6FA 3VXPA 4Z3JA 4N26A 1AGBA 4IK7A 1OTTD 3AXIA 3O4OC 5IROC 5IVXB 3I9IA 4S1RL 1YEFH 4ZX3A 1J05B 1A6AA 4XNMB 2EH7H 4S1QL 5CLWA 4IJ3C 5J06A 2EXYD 4IM8A 1WP6A 2WXQA 3MLXH 3BI9X 2QFRA 1VFOA 1N0XL 1RU9L 3VFPA 5FYJL 4UYQA 5I73C 2YXFA 5D93B 4B3VA 4Z7NF 3B9KB 3D0LA 4PV1C 3AC0A 1F3RB 2J44A 5I26A 3BDYL 3N9GH 2Y7NA 3BKJH 4QOKB 1FQ9C 2N0MA 2GJZA 3BUTA 4PAZA 1OIOA 4LASH 5GGSY 2H3XC 3FFDB 1PQZA 1D5XA 3MRJB 4DERA 2A9ML 3LDBC 3IXAB 1S7VA 3ARYA 3F00A 4HHWA 5AAWA 1H3WM 3WFDH 4RFEB 5IHWA 1ZCRA 3B7SA 3BFWA 1YY8A 2WSKA 2OZ4A 5I0DA 3VFVB 5FOBB 5I16A 1Z9SA 3PGDA 1Z7JA 3I85A 3VXMB 1CD0A 4EUPB 3CN2A 4LT7A 3OHMB 3RWGB 4N8UA 1ZV9A 1CXKA 1B4RA 4PTTB 4HZAA 2CLVB 1SDAB 4I9WD 4HIEB 4GPVA 1BZEA 3A67H 4R5XA 4X6DE 4LU5H 3DBXB 3VGDA 5FV1L 1FGNH 5HYFA 3JV4A 1CGSL 4UQ3B 4JDVB 3Q6GH 2ZX8A 4DP9X 4E9TA 1G6VK 1EJOL 4FG0A 1BLIA 1FYTE 4XRCA 5I5RA 1QLRA 1SM3H 2GIMA 3NZUA 4GG8A 5GS2D 5ANMB 5DZLA 3DGDA 4R97B 1MFVA 4PP2B 1M3IA 2EIKB 2WKOF 3N1QC 5DC0A 3ZRCC 4JHAH 5CKAA 3PY9A 1O7SA 4QY8B 1FO0H 3C60A 4HOMA 4APXB 5CILL 2CHWA 1OGAE 3IN2A 5CM1A 1G9HA 1YEGH 4XVUD 2CKBL 4XTRD 1O9WA 5LWYH 4AE0A 1P1VA 4MJ2A 2I69A 3IN0A 1FNEB 1YYLL 2UY6A 3WFHA 4RDBA 1YZZA 5AW4B 2D2OA 5H4YA 3MRQB 2FO4B 5HJ3A 4A38A 1E8ZA 4P2QA 2CO2A 3ME0A 4WEMB 2OMZA 3WHXA 3EYVA 1FNEA 4K7PX 3V4UL 3P73B 5JHDE 1ETB1 1K2DB 4AENA 5EN2B 1IC4L 3NCFB 4YXKL 3D50A 4DEWA 5C3IA 3SDCC 5JIHA 3MO1A 4EUPG 4P2AA 4F93B 2IV9A 1SVZA 1NC2A 4MB4A 3CPUA 3S4SG 2L7UA 4LHUG 5L2KE 1UXLA 3WN5A 5DHYA 1HINH 4JFDD 1JUFA 4GLRI 4GAGH 2NRDA 4HQQH 2J21A 3NCWA 4X5QA 3CPLB 1BYNA 5IIEB 1NC2B 3H7BB 3WNNA 4X80L 4FQJL 1OM3H 4OIBA 4Z3HA 3CH8A 4WTQA 2B7DT 2DTML 1WH0A 2XXCB 1EA9C 1JPSL 