3HBQA

Structure of recombinant chicken liver sulfite oxidase mutant cys 185 ala
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
373
structure length
373
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQAAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulphite oxide
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 99
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbqA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbqA01
2BLFA 4PW3A 3HBPA 2A99A 1XDYA 2BIHA 1SOXA 3R18A 1XDQA 1OGPA 3HBGA 2CA3A 4PW9A 2BPBA 2BIIA 3HBQA 3HC2A 2A9BA 2CA4A 2XTSA 2C9XA 2A9CA 2A9DA 2A9AA 3R19A
chains in the Genus database with same CATH superfamily
4TTDC 4GRWE 4N25A 3PHOB 5DHYB 4WHYH 2Q3ZA 3SKOB 2W91A 4AV5A 3EF7A 1WFTA 4K2UL 3RTQC 3HBGA 1JG9A 4A2DA 3FTVA 4PRHB 5E4IA 3W39A 4QRPA 4AYBA 1PY4A 2F53D 5DS2A 1CF8H 4CADA 4P2QB 1FL5A 1NBCA 1CE6B 4OUOA 4PJ7A 4WFHD 3ARYA 5CP7A 3RX5A 1UXWA 2IQAA 1R5IA 2WXFA 3FB7B 3KPPA 3LIUA 3QEUB 5GGQL 4A55A 4X6EA 1PZDA 4WCYL 1JNNH 4M4PA 1PD1A 3V5HB 2CXGA 2WIIB 2N56A 2E76C 3DX8A 4YDIL 5ALBL 3WIAA 2O5YL 4YK4B 1EDYA 3OC8A 4N1EA 5C0FA 3F58L 4UILH 5ISZE 4P59H 1XCTA 2Z92B 2F08A 2VDML 1BEXA 5E6YA 5B1JC 2VSCA 2N01B 1OM3L 2BNQA 3NIFF 3GUTA 2HVKA 5HYJD 1GH7A 1ZV5A 2O6EA 4L1LA 4Q14A 1HHHB 4F8PA 4JJ5A 3PGCB 3I75B 5H37A 1AHWB 2NNRA 1JYXA 5FB8A 3HG1D 5I8CB 4XO8A 3LZPA 3ARBD 3GO1H 3A67L 5IBUG 4GRLA 3WFDH 3CVDA 1D7BA 2VM3A 4L29B 2IANA 3TWYA 3NZSA 4FQ2L 1AQKH 4OB5H 1W72L 1E50A 2RCSH 3WKPA 1QLEB 4FXTA 3RVWC 5AB1A 5B38B 2Y23A 4L05A 5GISL 4LDOB 3UIZA 4JE4B 5ELIA 3SE3A 4GQQA 3OHXA 1E2ZA 3LHPL 1YNKL 1XGYL 3MODH 4G71B 1LO0L 2XN2A 2XKNA 2VUYA 3AFLA 1KCVL 3ZL4L 3SDDB 1F00I 4OUUA 4L37B 2H32A 5GGRB 1P4BL 3FHEA 4XMLH 4P2OA 5DYOA 2O5NA 4PJDA 2OI9B 5DHXB 4PJEE 4UUJB 4D9LH 2E9WA 1V7ML 5GS1A 2B0SH 2P5PA 4P9HL 2HMID 3WKNA 4JJOA 1XGQB 5C3LD 2GJZB 3DSFL 3O6KH 4ELDA 2ENJA 4PRDA 4FQLH 3EJTA 4PWGA 1IX2A 1TYRA 3ARBC 1PZUB 4H44C 1NFAA 1SNRA 2AABL 4P5TD 3VM7A 3WFBH 4TOYH 3FQXB 1ILSA 4L4TB 3EO9H 1N9PA 3HNTH 2IFFL 5F7WC 3HE7A 1WLHA 4YSPA 2GTQA 3A6BH 1OCWH 3CFKB 4WHYG 1KXTB 2AKRB 4ZMTA 2P4AB 3MCYA 5C07D 5ABDE 1GJIA 4WGKA 4Z7UF 1MH5A 4Z0XB 4MD5A 1QSFA 2PP9A 1WD8A 2ICEC 3L3IA 5I73C 4WEMB 5EH1A 3KEHA 1OGSA 5D7JA 1WJ3A 1XF4A 2LOEA 1VGEH 2WNWA 3SDCB 3IF1B 3VXUE 1HQ4A 3TGXA 2OR9L 1U0QA 2FWLB 4QHNA 5ADPL 3NG5A 5ILTH 1MW1A 2DBLL 4IGBD 3ARGB 3ETTA 4Y0GA 1X4YA 5AVUB 4Y1AA 4XTRD 3C5ZB 4ZFZA 4G80A 2V9UA 1QASA 4QRSA 4FJ6A 4XAKE 2J57A 3RIAF 4TUOA 4JG0H 4XRCB 2HAZA 2WJ5A 3X2QB 4G5AA 1Q94B 4KDWA 3BZ4B 1JWUA 2JCCA 2VLJD 1BZOA 1AO7E 5D8JL 3WY2A 1FH5L 2QGBA 3BT2L 4K4KA 3QHFH 1E28A 3HN5A 3TBYA 3QYCA 3ZKND 1Q0XL 3HPJB 3NSJA 2FIRT 5JOPD 4F7TA 4LVOC 3GMQB 4GUPB 3R7RA 5JXED 1F3JA 5E6SB 1CGXA 2O93L 5I19L 5SWSE 2Z65C 1GMEA 3OKYA 4EDWH 4RRPG 4FLOA 4FADA 4IGBC 1RK1B 5HHQB 1HKLH 5HYSB 2YD1A 4J2QA 4PRID 3VGBA 1QFPA 3GLDA 4PJFF 1WAEA 3NAAL 4M43L 1A0QH 4LPUA 3SPVB 2NY3D 1VFOA 4LMQI 3FQTA 2WKOF 5DC4B 1NCNA 5T5FH 3C9NB 5D93C 5EEZA 1N5YH 2X9ZA 4PV1C 1QQDA 5DS8A 2ZPKL 5I1DB 3TO4B 1FO0A 5F44A 2ZXWB 3ZKNC 5FO2A 1U33A 3FU9A 3C60B 3N9GH 1KEGL 3P9MB 4QXTA 1UD4A 4XVSL 4HU2A 4MMZB 5JXEC 1XDQA 1M71B 2CALA 2ZCLL 3LH2L 1CJYA 2XA8L 4JMXA 1MJJB 4GUOA 1TPXC 1DEEA 3BW9B 4WSKA 5DJ0A 5HPMB 3R8QA 3V2AR 4G3YL 1ZA6A 4IHBA 1JV5B 3OVUB 3VMPA 2VDMB 1GTNA 1XGTA 3DJSA 4OZ4A 5C09B 3VD3A 2OLDA 4YS4A 7PAZA 1U8KB 2YPVH 1NIEA 2LAAA 4H8VA 4MB4A 1IAIH 4M4RA 1AS7A 1I4FB 1IGYA 3PWNA 2Z7YA 1KT2B 5T3XD 1WT5C 3MTXA 2FHBA 2XDHA 1QEXA 5FFLA 5KVMC 4HIEB 1QBMH 1OO2A 4AEHH 5AENA 5HYIA 4HBCH 3BGMB 1NC4B 1RUQH 1YEGH 1RJZB 4IBWA 2G9HB 1JAEA 3P0YL 4QUOA 3MRPA 5D55A 5BS0E 2DQCL 3OGCB 4FQ1H 4BZ2A 3NA9H 1G7JB 3W3BA 3V6FB 5J11C 3VXNB 2DWEA 1E27B 3NESA 3TA3A 3QUKB 1MQ8A 3VGDA 3P4LA 3LRLA 1ADQA 2AQSA 3LRGA 1VCAA 2XHNA 3KNBA 2FR4B 3ZDWA 1RK0A 1KBWA 3DTXB 5AFAA 3NUKA 3DO7A 1T7YA 3L95B 4L4VA 1AACA 5FK9B 4GW1B 2J5LC 2VJXA 1OP3K 2J8UE 3KYOA 4XP9H 4H8PA 3MRJA 1UQSB 2E7BA 2B4CC 4BE5A 4NQQA 4NKMB 3P4NB 2R2EA 4OM0L 2L7QA 2P46B 5E2UL 1HHGA 1U21A 3K4DA 3ULVC 2AVFA 3ZDXF 1NH6A 2BSED 3MNZA 5B21A 3MRFA 3D39E 2E8YA 2J6WA 3UC0L 2K7QA 3O6MH 4H0IA 3U7AA 3CGTA 5DJCA 1ZHKB 4BSWB 4J2XA 3RU8L 3C6EA 2IDQA 4N85A 3NPZB 5FM4A 4JQXA 2R1XA 5CUSH 1ZGLA 1R3JA 3VD1A 3T6QC 2XPGA 2QDVA 4AL8C 1KMGA 2I07B 3WUWB 2Z1KA 1D5MA 3B2MA 1YEIL 3AM8C 5IW6B 3KLDA 2CJSA 3DX9A 1WS8A 5CMAB 3WXWH 1RUML 1H8NA 2X28A 4BXSV 1HL5A 2X41A 2XIBA 4FQCH 5JA9A 3QUXA 5HY9A 3CFMA 4NZTL 2PN5A 5GRUL 2W9EH 3TBCA 4NQED 4Y2OA 3UTQA 1OWWA 4JFFD 4MAYB 2YFNA 3MJ9H 4LVNB 1ZPUA 1ZY9A 3DHUA 1NL0L 1QABA 3IJHA 2IBGA 2A9NL 5FYLL 3L48A 3MCKB 4XXWA 4JFTA 3IJSA 3QFJE 2B4CH 2MQGA 1DVZA 3G5XB 4ZPVA 3WFHA 4FZEH 4GMTL 1WZAA 4Z3JA 3FB8A 3HAEG 5CEZE 3GSNA 4FFZL 1LEGB 2CRMA 2D4FA 4PLJC 1S9XB 2V2WB 4QPEA 5CILH 4AYFA 1NCAL 5KS9F 2OL3H 3ULVH 2IF7A 4LOVA 3C12A 3AITA 3WHXB 5TD4A 1BZ9B 3B6SB 1HJCA 1PZSA 3L9RB 3P69A 1EHKB 4XNXH 2HT3D 3GHBH 4OQTH 4XOEA 5CN1A 3TOPA 4Z7VE 1MCKA 2DJUA 3EDDA 4NWTL 1YN6A 2YKLL 1ND0B 5C0CB 4U4BA 2EQDA 4H88L 3HG5A 3L1OH 3MO1B 3NFSH 5ESVB 4F58H 1ONQB 4ZMNA 3EJZD 2FEDC 4RWYL 3QEGL 5MENA 4AL8H 2CM6A 4PJ5A 4HKBA 4Y5XA 4NJAH 4JAMB 5ESAB 5L2KE 2AHIA 5KZCB 4IRZA 1FNHA 5DRXB 3CQQA 2OXHA 2CO7B 3QCVH 3VXQA 1MCPH 1FZMB 4F37F 1MI5A 3LXAA 5D5MF 3WO4C 3X13A 3FW6A 4ZFGL 3I74A 3WOVA 1BD2B 3CXDL 3T1FA 2M8XA 5F1OB 4HXBH 5DT1H 1EZLA 2EC8A 1K4CB 1F13A 4P5SA 1HNYA 4H25A 1I7RB 1I7TB 3VXME 2NXZD 3A24A 4AENA 1NCGA 3GTNA 1SOXA 4I3RL 2EXWC 2P7TA 3P73A 4F7EA 3GINA 5J4MA 2HG0A 2YD6A 1ZT4A 4LDCA 2X4UB 4OGYL 1N26A 4G6KH 5EIIA 4YGAB 3V6ZA 3EJZC 4NUMA 3K46A 5GJTL 3QDMB 1D2OA 4AW4A 3QO0A 1FZJA 3PHQA 5AZEH 4WW2F 4OBSA 1JXGA 1NMCC 5FA3A 4JQVC 3E6HB 1J18A 2X4RA 2X87A 2M83A 3BIBX 4Q6YA 4GG8B 2BRRL 4TTGA 2NZ1A 4RIRA 1TTCA 1BX2B 3PP4H 4GW4A 3H3BC 1EJFA 4CN1A 5GS0D 1AVAA 1FPTH 5KBNC 1VSCA 4WK4B 1XHHA 3BZFB 3JUZA 1UTDA 2XXGA 3BDYL 4HGWA 1AXIB 1VIWA 5EOTB 3LHAA 1PAZA 3RUGF 4BM7A 3MRBA 1F1GA 2OXGB 2BSSA 3QYMA 4HP5A 4NM4L 4V33A 4X7SL 4JG9A 4F57H 5J12C 3MU3A 3H4HA 3GBDA 5JR1L 3ZE1E 1CD1B 1KB5A 5EU6A 4MZRA 3IJ7A 3DA0A 4HUWA 2EINB 5E8OA 4H1LG 4IHOB 4UZUA 1ZLUK 3TVMA 4NQDA 3G04B 4DETA 4EIGB 5T1KD 3C6SA 4KQ0A 1NCHA 1B3IA 3UTZA 2DYRB 4R5TA 2EDOA 4JLRA 2YPLE 3OMNB 2WAHA 1AD0B 3GI8L 1DFBL 5KBMA 1CVSC 1IEAA 3FUMA 3FRPG 1I8LA 4MTMA 5AWNL 4LHUG 1AR1B 3HZVB 4WHTB 2IQ9H 3BE1L 5D2NB 2EE6A 3OWRA 4HIXH 5TTRA 5HHOA 4L0ZA 4LSVL 1OCOB 4QHMB 5B39A 2CR3A 3T0EA 4Y4KD 1O75A 5GS0C 4ZBJA 4MD4B 3EOTH 3CFEB 2BVOA 3D3VE 5LAPA 1FGNL 3DURA 1FUNA 1DBJH 2KL6A 2OSLA 1DBKH 2AK1H 1X9UA 4C56E 4HKXA 5I6MA 3FFCB 3SGJC 1J8HA 3MOAL 1NUNB 1CCZA 1IUZA 5KTEH 1KBPA 4HJTA 3VFNA 3T3MF 4L9LA 4RAUA 4R4FL 4JFDA 3DIVA 4WRLA 2R29H 5AW3B 4YSOA 4JDEA 2VLRE 3MLZH 4LSDA 2VKWA 4GRWH 2XWZA 4ZDHA 4TUJA 2VR8A 3C2AL 2ZUQB 3F7RA 2NY5L 5HTSA 4ZG1A 2PYEA 1AFVH 3SCMA 1I7UB 3FOMA 3MUJA 3V0FA 5GRWA 2IV9A 3MV7B 3EH1A 4YE0A 1JNLL 3IFOB 4YDVA 2AV1B 3EOBB 4K7FB 1XAKA 3CC5A 3IFNL 4FXLA 2EVHA 4HEMA 3AREB 4HFUL 3KJ4B 5DURB 2X4PB 1T6VN 1BVLB 3PG2A 3CFIC 3QK0A 4EI5B 3PWLB 4JG1H 2X6BA 4PGBA 3PP3H 3ZT7A 3VXUD 1V55B 2LFEA 4HS3B 1HNFA 2CCWA 4AWJC 1QTYT 4FHKA 5E1AA 4P3DA 2Q8AH 2A73B 1FWXA 3IMBA 5GS0H 1KULA 3X11B 4NN6C 3NJXA 2E46A 4X80H 4XZUB 4XAKD 4Q9RH 3WMQA 1L9TA 1JGVH 3OKDB 5DJDA 1U41A 4JHWL 5I16B 3F5WB 4M7KL 1HNGA 4JDZB 2EECA 2WW8A 3V55A 4QRBA 3CMOL 1LJMA 1PEZA 1P7BA 1NFKA 2W0PA 1AO7D 1GZQB 5EN2A 5CGBA 4FTDA 4NQVB 4PRBB 2AJZA 3RGVB 3GXFA 4KQ4H 2O6DA 2VDLB 2YBRB 1JERA 4MCZA 3EJJX 4XMKH 5C0NC 4HA1A 1LO2L 2H3XC 2HRPH 5KVFE 3KWWB 3UTSB 5MEQA 2H6PA 3TP4A 3VI4F 3D05A 3GB7B 4W9IC 1BGXL 1DLFH 1KJ2A 4I0PA 3ERXA 1E7VA 2HLFD 2KDYA 3FN0H 3FT1A 4MAUH 4UIKL 5JHLA 3SZ6A 5F1KC 5AVSB 1VFAB 2F0CA 3K4ZA 2QFRA 4J4PC 5D9SB 4NIYE 3QJFB 1JWMA 1NCWH 2F19H 3DPBA 3H1ZA 5EZPA 3TBWA 5LGJA 3Q3GB 2HT2C 3QXTA 5I0VA 5IB1A 2TAAA 5CINL 1OSZA 2JLPA 3REVA 3JZYA 1TJMA 1TENA 4N8PA 2K9UA 2HN7A 3LS5L 4XP6H 5K9QG 1IFHH 3HG3A 5F9OH 3W39B 4QRPB 1KYUA 2WZ0A 5D6DA 4XOBA 2H7WA 1F1AA 4FG2A 1OE2A 2R2HA 5C8JA 3GRWH 4CADB 1FL5B 2GEQA 4JDVA 5ANME 1XR9A 4RETB 3WNKA 2FT7A 4MJJA 5D4JA 5CP7B 4NZUL 1KCSL 1UXWB 1R5IB 2IQAB 4YEFA 2WXKA 5GXBB 1CDYA 4X6EB 2DW5A 1RIVH 4L1SA 2WLZA 3BKJH 4WWKA 2YS4A 5IVXF 3MV9B 1NFIA 3FT4A 2HLFC 5C0FB 4M3HA 2J1YA 3HHMA 5TDOB 4CDHA 3EOAA 2IOIA 5FM8A 5HJDA 1XGUA 1MAMH 4TL4A 4XX5A 1X9QA 4PJ8A 4XZ4A 5IQNA 2WLJA 1RPUA 1JRHH 3GUTB 3OF6A 1L9OA 2OMNA 3ZMEA 3CH1A 4F2EA 1EAQA 4N2FA 4FQHA 3VA2C 1S9YA 1MPAH 4UT7L 2MPAL 3NFNA 3RPIA 4JJ5B 1JZGA 2ZX7A 3RL2B 3VXRB 4PTUA 1AKJA 5FB8B 2GK2A 3IBOA 1A8JH 4QJ4B 5CCKL 2ZP9A 3OJDA 4BFEA 2DBJA 1MFBH 2NXYD 2AQ2A 2DYPB 5E5MB 3WLWD 5TGBA 4LCIL 3V0IA 5TE4H 4KKQA 4PBVC 1BMGA 4EPSA 1QFUL 2R2BA 2WP3T 3FC8A 2H8PB 1FRGH 1QBLL 3OHXB 4BYHA 5CF3A 3IK2A 2B59A 4DN3L 2EDWA 3L45A 3SO5A 5CEXB 4XMTA 4OUUB 3TWCH 2H32B 5GHWL 1GC1C 2QVMA 5FYKD 1C5CH 2V3EA 4P2OB 1AY1L 4PJDB 5DYOB 1SDAB 3NGBC 2XV2A 5TE7L 5DVLA 5GS1B 3GM0A 1E4XL 2E7MA 1OLLA 4QHLA 4A66A 2PO6B 3MRQB 1BQHA 5HGAA 4NKIH 5AKTA 5LXGH 3QRFM 1DR9A 3D39D 3QB7C 1CR9L 1FGVL 3OAYH 4NLAA 4OCYL 3FTXA 4KJPD 1IL1B 4OVVA 3GTTA 2CO1A 3MTRA 4K3JH 4EBQH 5C6TL 2DAVA 1QFWH 5ECGA 2VQ4A 3UAFA 4DO4A 4F9PA 3WLWC 3EDFA 2EDDA 2PCPA 3GSQA 2WO3B 3HE7B 1L7IL 1IBBA 5CKGA 3CSPA 5LBVA 3FUJA 1KBGL 2JJSA 3K8MA 4HWZB 4PJIA 1PMYA 2Q9OA 4ODTL 5LHDA 2BS9A 3LRMA 1A6WH 1PG7H 3L5WA 4G8GB 5J1AA 3VRJA 4Z5RA 3CSGA 2J25A 5A3ID 4RQQA 4MD5B 2FWSA 3BJ91 1CUOA 1QSFB 4HZ1A 5DUPL 1AZZC 2QL1A 1F4XL 3WHE0 3QNFA 2CK0L 3NZHH 1U8MA 1MCEA 2W38A 1S5IL 5DWUH 1R3KA 1S8DB 4ENED 3GSOB 3NACL 4I1PA 2PR9A 5K9OA 3UPRA 5IREA 4JM2A 2ODIA 2AEWA 1AIZA 1X9RA 2FECI 2HT4D 2BDNH 3KPSB 4OD3L 4OZFA 4QHNB 3SBWA 3UJIL 1HEZA 3UBFA 5BZDA 4NOBA 4ZS7H 1GC1H 2ORBL 4IK6A 4U3HA 1JGDB 1G0XA 2ATAA 4Y1AB 4L8CA 3QFJD 3IJ8A 4G6ML 2YAOA 5F6IB 4JO2H 2QHRH 1IGIH 1S5HA 4TUOB 4E42A 1YPZB 3JVFC 1A1NA 3C87A 4QRUB 5B7FA 4PJBE 2NDFA 4IRJD 1JWUB 2JCCB 1S2EA 3ML9A 3STLA 1I1AA 3QI9D 1T2QH 5E99H 1URIA 5TE6L 5A3IC 1EZVY 4YQXL 2VQTA 5AUMA 4Z9KB 1E28B 3P02A 4KHXL 2DLHA 