4JRXB 3FF7A 1BQ5A 1JOIA 5EZIH 3SN6N 3Q44A 4QLRA 1MIEL 3MREB 4DFHA 4KZEL 3RTQB 3PP3H 1CS6A 3PG2A 1IM9A 5E9DD 3CFIC 4WJ5B 3JWNG 3OWEA 3KPLB 2W60B 3TTSA 1RZKC 5L2KB 3HRZA 4JFED 4KTEH 4L1SA 4NP4H 2V3EA 4ONGH 3WNJA 3TO4D 2DQIL 3L8QA 4DVRL 3DOHA 4N20A 2AJYH 2ZUSA 4WI0A 4Y5YA 3LH2H 5A3ID 4OCYL 4ONFL 2CPUA 4MQ7B 4FP8H 4WJ5A 1DDHA 1JCVA 3EH4B 4U6HA 1FH2A 5HYQB 1HZKA 3QUYC 5JHDB 4HKBA 2OJEA 4GSUA 2GITA 1DCEA 1FDLL 1JCKA 1Z9NA 4ORZC 4MQXD 1JMZA 4PS7A 3LZRA 4X8CA 3AFLA 4PJCB 5DVLA 1F00I 3INUH 5E2WL 5GS0C 1QBLH 43CAA 5KVDL 1GGCH 1AP2B 1B9ZA 1U21A 3O6FA 1R3IL 3U83A 1NMCC 4J3OD 3ZR6A 1CDIA 4AIZB 1AGFA 5FLVA 5GGUB 1AP2A 4PWHA 4GQ9L 4UQAA 2XC8A 3EYUH 3SDDA 3N0AA 1F4XL 3N44F 4GNKB 3QQDA 4MQSB 4PWKA 2VR7A 4FG6C 4TLSA 1QTPA 1O6SB 2VDNB 1ZA3B 1DJSA 1N2RB 2DH3A 4JM2F 4P4KB 3ESUF 2YPVH 3OKKA 5LCVH 1DBJL 3OC5A 3RIKA 1BFOB 1JPEA 1NAKH 2A9MH 4XO8A 3OKNB 3SDYL 1O9ZA 2XN9D 1JAEA 4KK5D 1P7KB 2GW5A 4CJ0A 3EYQD 3O45B 5CIPA 2WVTA 3M86A 1FIGL 4RWHA 1N8OE 3GRGA 2EVJA 2BSCA 3TXAA 3FB5A 3DVNB 5E1AA 3WG7B 2IBZY 1P7KA 4ZFOB 4KRLB 4TQHA 2P5WE 5ECJE 4M7ZC 1AQDB 4A68A 3FN0L 3O4LD 3K71B 4PCTA 3ZMRA 2ZX9A 3U0PA 1RIVH 4FNTA 4DP4X 3BE1H 3NSDA 4EQ2A 4XX1G 4PSPA 1ZKAA 2XYCA 3MCG1 2WMPB 1MEXH 4M3JA 4L3FA 5HI5D 2Y69B 4F58H 3GS7A 4H8HA 3WJMB 3UZQA 2DQIH 1ZD6A 2OPCA 3EDKA 4G7YL 2NY4B 2Y06L 1OP5H 2FR4B 1EEZB 1E5CA 3GXFA 3P11L 2HUHA 4JO5A 5ACMA 4QOKE 1HQRA 3WNOA 1XVSA 2MOGA 2WTPA 5D7KE 2F5BL 1LEKA 3RWDA 2GPZA 3G9VA 4XC3L 1XIWA 2P7TB 1KTDA 3MUUA 3UTZA 3VNYA 2JCCE 3GSQB 3B83A 4QRTA 3AWGA 2APBA 4X6DF 5DS1A 5A43C 3V2AR 3CDZA 3KL3A 5F70A 3OBAA 4NQVA 1VZGA 3L4VA 1C1EL 2R56L 4GRWB 3QUZC 4PTUB 1QR4A 2E4FA