3ULSB 1J12A 2ADGA 3GKWH 5AW9B 1T1YA 3SE8H 3VAEA 4F7TB 2HLEB 3IEAA 2AJYH 3AT9A 1NC2D 3SE9L 1WBXA 1JWSA 2M2DA 1CGSL 1F3JB 5AW7B 1LK2A 3MBWA 4ENEC 2DEWX 2W95A 3M1OA 4Q9BA 3MJ7A 1B2YA 2D7MA 3ESUF 5L7XL 1GSMA 5BUPA 1MFUA 1LXMA 2JIXD 2WJ7A 4NHCH 5D96C 5DRNA 5C09E 4UM9A 1HXYA 2D7PA 4JUTA 2HT4C 1T0MA 1LM8V 5C0RH 4J3XA 3CBRA 4F93B 1P1ZB 3FFDB 5I1AA 3R06A 5FYKH 1CN4A 4IRZL 1A4AA 2VW6A 2WKOA 2YQ2A 1XH3B 4DP7X 3TN0D 4LEXL 2CGRH 4JFPA 3BYTA 5JW4M 4X8JA 3VFGH 3WKMH 2UVEA 3FQTB 4OM1H 1NLBH 1TFHA 3RY5A 1VZIA 3QZBA 3V8OA 4BZ1H 2IH8A 3IRCA 3VXMD 1NGPL 3QI9C 5HGDB 1G7LB 3CZKA 1V7NH 1QQDB 3NSCA 9PCYA 4LZKA 1XMEB 5FO7B 1M4KA 2G0LA 2PTVA 3T04D 3U46B 1R34A 1BXUA 2JI1A 2ZZUT 2X05A 4K5MA 3RNQA 5EHFA 2QKIA 3MUZ1 4JR9L 4NNPL 3JYCA 4NGHH 5BOPA 5IUCA 4Z7WE 4UNIA 3OSVA 5DD3H 5EZIH 2YAEA 5DJ0B 5A2JH 1KTCA 3APMA 2EEFA 2A1WH 3ML8A 4YHYC 1FNLA 3EJPA 4LAQH 1GMIA 1OAZH 1XGPA 1XGTB 2C3HA 2KZBA 3IYLW 4L1HA 4OZ4B 3V9CA 4DWHA 5BW7A 1TR7A 4MA7L 4NPYA 1GS6X 4M4RB 2VN7A 1PTZA 3BDBA 3I9GH 1IGYB 2FSEA 2ZKHH 4KX9A 4DP5X 3T09A 2JTDA 4DZ8B 3QCTL 2W8CA 3JVGA 4LCYB 3D6GA 1T6WA 1K6QL 4V1DD 4ZXBA 3A22A 4TLSA 1X5AA 1XD0A 3RWHB 5GGUA 1RIUL 2I7SA 2IBZY 4MDJA 1Z32X 3EF4A 2BHFA 2NY1B 1ZIBA 4XXDB 1B0WA 3TA3B 1U2HA 4P46D 1AE6H 1I53A 1JZFA 3L1GA 5BZWB 1N6QH 3KLAA 2KH2B 4OZIB 1AI1L 5B3SB 4ONFL 1ZA3B 4DT2A 4M1GL 1SN0A 5INDA 5DMKA 1NA8A 1PY9A 1ZLEA 4HQQL 4L4VB 2JKNA 2DH3A 3SGKA 2YPLD 2FJSA 3KYOB 4TVSa 1PSKH 4K8RL 2ARJA 3AQXA 2DQUL 4PWJA 4MB3A 2XXCB 4TV3A 4KVNH 2R2EB 2WBXA 1DVFA 3ALWA 1Q0EA 1PZ5A 4EUPA 2P47B 3RRQA 3VXSA 1M1SA 2W59A 1TQBB 2G3NA 3C08H 4FYQA 4K9EC 4KK5D 5EUOF 2H1LM 2LV4A 1NGQL 4IYKA 2F1EA 4MMXC 3FQ4A 1KJVB 3MRFB 3RHWF 1D6VL 2EVGA 1NCCL 4JB9H 4L9DA 3HPLA 4OZGF 1QFHA 3MGOA 4BJLA 1C5BL 1BCIA 4FL4C 4OLYL 1T03H 2Y7NA 5DD1H 1QR1B 2DTML 5DMIH 1UCTA 2OPCA 4MNHB 1N0XL 2CMRL 4R96B 5IHUH 3MGTA 4BGLA 1ZXKA 1ZGLB 1TETL 4HEPA 3V4VL 1R3JB 2ZUXA 5HHPA 5IIEB 2K1MA 4P46C 1W91A 5D7EA 4UTAH 2P26A 4HC1H 4MJIE 1J5OL 3HRPA 3F05A 4LVHB 1YQVL 4OCRL 5C08A 1NBQA 1GYUA 3S37L 1P4IH 5C0CE 2QKSA 4PS8A 3TS8A 3L81A 3VH8G 1JGUH 5F7EH 3DX9B 2XXFA 3MA9L 1QBAA 3UADA 5MP6L 1PIFA 1CYXA 3OAZK 3SDXF 4DGWC 3MRIB 3MPCA 1KLUA 3QUXB 4P8QA 1MVYA 5HY9B 1U8JB 2GC7C 2CDGB 4RMSA 4JHUA 2NZ9D 2JELL 2FBJH 4KK5C 3Q7JA 1G7PA 1MHCA 1H9DA 3VTTA 4Y2OB 3UTQB 4PJCF 4HJEA 4WFEE 5LAXB 3F00A 4WFGD 1OW0C 3MRHA 5H8DA 4CC4C 3ARFC 1J7VR 3IJHB 1GGCH 4XPGH 1VPOL 3LS4L 1H3XA 2D2CC 3QULA 3IJSB 5KYUB 1H6FA 1YY8B 2MQCA 3EH2A 5IQMA 5T1JA 3FB8B 5HYQA 3BUTA 3GSNB 2BMKB 3AROA 3GZQA 4QOKA 1N7ML 4AYFB 2FDBP 3NBNA 4HWEL 5CHNA 1PX3A 2E9BA 4K9EH 4JZJA 4FXGC 4ABWA 2W9DH 4AITA 3QIBB 3IXAB 1HWWA 1E40A 3MRKA 2ADJA 4GQ9L 1DJXA 4N8VG 5AB2A 1MFDH 1TZGL 4PRHD 2HFGL 1RHHA 1YN6B 2ZUSA 5TK2A 1E65A 3OXRB 4P2QD 4RX4D 4JO8A 2GEEA 5DO8A 1T66D 2NQDA 3EDKA 3QDME 4M8VA 5LNEA 2X89A 3GKZA 3LPFA 2NZ9C 6PCYA 4NEHB 4OF7A 5CSBA 4NBZB 4XBGA 3BPCA 3CBJB 1URZA 3Q48A 3LEXA 4UM8B 4PJ5B 1JE6A 1T21A 4BHUA 3LKPA 4HKBB 4Y5XB 3NJGA 2FEEI 5IKCA 2K6ZA 1AOZA 4DK5A 1BVZA 3QAZB 3B7TA 1VDGA 2OXHB 3MQIA 1EEZA 2ZONA 4Q4IA 3D9AH 3GJEB 4OZHE 3X13B 1B9KA 3R1GH 4AQ1C 3RDJA 4LCWA 5E9DE 4KKCD 1J8RA 3TBSA 3VFSA 2Y2WA 3ZHFA 3T1FB 1H5BA 1BZDA 2NNFA 1MRFL 2F54A 3PHAA 1UM4L 4PUBL 4H4NA 2YAMA 2ZX6A 2FLBT 3QBTB 4H25B 1ET8A 4TLUA 4LQFH 1P5UA 3WJJC 2C5DC 2KPNA 2LVCA 4AENB 4BDVB 5HI5D 1OALA 2ZCKL 1FDLH 5F7HA 2VITB 2R15A 2CKBL 3ZYIA 3ISWA 3KH4A 4HOMA 4ETYA 3P73B 4BBWA 4F7EB 3MYJA 1ES0B 2FZ3B 5ENWA 1A6TA 4LRIC 4N2IA 1ECYA 4XNZB 5DLML 1ZT4B 2A9CA 4UT9H 1H6TA 3SHSA 1T66C 3EYVA 4DZ8A 3CZFA 5EIIB 4S1DD 4WW2A 3V6ZB 1MELA 3GPSA 4O2FA 1N6VA 2XZCH 3BI9X 4Y1SA 3PHQB 2VR9A 4YK4C 4NYLA 2BNRA 5BVJA 5D2NE 1VZHA 5FA3B 3NTCH 3QXDA 1UJTA 3SDDD 2LTQC 4LRNH 4TLTA 1SM3L 3IGLA 2L7UA 3CZNA 3F65A 4JFEB 5MEPA 2CJTA 1N70A 3A23A 4GW4B 4D0DB 1K2DB 3OR6A 4IRSC 3HNSL 3LAFA 1Y6KR 4RISL 2ZWLT 1AGBA 2Q2EB 3US1A 1WHOA 4M93C 1YEDA 5E8NB 2WC7A 5GGTH 1BQRA 4ILDA 1QKZL 3BJLA 1RZ7L 1VADA 3FFCE 3FHQA 2EH7H 2A6JA 1AHWC 1IBHA 1MNUL 2HFEA 2DQTL 4XHJD 2MTPA 3MRBB 2EE3A 3HIZA 4TQ8A 4PG2A 4H5SA 2BSSB 4AJ0A 1PW3A 3NRPA 1GS7A 2Z8SA 4KOCA 1IGMH 2VDKH 1YLBB 4L4TD 4PRNB 1PQZA 4YDJA 4IOIA 1IQWL 1ETJA 1SBSH 4HLZH 5EU6B 4HUWB 4TQIA 4HAFA 5E8OB 3TVMB 1RUAH 4OF8A 4NQDB 3C6SB 3DECA 5HHXL 3UTZB 5I8EA 3N43B 4PD4K 3JT2A 3KAAA 5G4MA 2BM3A 3G5ZA 1IEAB 3WNIA 4GJTB 2NX5B 3F6JA 3MV7E 1FCGA 4FFYA 1NUFA 4MLSA 1K5WA 3K8KA 1H0DA 2DN7A 2Y07L 3MLXH 4KJYA 2LLGA 5D1ZB 5HHOB 2OI9C 5FWRA 5B39B 2ZCHH 1TVDA 1UA3A 3SDCD 2WYHA 2YC1B 2BVOB 5KVFH 4YGVA 4XVTL 1QWNA 3DURB 5DZPA 2VABB 2OSLB 2H26A 3D2UA 3O4LB 4XHJC 1RLWA 5C86A 4HKXB 5CLTA 3ARGD 1J8HB 1XD1A 4RAUB 3MLPA 3C5ZD 4CVXA 1PLGH 4YSEA 1N59B 2DLFH 4XMZA 2ICWI 3AU0A 4TVPE 5IW1A 4ZDHB 4TUJB 3H42L 3HJEA 3T8XB 5HGBA 2GITA 4XODA 5K1NA 1IGCL 2OZ4H 5MHSE 4GO9A 3ZQWA 4DOHB 2P49B 2PYEB 4BFOA 4JDTL 4YR6A 3FOMB 3VCLA 4KH9A 4A2GA 3CFUA 4ZPTA 3UTSE 5E6IA 4YDVB 2EABA 5L88H 3HMXL 1DVUA 1GTFA 1ODAA 1QLEH 4FOMA 4GRWF 3SDCC 3CG8A 1BQSA 3TT1H 2OW6A 3PL6B 3L13A 3ULUE 1YEFH 3DARA 4LSSH 4NZRH 5AKRA 1CI5A 4QCIA 4PGBB 1MF2H 1MW3A 2XNAA 5LNDA 4LLDB 4QT5A 3D34A 3T4AA 2FVNA 1CURA 3ARGC 4Q97A 4XR8C 2WB1A 4AGLA 5LCVH 3MUY1 5DDHB 5F89A 4AGMA 4A38A 4L0YA 3WFCH 2O30A 4BKSC 2FJGB 4AE1A 3KBFA 1DVSA 1YDPA 4AVHA 3E8VA 5TK4A 1WPCA 3CHRA 3HHSA 4KRPB 4FNQA 4QRPE 2HTKD 2EKSB 1YEEH 4O58H 1ZEAL 4W9ZA 4XN9A 4RESB 3TO4D 2N4IA 1W9XA 1UACH 3L5XH 4KKBD 4LEOA 4PJ7E 3RWJA 2WUCH 3C60D 4GKSA 1R33A 4AQEA 1A4JA 1UM5H 3LZQA 4M3JA 3AY4C 1WS7A 2VZSA 4JUSA 1QRNA 1U30A 2R1YA 3DUUA 1N8ZA 5MEQB 5C71A 1QYGL 3U7WL 2CPUA 2N0MA 5AVQB 4PWHA 4MQ7A 1AGEB 4AM0A 1T2XA 4GFXA 4XP4L 1MEXH 4RFOL 3GK8H 1UB5A 1JZ3A 5C09D 2IIJA 5DR5L 4EVNB 1DBML 4BV1A 4XHQA 4HK3N 1IFRA 2BNQE 1RULH 3E0GA 5B1BB 4XPTH 1NWOA 1JWMB 3NH7H 4CVZA 1I3UA 1OHZA 4XCFL 4QLWA 1KC5H 4UOW0 1JPSL 1RZ8A 4P23A 5IB1B 1OSZB 4ZSOA 2CKBB 3REVB 4KNUA 4FMFA 2R0ZL 2QQNL 5DUBA 1NC4D 2HTKC 3FQYA 4RBPK 4UDUA 3GUFA 5CIPA 5HDBB 5K1JA 2HN7B 3I6SA 1NWPA 4G82A 3O3AA 4KKBC 3KJ6H 2IANE 4QDGA 5K39B 4AVKA 2R2HB 2X7LB 2GKIA 3TH2T 3JWNE 4PS4H 1XR9B 1EAPB 4MMZC 4PJEF 1MJ8H 3QVAA 1SQ2N 4JQIH 2AGJH 4WI3A 4FQIL 2EIMB 5IVXA 3IMVA 3FTUA 4WWKB 5CD3A 4Z77B 1ZT7B 4A2HA 4E41A 3HRZA 4M6OH 2X6CA 2I60H 3EBHA 1NFIB 2AJ3A 3O4OB 3FT4B 4IBQA 5CCHE 4DF9A 4DK3A 3K6SB 1TEYA 1SJEB 4PJDE 5KYXA 3EOAB 3RA7H 1OE1A 5GGSY 1FYTA 1XGUB 2EDXA 4U6VL 5KJRH 4PJ8B 5B3NA 1KDJA 4KK6C 2JV6A 3QZWB 3UZEC 3CH1B 3EFDL 5B38G 3VXTA 2D7QA 4FQHB 1FLTX 5DEGB 1S9YB 5D7KD 3NFNB 3RPIB 2E0PA 1T83A 5DCCA 4PTUB 1AKJB 1CYWA 4Z7IA 3EADA 1FZOA 3CFNA 3WAKA 5BV7L 1U2YA 3BEWA 2FYVA 2C9QA 3GHPA 1MVFA 4K94C 3QUYA 4GI9A 3NRFA 6TAAA 1S7QA 2G5UA 4K5LA 4NWUL 5TGBB 5A7BA 2AVGA 1RFDL 3C2SA 2R2BB 5T1MA 1A7QL 1EWHA 2PCYA 2Q1EA 3VI3A 1DVQA 1ZLWH 5E6RB 1QSFE 2OV0A 1EZUA 2B59B 3IKCA 1ZDQA 1GL4B 2GPZA 3FAXA 1PVHA 4WCYH 2NW3A 3GMLA 2OCJA 4OIAA 4R5VA 5DZLA 2XV3A 4YDIH 5ALBH 2YOAA 2DKSA 2ZIDA 1VA9A 3KPLA 4QXGH 3TBVB 3EJYC 4RRPA 3S96A 4F7CA 1QSEA 3B8SA 1RZJC 4PTTA 3F58H 3GBEA 3EJRA 2BY3A 4MAYD 4QRQA 5TH2B 2COQA 3QRBA 4QHLB 3OZKA 2C9RA 3FO1A 4DKEH 3D0LB 3IMWA 5HGAB 2VDMH 4CBZA 3OAUH 4Y1AE 3SEPA 3AT0A 3H3PH 3JV5A 4LLYA 2OMUA 1PG7X 1ADWA 2QTVA 3IKKA 2Y7SA 2ZAIA 4YHIB 4HSAC 1Q1JL 1A65A 3KPOA 4PSPA 3LVEA 1ZCRA 4EXKA 5JIPA 4XPAL 4IIZA 1CD8A 2JCCE 2AJUH 1WWAX 2CJ3A 4NKQB 5I6PA 3BAWA 1NFDF 2E86A 1EPFA 1LP9F 4PJIB 1W0WB 1IFGA 3A67H 1JTPA 1NM9A 2FJHA 5J1AB 2Z3FA 4Z5RB 3TXAA 1L0QA 2JJTC 4RQQB 4YHOL 5C0CD 5EO1B 4FQ2H 4JVUA 3CHQA 3HS0A 1EO8H 3SE4A 1MIEL 2YUVA 4E68A 1U8MB 3KYNA 3O6LL 3BWSA 3PPEA 1R3KB 4A1RA 1XGYH 1E4HA 2BZDA 3DV6B 4L2YA 4CMMA 3MN8A 4NO3B 1EJOL 1KCVH 3ZL4H 3X1GA 4NQCA 2B3RA 3CSTA 5AYUH 3L3GA 2UXFA 4LVNC 5K9OB 1X5GA 4JM2B 4A39A 5KZCD 3PDOB 1MCOL 3CVBA 1UWGL 4KTDH 4XNUL 5EMYA 5JQIB 1BDYA 4L8CB 1BD2D 1ZVYA 2IPKA 4DZBA 4X5XA 5BUGA 1RZJH 1WIPA 3NPSB 2HRLA 2K8MA 2J21A 2BXYA 1BVNP 1A1NB 5CJQL 2CHDA 4TSBH 3BVXA 3O2DL 4FXKC 4R8WH 4PRPB 1YN7B 2VB5A 2YXVA 2EXSA 2F7OA 1JDDA 2AABH 2Y4SA 4JPVL 5D72H 1I1AB 2JF1A 1AP2A 1AIFA 3ZTJG 3W0WA 4Z23A 2IFFH 5AUMB 4ZMOA 5EDSA 5KW9L 3FONA 4X98B 1EJ6A 2J73A 4HZLB 5FHAH 2ADGB 4O9HL 2R27A 4PGZA 1NANH 1T1YB 1HE7A 2UZYA 1UJ3B 3QISA 2UWEB 3X3FL 4KI5E 1WBXB 1JWSB 2FWUA 1LK2B 1Z7JA 2XIDA 3QDMD 1MG2C 4JFVA 1B2WL 3MJ7B 5HD8D 1A6VL 5BO1L 5AVYB 5DRNB 4UM9B 1HXYB 1HTYA 1PNCA 1T0MB 1TJXA 5IWLA 3H7BB 2ESVB 4A04A 3L6FA 2OSXA 5I1AB 3R06B 2B3IA 5I71B 2FGZA 3RFZB 3AQZA 3QR2A 1O7SA 2OR9H 4IIQC 3BVNB 2P80D 2Q2LA 5FFOA 5ADPH 3BKML 3IN2A 3OKNA 4X8JB 1MLCA 4LQ1A 5EZLA 3A4FA 4HIJA 2WTPA 2X53A 2HLAA 1YNLL 1BZ7A 4K3GA 1A5FL 1FIGL 2X09A 4AE0A 4GAYA 4HMEA 4QYAA 3US0A 4BK4A 2WYIA 3OC5A 4MHHG 2A6DA 4X9FA 3ECQA 4H40A 5T5FA 2Y1ZA 1YA5A 7TAAA 1XSKA 3P0GB 5LG6A 3EDJA 3OQRA 1FH5H 2DQGH 4JCLA 4ZX6A 4KKAC 3BT2H 3QG7L 3P4MA 5KSUB 2GB2A 4YSCA 1IC4H 3DHJA 2OMWA 4L4VE 4HPYL 4P5TA 3UYRH 1Q0XH 4YSTA 1O6VA 1QVOA 4OQ1A 5DQ9B 4Z76A 3ZL1A 1AR1D 3INOA 3OV6A 4U1HA 4Z95H 1X5ZA 3ZBMA 2B1AL 5AOKA 1DVXA 1XGPB 2IDFA 4ONGL 3ZPDA 5C07A 4NPYB 5M7QA 5DFVD 1TLKA 4CNIB 3QJRB 3GXUB 1KFAL 2FSEB 2NNAA 1E4JA 1A14H 1BM3L 5A2IH 5A40E 4DEUA 1KYDA 1RVFL 3KW7A 3HAEA 5C97A 1A21A 5BV7B 3V0EA 1X4XA 3M7OA 4ANVA 3NAAH 3CXFA 3FFCD 5TF1H 1W8NA 3GSVA 4GBXA 2HJKA 4DGVL 1MFEL 4MDJB 4JKPL 4QGYA 2X44D 5A2BA 1GA2A 3FUEA 4S1QH 3M86A 4RDQG 3WENA 4IGBA 3V0DA 1HKFA 4NX0A 3KPMA 3KLAB 4P05A 1QR4A 4I5BB 1MOEA 5INDB 4HUVA 3D18A 3S48A 2ZJSH 5DMKB 2FIKB 4F80A 2X6AA 5C6WH 1KEGH 5BRQA 4XVSH 4O00A 4AV0A 5D2NC 1CFTA 4Q0XL 2ARJB 5TQ0L 1SY6A 3MV7D 3LH2H 2VLJA 2XA8H 5I6NA 1DVFB 1JF1A 2HWZL 3APFA 3CK0H 5GGSB 5DFVC 2ZOLA 4EUPB 3EJCA 3VXSB 7FABL 3ARED 3TEZA 3WNJA 5DURD 1YNTB 1Q72L 3WUWG 1LYQA 4EI5D 1FL6B 1M53A 3EGXA 4CU6A 2AXHA 1EXUB 1G7HA 3MUUA 5ICUA 3TONA 5LN8A 2RACA 2EYSA 3BVTA 1CK0H 4KI1A 4I89A 5IESL 1QA9A 1TVBA 4OJCA 3KWVA 1MJUL 2GJ6A 2ZXDA 5D70H 3MV01 1A66A 4L5FL 4U0QB 4TNGA 1FFOA 1JVKA 5AOIA 3WIIH 3CZUB 2V2XA 4BXVA 5KVEE 5HHPB 4PRIA 4ACTA 3MLVL 1H3PL 3ET9F 3MFFA 4F7KA 1TQSA 2KS0A 2DQCH 5C08B 3KPTA 4ZT1A 3V52H 4JPIA 4HDIB 2ZUQC 3S88H 1XFPA 3SDXA 1MLBA 5BCAA 5LVEA 2MMXA 3EAKA 1T3FA 3GM8A 2XTSA 5CJXA 2CLRB 3D8MA 4F9LC 2X40A 5F21B 5MHSD 3E1ZA 3RGVD 1QRKA 3LB6D 1KLUB 1MZZA 4YNYA 4WVRA 2OYKA 4PJ5E 2B77A 5F7NC 5SV4A 3UGUA 5KYYA 1G7PB 3UTSD 4DKFH 5HDRA 3G08A 4G6JH 2Z35A 4XN7A 4A6YL 1INDL 3GGWA 3LKQA 4PBWD 5IGXH 2NY0B 3MRHB 4OM0H 4M03A 3ELQA 1MI5E 5HHMB 3ULUD 3PJNA 2FJFB 3O3DB 4L1BA 3JTTA 3PWPA 1Z0NA 3O81A 1WBZA 3VNYA 4G42B 3N85L 4BFNA 4I48A 4FABL 4RFNB 5HYQB 3MJ9A 3FU6A 4Q89A 4QOKB 1FC1A 4JZJB 1L5GA 1N10A 2ROYA 3MUHL 4P4KA 5KSAA 2ADJB 4NM8H 3G5WA 5GSRA 3LSOA 1CI3M 5JLZA 3RU8H 1J05A 4UAHA 4E0RA 5T3ZE 3FZUC 1J1PL 2WOYA 4H1LA 4QRPD 1RHHB 2WBJA 5I2IB 5HP5A 2XJKA 1PLCA 4ZAKA 1IJNA 1GOFA 1U8HA 1MIMH 1HJBC 1KN4L 3UDWA 1EGJL 3BH8A 1V05A 1FVDA 4ZUSA 1YHPA 2AJXH 5ICXA 3GMPA 2C3WA 2L0DA 3FRPA 2JMRA 1A7PL 4FNRA 4LHUA 4M7LL 4XBGB 3Q9PA 1A3ZA 4NC0B 1G6RL 3LEXB 2QQLL 3QUHA 4OW6A 1YAZA 2AEIT 2R7EA 3WIHL 5ITFA 3MV9D 5A6IA 3LKPB 3B7RL 2MFNA 5IKCB 3ULUC 4I18A 4TVUA 2H1PL 1C8PA 1EEZB 4MNQA 4MQSB 2Y2TA 3WTVA 3FT3A 2ERJC 5EU5A 4LCWB 1X5IA 3ZE1F 3TBSB 3UCQA 2ZKXA 3AAZA 4BE6A 2F54B 3CCHA 4ODWB 4GIOA 1DJGA 2A9NH 2FD6L 1IRAY 5GJSL 2O61A 2XVLA 2VDOL 1P5UB 3SYAA 4U6YB 3VXRD 3TURA 4FFZH 2C7UA 4QKTA 3EZ8A 3P1VA 2P48B 3U7YH 4PJGA 4MBOA 3F7YA 4OLWL 4LLWA 4MJHA 4ODBD 1CGYA 2J4WL 3MYJB 3ABMB 5ENWB 2X5PA 1A6TB 4AK2A 2MNJB 5EU6E 4DN4H 5B8CB 2K45A 2CE6A 2DYPD 4NQDE 3EYVB 2IAND 4F3FB 3BT0A 1HINL 1YSOA 2JK5A 2K7PA 3HUJA 4DEPB 3FYEB 3CZFB 1YC8A 3FNKA 2WXOA 4K5OA 4OTXL 2BIOA 4R2GB 1ILUA 5DJ8A 5A1AA 4G7VL 4O2FB 2YKLH 5L8KB 4H88H 2GIYA 3KL0A 5K33A 4KROC 4TVPH 4AVIA 4NYLB 3I2CL 2BNRB 2VXTL 2B2XH 2J1ZA 4P5MA 1ZTXE 5IOKA 2EUWA 5IK3A 3QXDB 5HHOE 3N55A 3VXPA 1CVRA 1H15B 4RWYH 5E8EA 3T0EE 3UTPE 3V10A 4P2OD 4Z7OB 3GXMA 2VDLH 3A4DA 3PQYB 3OR6B 1ITBB 4PJHB 2ZXCA 4W68A 1EH9A 2H6UA 1YYCA 3DO3A 1JFHA 3EH3B 5GSVA 4MSWA 1FAIL 3BN9D 3I9PA 5AG9A 3W37A 3ZHLA 2V7HB 2XWTB 2UZIL 3JTBA 4XC3L 1VADB 5I0DA 2PO6D 5IMMA 1J8HE 2EUZA 4E9YA 1BWMA 2CNZA 4QY8A 4JZOB 3ULUH 2G5RA 3UCRA 1OAYL 2HFEB 3CXDH 1AQDA 4NQEA 4LU5L 3ILEA 4JFDE 1OP4A 1OCZB 1XIWB 4H5SB 4MQXD 3L4UA 3VJ6A 5JO5A 1GW6A 3H2WA 3BKYL 3WMSA 4GRLC 4XMWA 3QQ9D 1PQZB 4YDJB 1UEMA 4C58B 1A4BA 3HE7D 3JWNC 4I3RH 1MXDA 1NCDL 5IB5B 4X5RA 1HILA 1SYVB 3APNA 3CVHL 4FEIA 4ODXB 2R0KH 3SE3C 1PF3A 2PYEE 3OHXC 4G8GD 1YMMB 4OGYH 4PJAB 1BECA 1TTAA 4DFIA 4EAEA 1QSFD 3VWJB 1KUMA 3VVWA 1H0DB 4HEME 4G7QB 4KJYB 4P2OC 4PI2A 5F88B 2HTLD 1Y18A 1G0DA 4Z3FA 3L08A 4Q58C 5GS1C 4KXDA 1RK7A 3BN9C 3PGDA 1KY7A 1I1YB 4ALAC 1XCQA 3FYIB 2Z8VC 3ZE0B 5JIKA 3F7VA 2OJZH 5F96L 1IV8A 1UWEH 2VN5A 2H26B 1IVLA 3KPSD 1XDYA 2VIRA 2RA1A 2MWCA 4MA8L 1KYAA 4KRMB 1RY7B 1CFSA 2DLTA 1SDYA 1W80A 5EIQA 1GIGL 3A4AA 2IWKA 3E3QE 4FLRA 4TUUA 4Y1AD 4D9QD 3V95A 4QXUL 2YEZB 3BEVA 2E47A 3BVDB 2ZKYA 3TYFA 3HE7C 1WGOA 2HVJA 2BFGA 5LBSA 1O7DE 2NY5C 3LCYA 5EN3A 4EF3A 1E6OH 3N1GC 5IW1B 1F1DA 3QR1A 1DE4A 4NM4H 32C2A 5H37H 2DH2A 1DJWA 3ES6A 3KGTA 3L5IA 4N2AA 3FO9A 6FABL 4XBMA 5HGBB 5JR1H 2GITB 2DDQL 3BRGC 3KG5A 4ZZFA 3DOHA 4YR6B 4XCEA 3IDMB 4OY9A 2WB7A 4KNSA 4B95C 2WCSA 3WN5B 4ZPTB 4A6YB 2Z93A 1DVYA 1FNEB 2CCLA 3FTSA 3JV0A 4X7TA 2WV3A 3JWNH 4X9BA 5D7JC 5E6IB 2BVEA 2P52A 4JREB 2XV6B 4BKTC 4OJFL 5C3TA 2VLLA 1DQTA 1MWAA 4L8SA 3U48A 2IEPA 3BE1H 3M1BB 2A74A 4GS7B 5EEUA 4QCIB 2XNAB 2WWKT 3ZDZB 3T4AB 2P8LA 2H32H 5GQBA 1WK0A 3QZMA 5E08L 1JPTL 5F89B 1XT5A 3HC4L 2FX7L 5F6IC 1AQ8A 4YN3A 3VG9C 3WKQA 4D8PA 5GS3A 1FHGA 3ZL2A 1YDPB 1OSEA 1L9PA 3HI1A 4OIFA 4R7DB 5GPRA 3ZYZA 3MOAH 3RE0A 4UANA 3HHSB 2XZAL 2DQHL 5GRYA 4D3CH 1D5IL 2C8NA 4HK3J 4ZW7A 3ZRFC 5C92A 5I17B 4LEEA 2KKQA 3T65A 2X10A 1EHLL 3IMUA 5DJYA 4LEOB 3SBQA 1X6NA 4UDTA 1SOSA 4D0BB 3CN0A 3FB6B 3AVEA 5I18H 1A4JB 4MA1C 4X9GA 4ABVA 3SQOH 3QHZL 2WQVA 3L3DB 1CZ8H 5HVHC 3NZUA 5EF3A 2NY5H 2R1YB 1E4XI 3D07A 1N8ZB 3GLZA 4G11A 4DP4X 1A4KA 1NLDL 4KI5D 4L3AA 2EE2A 3IRPX 4R97B 3WDHA 3D4YA 3EYFB 2BP5M 4MXVE 2G9KA 5I24A 1XF1A 4MQ7B 4AM0B 1TZIA 5TQ2H 1HHKA 1UB5B 2YOCA 1DO6A 5T1KA 4I87A 4OF5A 2IDUA 4Y2DB 2VDOB 2OP4L 4LHQB 1BF8A 4PP1D 2O72A 3DTDA 3KGSA 2WTOA 1OD9A 1REIA 2DM3A 4P23B 4J3OD 4ZSOB 5KVGL 1H6UA 1P5VA 2YGPA 3HB3B 3IMRA 5DUBB 2NRDA 5CIPB 4Y4KA 3EO1B 2MCMA 5MI0C 1DHKA 2R1WA 3UZQB 5HHNA 4HJGB 3X17A 3AS1A 3DIDA 4KRLB 5FW8A 1NDMA 5DHMC 4C4BA 3FHAA 3X1BA 4JHWH 4X6FA 1CMOA 1V8HA 1FG2A 2WLIA 4M6NL 4M7KH 3RIFK 4IS6B 3BGAA 2EIJB 3CMOH 5DD5L 3TA3D 4HK0A 5EWIL 4JM0A 5J1TC 1V5JA 4IBYA 2WO2B 4GAJL 4KI5C 1UT9A 5CD3B 1JK8A 4E41B 3HRZB 1JZ7A 4L4VD 2ADIA 4KTEH 5E7FA 4NO2A 2IAAC 1SHWA 1LO2H 5KYXB 1FYTB 3W81A 2CLZA 2PPFA 1BGXH 2P3YA 3OG6B 3T5WA 1KCRL 4H13C 4JX0A 4UIKH 4JKNA 4DGYL 4C47A 3C6LB 2KZWA 3C8DA 2BHZA 4PGCA 3U82B 4FLHA 3KYAA 4GSXA 1JGLH 3K0YA 3IE4A 3DOIA 4ORZC 4OV5A 2PKDA 5EO9A 4KMLB 3ULAB 2BC4B 4HVBA 4MQTB 1JV2A 3QUYB 1TCMA 2FO4B 4N0FA 1TO5A 1N12A 4IEFA 1S7QB 4M48H 3J27A 3TA3C 3LS5H 4PJIE 3F6IA 3BP7B 1S7TA 2CQVA 3CNKA 5K5YA 3VI3B 3QORB 1DQKA 2JKLA 3OLGA 1U95A 3V8CA 1CBJA 1KCSH 1FO0H 2HXAA 1SLXA 4E5XG 2NW3B 5DFTA 3EGSA 4KK9C 3GMLB 3QUXD 4I4WB 1HZHL 4NKOA 3FULA 2YRPA 3TBTA 5JHAA 5F3BA 1KGIA 4ZW6A 1TQBC 3S96B 1QSEB 5FCUL 4D2NA 3IAGC 4DHLA 2K8QA 1JK9A 1LWHA 4OR1A 4QRQB 4WI9A 3TEYA 1TYJA 3S2CA 3F04A 2VZOA 3II1A 4NI6A 5BQ7A 4FZ8L 3RWDB 4FP8L 1U36A 3B2VH 4OLUL 4F1ZA 4LLYB 5DK0B 3B7SA 4PN6A 3FL7A 1OV8A 4CL7A 3A6OA 2MPAH 2VXVH 4JQXC 4LSPL 1R75A 1MREL 1NFDA 4WO4B 1LP9A 3QIBD 2GTWA 3PJLA 5HPOA 4DTGH 4J3OH 4PWEA 2ADFH 4LVHC 1JSYA 5EOCH 4AC2A 3DX3A 4DKAA 1UZ6F 4U1KA 4PAZA 5KN5A 5DO2C 2BIMA 1SVZA 1E9OA 5D4HA 5SX4H 1MXGA 3MMEB 5GZOA 3L5HA 4LCIH 4O2CA 3QDGB 5JW5A 4ZMXA 5IR1A 5FDYA 2EAEA 3HS0B 3WDJA 3QUXC 2EIEA 4BFRA 3S36L 5I8KL 3T4YA 4AZ8A 3ZSSA 1MFNA 4NZFA 2PWEA 1P4LA 2XN9B 1ADQH 4EXPX 3RNKA 1NGXA 3D85A 3BCFA 3MHZA 1AHKA 1B4JL 4PJ5D 3LEVL 2R39A 3MXVL 4HOZA 1PDKB 4R0LA 3L3GB 4N0RA 1I1RA 4NS0A 4PJXB 1AY1H 3PJSA 3K72A 4XXWC 2HYMA 3B9AA 5HJ3A 2BSRA 2R69A 2CAKA 1OGAA 1ASPA 3GMOB 1SFHA 4N4YB 4NNYA 2AEPL 1JGEB 2IPKB 4LLUA 3QUZA 1OIOA 1JYWA 1WYJA 4UBDD 4ETQA 2JKXA 1CR9H 1FGVH 1PFCA 4LLMA 3BVWA 3II3A 3PUCA 2OA9A 1MWOA 5EFIB 2XN0A 4X83A 3AWEA 1PL3A 2XVBA 5C6TH 4ZTOL 3AW5A 2OTUA 3VGEA 2RJMA 1AIFB 1E9PA 3W0WB 3L4VA 5T3ZD 4XN2A 3FONB 1FN4A 2XQBH 5I1JL 1L7IH 4RDQF 4Q56A 3E8UL 1Z5LB 3CLWA 1KBGH 1Z3GH 1J1OL 2UZYB 4ODTH 4WY7L 4I0KA 2Q8BH 5B1AB 3LZRA 2G60H 3QS3A 2CA4A 1YVLA 4XCNA 1R0AL 3QXWA 1I8AA 4Y5XC 5DUPH 2X0VA 3E7JA 4C83A 2EXTA 3QAZC 1FFPA 2A9ML 1QAWA 2GJPA 4JFED 2Y5QA 3NACH 1A6UL 5FKAA 5FYJL 4A2LA 4RNRB 5I26A 3T08A 1IU1A 2ZUVA 2H0PA 4U7SA 4HPHA 1AC6A 5JOEA 1MFCL 1CXEA 1R6VA 3OKNB 3O0LA 2CBTA 1MLCB 3M88A 4HGMA 5EZLB 2BS8A 1A1MA 4HIJB 3WAJA 2ORBH 4IU3A 2XQYK 3NJKA 4DW2L 2VDQL 3MLSL 3QNZA 4G6MH 2MKWA 1LK3H 1QLRA 1BZ7B 4M1DL 2NY7H 3T2OA 2XCMC 4GAYB 1XBDA 5ICYB 3ZZLA 3GIZL 1R3HA 3GSNH 4HKJA 2A6DB 2ZF8A 3FBQA 3D2TA 3HCVA 3NCMA 3VH8A 2G4EA 1UKTA 5EU6D 3ASWA 3TVMD 1CDBA 1CF1A 2Q87A 4NQDD 4YQXH 3P4MB 1TTGA 4J3OG 5KVEH 4KTYA 4HHWA 3SGEI 1WFUA 2CO4A 2OMWB 2IPUK 4KHXH 1TTUA 4K8RD 2Y6SD 1HH6B 1KGXA 2EDLA 1QVOB 3LEYL 4XI5C 1U3HA 2NX5D 3SE9H 3CU7A 2LLLA 3OKMA 1CGSH 2XQYG 4I3SL 3B83A 3LNGA 3VXSE 5D1ZD 5HHOD 4TQHA 3UTPD 1TNMA 3J7HA 4FRWA 4GP5B 3UGXA 5J1SC 4WO0A 3BRFA 5E5UB 3W5NA 2GQHA 3U0PA 1IZKA 2FWOA 1CTNA 3KXFA 3HAEB 4GG6A 1G9HA 4IRZH 1J48A 1NSNL 3O4LD 3R8BB 4AYDC 5I5RA 1J8HD 1E4WL 2IPUG 1U8CB 3GSVB 2JKRM 4GBXB 2HJKB 5A6LA 3CJJA 2CGZA 4QXVA 5EOQL 3TO2A 4N8VA 1E0OB 4G7YH 3OJMB 1KY6A 3LNDA 3QFDA 1WITA 4IDLA 1UYWL 3K6OA 3WTXA 4ONHB 3TVMC 5C08E 1ZTMA 3KLLA 3OHMB 1KJ3L 1EO7A 5DZNA 3RLSA 4LSRH 15C8L 2R0LL 4K8RC 4HUVB 4KH2A 3D51A 1R5WB 1FFNA 2R4RH 1F4WH 2Y7QB 2X6VA 1I8LC 1CICB 2PYED 3O2WH 5T3ZH 4AYMC 4WUUB 1FZKB 2JJWA 2XWDA 1CFTB 4JR9H 5E94A 4IRJA 4HIQA 1ZVSA 1UFUA 4X0NA 1UD5A 2VR6A 3T0EC 5F72S 4XBPA 2YD9A 2ZOLB 2DTSA 5F7YC 5I1GH 3D25A 5F71A 5HHME 2AMUA 5MERA 4MAZA 1DJSA 3BIKA 4JVWA 4BWWA 1E5BA 4JKMA 1JPGB 3VXOA 2PMZA 2R59A 5JW4R 4JKWA 1G7HB 4TQEL 4GQZA 3BUYB 2CHNA 2G2NA 4B0MB 4QOKE 3ZRSA 3QCTH 4L9LC 4N24A 3UJTH 3WCYA 3AADB 4XPBL 1TVBB 5IQ9A 4MXQD 2XU9A 2GJ6B 2QFPA 2Z8RA 5AW5B 3U6XA 2KERA 1ASQA 4BSJA 1FFOB 2G75A 1OARL 5CGYC 1Q9KA 2FTAA 2V2XB 5LKNA 2YMXL 3N91A 1LEKA 4KRPD 3MFFB 2FT6A 4Y16B 3T8MA 3GSWB 3ZE2B 1TZ8A 4G8FA 3C5JB 3TN0A 3VSUA 2ZP0T 1QO3A 3SCMC 1T3FB 3KWUA 4UTAA 5IEKA 4ONFH 1KB5H 1G9EA 4EQ2A 2NQ3A 5KYYB 3UOAB 3EHBB 4ODSL 4ES8A 4K8RH 3UX9B 1LE9A 3GGWB 3LKQB 2AEQL 5FW6A 4YJZL 3ZUCA 4YC2B 3QCUH 3JTTB 2I9LB 3PWPB 4GB9A 1X7SA 4LCWE 1NGQH 2AERT 2F54E 5AAWA 2LE9A 4MXQC 3T1WA 1MVUA 2BIPA 3E3QC 4EZMA 1NCCH 3NA4A 4OJAA 1L5GB 4P4KB 5KSAB 1F45A 2IDCA 4OLYH 4Z7NB 4CA4A 1IAIM 3LSOB 2DTMH 5JLZB 1O7DC 1J05B 2Y1VA 3ARVA 4E0RB 3RQ3A 3IU3B 4IBTA 5CU5A 3UG5A 5LWYH 4H1LB 1TETH 2WBJB 5E2WL 4ZAKB 4V1DA 5F9WB 3IMSA 2EILB 1OF2B 1YQVH 3BH8B 1FVDB 3MRLA 4ZUSB 3S37H 5ICXB 3FRPB 2RH0A 3OPZH 1B3JA 4JFZL 4LHUB 4Q6IB 3MA9H 4WWKD 2BNRE 1G4RA 2HJFA 1NOFA 1ERNA 2LQRA 4MYPA 2LW3A 5MP6H 5LDSA 2ADYA 2PXYA 2R7EB 3B37A 2CGYA 2WP3O 5ITFB 3QDHA 5F6HI 4I0PC 4KV5E 5EZJB 4AW7A 2YRZA 3D4GA 1VESA 4ABUA 2JELH 3PWUA 4I18B 3SPHA 1NMBL 3DVGA 4MNQB 2OZNA 1RUKL 5EU5B 1N0LA 3QZOA 4PJ8D 5E95B 4B9PA 4OCMC 5EC2A 3AAZB 5FFGA 1VPOH 3IDNA 3OF6D 3ZVVA 4EI6A 2NY4B 1OTTC 2O61B 4ADIA 3RZCA 3T3PB 1ZGLP 1KXVA 2FNBA 1AKJD 4YDLC 4HWEH 3GJFK 1ZVNA 2AQ3A 4PJGB 5L9DL 1NAKL 3OAWA 4GXUM 3NJFA 5D6DC 5I1KH 3QQDA 4KO6A 1R3LA 2YAPA 4N2HA 5MENB 2BP0B 4NENA 4NJ9H 4JO3L 2NTFB 3IDJA 3QT2A 2VQ1B 4MDIB 1A6ZA 5IZ7A 3HUJB 2JK5B 3VD2A 3D48R 3PGFH 3Q44A 5CCGE 1HL9A 4CSPA 2ODHA 1M9WA 3TBBA 3SODB 5DJ8B 4WWKC 3VD5A 4BRVA 4GI6A 3SYCA 5KAQG 2AEOA 4YHZL 3WTSA 1EV2E 3SGDH 4UT9A 4GAAA 1E2VA 3O4OC 2HH0H 3WL9A 5J6GA 3RVXD 4P5MB 3ABZA 4YBLB 5IK3B 2BW5A 5E8EB 2GABA 1FI8C 1Z3RA 4RGMC 2CG9X 1AD9A 5AVTB 2HKFH 4XH2B 1CLYH 1SLUA 4PJ8C 2EIZB 4K3EL 5B4MD 3TJEH 5DZ9A 2H2SD 3HBZA 5B1CA 3FT9A 3ZE0E 5GSVB 1QI3A 3T3ME 4DESA 3QC6X 1FAKT 3BH4A 1HH9B 3MREB 3M07A 2F1BA 4C4KO 1TQVA 3PABA 3DV4B 4L5FE 4F7PA 3GBMH 3EBIA 4HJJL 4QY8B 2FB4H 5JHLH 5IMKA 4JO4L 2VKXA 3WLBA 5CU9A 1S3KL 3PAZA 1AQDB 3BO8A 1MRFH 4PUBH 1UM4H 3TF4A 5JO5B 3HC3L 5GGTA 3WTWA 4UQ2A 5DJAB 1HI6A 3OZ9L 1TEGA 4UTBA 5LO7A 2ZCKH 1X5LA 5LN4A 3A6CL 1CXFA 2CKBH 3FK3A 5CBEB 1KIRA 3IFPB 3S5LG 4PR5A 3ULUF 3F62A 3QQ3B 4GXVH 5F1IA 5DLMH 1ETB1 2Q6WA 4QRFA 3RVXC 2WNXA 3ZT5A 4WGVB 4LARH 4WV1A 1OAJA 2FBOJ 1H3GA 3OB8A 3QPKA 1N4XH 4UYPA 4XO4A 1WFMA 1KZQA 2FH8A 4WQOA 3DNKA 3K8LA 5B4MC 3QPXL 2APTA 3JWDC 1WP6A 1Y18B 3L7FB 4PRHA 4KZDH 2MRYA 3PV6B 3AMLA 4LCUB 2Y7OA 4CSSA 1IBGH 4P2QA 1VEPA 4CC1A 1SM3H 2CA3A 5AL0A 4QLRA 1E6JL 4JM2D 2GY7B 3LIZL 3QEUA 2WO4A 3F7VB 3VWKB 3P30L 1T6BX 3IDIA 2VIRB 3O41A 4A68A 2ZOOA 3B9DA 3CPUA 5HSFA 2L4OA 4E9LA 1TIUA 1NEPA 2H2PD 4NDMB 1CFSB 3TEUA 3V5HA 3VGGA 1QKZH 4NP4L 1DJYA 4KNTA 4F9PC 3ZZSA 1IVTA 1UA6L 4I7ZC 4NO5A 4ELMB 2DQTH 3TYFB 1TQCB 3BP4A 4HCRA 5FF6B 2HVJB 2Z92A 1E42A 3B7YA 3K6NA 4PRPD 1GKOA 1JHKL 4ACPA 2JJSC 1BJ8A 4WI2A 4KDTA 2YA2A 32C2B 1I1AD 3Q8BA 3HLAA 1DJZA 1RD6A 3FO9B 1IC7L 3GNML 2RALA 1TNNA 5CNHA 1HHHA 4UV4H 4XCEB 1RZKL 1IBFA 1INEL 1QRNE 3N0AA 3PGCA 5HHXH 1TDQA 4HD5A 5D1XB 5JW4Q 2WXIA 3FSVA 4AGQA 2Z93B 4KJWC 2VR4A 3RURA 5BVPL 4RMQA 4X7TB 1EERB 3R4RA 2AV7B 5CLYA 1GHFL 2KUTA 1E9QA 1MFVA 3B3IA 4BFBD 1T1XB 4L8SB 2A74B 4JM2C 1OF0A 2DD8L 2W1NA 2Y07H 4UM9D 3SBWC 5HHVL 3WG7B 1CLVA 4B6ZA 1X5JA 2ESVD 2G5BB 2H2PC 2L04A 3D50A 5B38A 3BD5A 2XWEA 3KPRB 3G6DL 3QPQD 3ARZA 2QT6A 1KFGA 2VERA 5EF1A 3NPSC 3NIDB 2R69L 2BP8A 4ZSOE 2A6KA 4D8PB 4PGJA 3H9YA 3HI1B 4WNQB 4JK0D 3SDDA 4OI7A 2NUTA 1PCSA 4L37A 5GGRA 2YRBA 3HI6L 5LCVA 2A4ZA 3UO8B 5DD0H 1I1AC 2APFA 2BERA 5E0QA 4AKPA 1V27A 3PDDA 5BOZG 1CO1A 4LPCA 1T4KB 4GSDL 4PJDF 5DJYB 2GJZA 4RMWA 1QZNA 4OGXL 4GP8B 1G7MA 3BXNA 4UDTB 4U2ZA 3B9KA 5IVXE 5F93C 1HXKA 4X5QA 3BPOB 3H42H 4Q2ZB 5CFAA 4F91B 4E41E 3O9WB 4XPHL 1HESA 2KQMA 3K74B 4YHML 1A4KB 2LR4A 2EDYA 5D2LA 4NB7A 4K7PH 1GGBL 4L4TA 1J86A 1OL0A 4YHPA 3QUML 4NAMA 3GXTA 4GQRA 1TZIB 1GKEA 4M5ZL 5K1VA 3Q8EA 3GFUA 1FYTE 3BP6A 3CFKA 5I71C 3D0AA 4W9EC 1KXTA 5T1LA 3K1DA 3WY1A 4N2CA 1ZHLA 2XWBB 4Z3HA 4FYTA 2PP8A 4XVJH 3F2LA 3LMJL 2EVIA 4J39A 1TYEB 2F5AL 4LL4A 5TPWL 2VDRL 4O4YL 5JYLA 3WXVH 3TCXA 4ODVL 1P5VB 3OXSA 2JQZA 4NPJA 2R8SH 2OMBA 1UM6L 2ZSVB 3IF1A 6CGTA 4W9FC 1KELL 3O2VL 5PCYA 4XNMA 4YUEH 2A9AA 2VQUA 2WLIB 1CIDA 4JY5L 3FF8A 3FQRB 3QZWG 3ARGA 4GMSH 1LGVA 5CLZA 3VI3E 2QKIC 1F58L 3TEWA 3CPLB 3C5ZA 1JK8B 3BSZL 5F9JA 5KEZA 4GXFA 2VXUH 2YKKA 3SKJL 5DUML 2VL4A 3F01A 3L8QA 4JQIA 2ADIB 1BAWA 4NO2B 4WLCA 3RWCA 1G87A 5BW7C 4JHVA 2YD7A 1QSEE 1YPZF 1DVFD 4LK4A 3MBXL 3VFPA 2VMEA 4UQAA 2CLZB 1FFTB 3VXSD 1S7UA 4CN6A 4XP4H 2AZAA 3TT3L 4AUJA 3O3EA 4KKNA 2JCCF 3JVGC 4PCYA 4UWQB 4AMKL 2XACC 2ZX5A 5BV7C 3GMQA 1BFVL 2PTUA 4ZXBC 5BNXD 3U79A 3GZKA 4PGCB 3UC2A 3UEZA 1JI2A 3P4OA 3ZTEA 1OP5H 3ROOA 3E2HB 4OV5B 1JPSH 3CUPA 3HFML 4ISVA 1NOAA 3C09B 1P7KA 1IBDA 4TPRL 1JV2B 3FQ1A 1RK1A 5EZOH 4XC1L 1S7RA 1S7TB 2MSPA 1KIUB 4HUXB 5C08D 3SDYL 2XYCA 2X4OA 3FTZA 1PKQB 4GO8A 2D03L 4W4OA 1WAPA 3ATFA 1U95B 2H0JA 5IFJA 5I1IH 2WBKA 3SGKC 3TIDA 1SXNA 4HETA 3DOSA 4YPGA 3C9NA 2ZXBA 1DVFC 4J8QA 3ZQXA 2FNWA 4HAKA 2OMTA 4N2NA 4NKOB 5KVDL 3TBTB 4FQPA 4N28A 1EVUA 3RZWA 5F3BB 4HT1L 4H20L 1CBVL 2K6WA 4NQCE 4L4JA 5DQDH 3TO4A 4D8OA 1T7XA 4WFHE 3W9EB 5CGMA 5JNYA 3C60A 1JK9B 1AXTL 2NY0D 2ITCB 2MTAA 1UWXH 5HHMD 4U6VH 4BFIB 3HVNA 3T2NL 4JO1L 4GY4A 2XSKA 3IJYA 5JDJA 4AXWB 3VSVA 2VZUA 1OAQL 5LXVA 2A0LD 1VFMA 9CGTA 2Z0UA 4GI8A 4QOKD 4DP8X 1LE5B 3BZEA 4KI5F 3CQFA 2PW1A 1DQLL 4X9IA 2GTWB 1AZBA 2A77L 5BV7H 3IPBA 2PWFA 5CO1A 2HKHL 3W0WE 1IIKA 3O8XB 3MA7B 1KT2A 1B0RA 4FNLL 1E9OB 1NBVL 3KCWA 4HIEA 5JW5B 1WO2A 2VXSH 4UQCA 2B16A 3BGMA 1NC4A 1S4IA 2A4CA 4AZ8B 4FC3E 4N2GA 2G9HA 4JG5A 4J3OF 3M6DA 1P4LB 4A37A 43CAB 4R7LA 1J10A 1UD3A 3RNKB 3OGCA 1NGXB 1W72A 3D85B 1VF5C 2DKUA 2NY0C 1RUPL 4R0LB 2BVTA 1R5VB 3JV6A 4P2AA 2C3GA 1XSOA 3K72B 3O6FA 1TTFA 3PJSB 3NOIA 5HJ3B 1BJ1H 2BSRB 4GIPD 1OGAB 3BLBA 4M5YH 2A0LC 3FO2A 1BBJA 4RFNC 4XXCA 1OWRM 4NNYB 1QUNA 4LCWD 4B9YA 4EUPH 4CRPA 4LLUB 4OZIF 3QUZB 4ZFFA 4JZJC 2F54D 4LLQA 4XB8A 5JUEL 5CCJA 1CLOL 3HZ3A 3DRQA 4ETQB 1ETZB 1UQSA 1UXSB 5A2CA 4LLMB 3P4NA 1CLZL 2VDPH 4X42A 1A7NL 3WEXA 2ITDA 4U1IA 1M7DA 3L5JA 1BQLH 2WKGA 3T71A 2P5WA 4OSUH 4S11A 1YEWA 4JFYA 3RKPA 2BXZA 4XPAH 2B1OA 1E9PB 4ZO9A 4HAGA 3NEOA 2ZWNA 3C8HA 5DEFA 4RWHA 1FN4B 2AK4A 4QIRA 3UJJL 1A9VA 2ED8A 2OJ1A 4MCNA 4ADJA 2KBGA 5GZNA 4R2GD 1CWVA 4DP0X 1ZHKA 1UGNA 2EH8L 3NFPB 3S4SB 3VD0A 1NAMA 4XCNB 1LO5A 2WKLA 2EE0A 4C83B 2BNRD 5CWSA 1MIEH 1YEHL 2TRYA 1FFPB 3O6LH 4F8LA 5C07E 3BRDA 1GAFH 2I07A 2KMWA 2OYMA 3WUWA 3L3OB 4PYHA 3PQYD 4GH7B 1KV7A 2VDRB 4RMBA 5CMAA 1H5BC 2V5SA 1E5UI 1JPST 2A2QT 3NABL 2YA0A 3MX0A 1RXLA 4ZI8A 1MCOH 3P3SA 5E00A 1P5UC 4CC0A 1UWGH 1A1MB 1QPPA 2LU4A 4XNUH 1TQUA 5KOMC 2WLKA 1XF3B 1QLRB 3VACA 4HX1B 3HC0A 1XIWD 2GJRA 2F8IA 1J8KA 4MAYA 3ARRA 4OAWA 4N68A 3AUVA 5FXCH 4CDGC 2XV0A 1N67A 1WZ1H 4LGSB 2VMJA 3AXIA 3MCKA 3VH8B 4JPVH 4WW2C 1J1XL 1OCRB 4HUUB 3LKNB 5D6CA 1J5CA 4XNBA 2WY3B 3MVSA 3H9HA 2V37A 2WAQA 4O9HH 1YMMD 2VLMD 3ARPA 4JRXB 1U3HB 4YDZA 3EJQA 3WHXA 1BZ9A 5SWZB 2DIAA 2JQAA 2VLJE 3L9RA 2XN1A 4KXCA 2XFXA 3VWJD 1JDCA 2X4NA 3EW3B 4WEUD 1KPRB 1SVBA 3SKMA 3WFEH 1A3LH 1A7RL 2OK0H 2GHZA 1R4XA 1XTLA 1A6VH 5BO1H 3FQ2A 3FTYA 4PB9L 5JOPE 1ND0A 1G1OA 1EVTC 2CRYA 1DBAH 3DROA 4L0PB 4X0KA 3KXFB 3U0PB 3MO1A 5E2JA 4YSAA 3EH4B 4QR7A 5ESVA 2RBLA 3U1SL 5FO8B 4GG6B 1X3DA 4BA0A 3DJ9A 3V4UH 4PG2C 1L3NA 2GJ6E 3BKMH 1KGWA 2F8XC 1EAJA 1EZVX 4N8VB 5ESAA 1Z1WA 2KLRA 1SUHA 2Z8WC 2PWGA 2AF2A 1BM7A 2DWDA 4PRIE 4ATTA 1RAMA 3HG0A 3OB0K 1FZMA 1FIGH 1MJ7L 1B90A 2FUTA 1XH2A 4ZO8A 1QWHA 1UT2A 1NEUA 2E9IA 3EBAA 5JPNA 5DGQA 3SDXE 3LRSA 3B5HA 1BD2A 5B3JF 3GPEA 1FFNB 1G9ML 3AGWA 3UBXI 1J88A 4ZX5A 1I7TA 3CVIH 3QG7H 4XB7A 5I1CL 2CUHA 1JHLH 1KLFB 3GHEL 3IJEA 1DQQA 1DDHB 5AAMA 1ZVSB 2UYLA 4GQPH 4J3UA 4LGPB 5E6ID 5AKVA 4XBPB 2ZOWA 5I30H 5EUKA 3D25B 1SEBB 5MERB 3UEQA 3BIKB 3L2MA 3PWPE 3KL5A 4ONGH 3Q0HA 4MCYA 4WI6A 1I9JL 1KACB 1F4HA 1KFAH 2AXFB 1JZ6A 4G9FA 4ZUVB 4JGMA 1RVFH 3U2JA 5IQ9B 1FLRL 1RMFH 4JY6A 2X2UA 4Z7NE 1XO8A 5L4MA 2G75B 4Y19B 4BK5A 4GG8A 1J9SA 3HKZA 4GT0A 4M8RA 5GRZA 1LEKB 3JWOL 4DGVH 1MFEH 4FMKA 2JFCA 4XNYL 5FS5A 5T3XE 4U49A 3Q9QA 2F58L 4HCRL 4AJVA 4QTHB 3MR9B 4LIQL 1UKSA 4KJQC 1QO3B 4KK8D 3BZFA 3BMVA 1JNHA 4OIBA 4HMCA 4UB0L 4HG4K 1JBJA 2HFFA 5EV7A 3VFWB 3P9WB 5E6IC 2DI9A 1RCYA 3IU4H 4N86A 5HDOA 3RAJL 1EHXA 4FYSA 1QUPA 4JREC 1JOIA 3JXAA 3LZOA 4Q0XH 2VXQL 5AW6B 4M62L 5TQ0H 1LE9B 4TMPA 5AZ2L 4YDKH 2HWZH 4MNQE 1UENA 4APQA 1KN2H 3T4AC 3RWIA 2NQCA 3SBPA 4FFYH 1UATA 1MRDH 3MYZA 1KCUL 5D7SL 1Q72H 4FULA 4MJ4A 2CNYA 2OULB 3QCUL 4Y2DD 2DQFB 2B5IB 1AD0A 1MVUB 3RGHA 3T3PE 3HZVA 3N43F 4P23D 4E9SA 1M57B 3II2A 4I2XB 2OR7A 3S37X 4YFEA 2VR3A 5BZXA 3HB3D 4KGJA 4PJGE 5IESH 1JZ8A 1RJCA 1MJUH 1MCFA 1UXMA 5C2BL 4L5FH 5MENE 4X99A 2K3HA 3EZJB 3WU1A 1UH2A 1J0KA 2LFGA 1H3TA 2JKJA 4WJG3 3RDTA 4HIHA 3HUJE 1QSVA 3MLVH 3U30B 1BXVA 3K2UH 4JN1L 3NCJH 1F97A 3WGUB 1BBDH 1A1OB 3MRLB 4A7VA 4GSUA 1JNNL 4MVBD 2YGOA 2WXGA 1FVCA 2QADB 3IXTA 3B34A 2Z91B 4F2MA 1EFXA 4POYA 3RVUD 1DP0A 3LJ3A 4E41D 1IEHA 1GZHA 2A5UA 2PXYB 1W0VA 4UILL 1J5IA 1BJ1J 3RI5K 1HL8A 1VGKB 1XX9C 3CHPA 2WQ8A 2WZAA 2KHAA 3BFOA 1FNGA 4JM4L 2Z34A 1FYTD 1INDH 1X4ZA 2F1AA 1Q90A 1N0LB 5EC2B 1WEJH 4MJ6A 4R26H 3L1EA 4P23C 3GBNH 1JP5A 3C6LD 3CIQA 3HB3C 3N85H 3RZCB 2KLTA 2EO7A 3EOBA 4NQEE 3V0VA 3AREA 4E36A 4CSTA 2DL2A 1BVLA 3IETA 3P0VH 3N41F 3QQDB 1R3LB 3DX7A 3WFDL 3AB0C 4EI5A 4MMYA 3QUYD 4Y7MA 2R51A 4NENB 2Q10A 1AQKL 3MACH 3IDJB 1BPVA 2O5ZL 2RCSL 3G9AB 3SY6A 1AHMA 1A6ZB 3W9DB 3DX6A 2JXMB 4TL5A 2XPZA 4O02L 2A73A 2BCMA 2WK2A 1NBZA 4QTIH 2VSDA 1MY7A 3RB7A 3ZLQC 2DOCA 4XVUD 1BFTA 2GCYA 3HRZC 3JUYA 3QORD 3MODL 2WSKA 1KN4H 2DJMA 4XZUA 5J6GB 4YEEA 4OJEH 3OKDA 5FR3A 4XMLL 5I16A 3QJHB 3SO3C 2QQLH 1R17A 3WIHH 2B0SL 1QSED 2VMDA 4M9PA 3RL1A 4UMGA 3DETD 4PRBA 3RGVA 1L4IA 1T83C 1DQMH 2YBRA 1NCBH 4PWIA 3N42B 1QHOA 5LDUA 2BVPA 2QVKA 3A3YB 5IMKB 4LCCB 3BO8B 3VQMA 3RY4A 2FD6H 1THAA 3N1QC 5GJSH 4R90L 3QUYC 1YYLH 1VKXB 2VDOH 5F7LB 1HI6B 3RWFB 2CK2A 3S2AA 3EO0B 1RZFL 4WO4D 4X8CA 2OX5A 4PVBA 5D1QB 4OLWH 1KIRB 3Q8CA 2WXNA 4J12A 4F5CA 4F27A 3QJFA 2ITFA 4PR5B 5CIPH 3QORC 3CH8A 3F12A 1T0NB 4Z3EA 1S78C 3Q3GA 5F9AC 1HINH 1JCKA 2F7IA 3QDGD 3M7FB 4NCC1 3ETBF 4WV1B 3ZO0A 1HDMB 4N0UA 3UG3A 4HG4J 5AVWB 4JL1A 1X5FA 3FDWA 2XN9D 4PEEA 2G4GA 3I2CH 3EH5B 1IE4A 2VXTH 2CDFB 3Q6GL 4UQ3A 5HDBF 3TX4A 4Z7AA 3HS9A 4NQCD 2VAJA 1BFOA 1TQTA 2QQKH 3BAEH 4Y5VA 1Y6MR 2CD0A 1AJ7L 3IDIB 3O41B 4PY8I 5E51A 2MHAA 3NIDE 3U83A 1JMXA 3MV9A 4JG0L 4KMQA 1KPVA 5FO9A 2CRIA 2FT8A 3BZDA 3DSNB 4NO5B 1OAYH 1T1WA 1ML0A 2HA1A 3BP4B 4OD1H 5TDOA 5K69A 4LU5H 2C9PA 3HZMA 1ZHBB 2YUZA 4HH8A 3G9VA 3PYCA 1BF5A 4HLJA 4ATWA 3BKYH 4N5UA 4MXVF 2BK8A 3QHFL 4IBLT 3HLAB 5LGKA 1MNNA 3W0WD 5CD5D 1FHNA 3L16A 1FFRA 2CDEA 4TNWK 1FNAA 1NCDH 2CJUH 3HS0C 1IB5A 3RX8A 4BINA 4OF0A 3RL2A 5HI4D 3SE4C 2YQBA 3VXRA 3V0HA 4MD0A 5F97E 1QWUA 1MN4A 5IQOA 3W2DH 3EYSH 4NP9A 3SD5A 1E9QB 1F6LL 1R3IL 1VERA 3B3IB 1BZQK 2NY2B 3KYKL 2DYPA 4JGJA 4WZ9A 5E5MA 4EDWL 5ID1B 3NQKA 4JZNA 4BEIA 4YXHH 1INQA 4DQOH 2JVUA 2MNWA 1ZK9A 2H8PA 2YD0A 3AWGA 3JYBA 3AQDA 1WUNT 2HZHA 2BSTA 1TEFA 2MCPL 5IJCC 3MBEA 2BP8B 2A6KB 3WNLA 2DPKA 2XWRA 5IW3A 5CEXA 4MA8H 2NUTB 3UFIA 3UBXG 5IFAH 1GIGH 3FUNA 4R6UA 1DJHA 3BESR 5T5NF 2E74C 3TM6A 1A3RH 5CD5C 1LILA 4YH6A 4K7PX 3U1QA 1M1XA 4Y89A 3O0RL 4FYRA 2PO6A 3MRQA 3EG9A 1OAKH 1G7MB 3BXNB 3LQAC 3ROLB 3B9KB 3MCG1 5CJ8A 1Q38A 3SQRA 6FABH 2QV2A 4KMTL 3DTUB 4YWGH 1IL1A 3QEHA 3WEBA 4E5XA 2IH9A 4X50A 5D2LB 4YHPB 3FRUA 1CDIA 2ATPA 5EA0H 1NAML 2V4LA 3DGGA 3EDEA 2YPVL 5F7KC 3V4PA 2GIXA 5IWLC 3FSZA 3BP6B 1XSIA 3OR7A 4HWZA 1IAIL 5T1LB 4G8GA 3EXJA 4GOSA 1LEIA 1ZHLB 3WUZA 1OP9A 5IBLD 4JKLA 2ZXEB 3EUUA 4PJIF 1QBML 4AEHL 3BAXA 2FO8A 3U4EB 1FVEB 1E8ZA 4HBCL 1TZHB 1U58A 2WQUA 5ACMA 1J0JA 1RUQL 1YEKH 3ARXA 5E08H 1YEJH 3OXSB 3NSFA 1P9MA 4WU5B 3QDJB 1S8DA 2XBDA 3GSOA 1ZDSA 3H85A 3NP4A 4FQ1L 3AC0A 4GBXD 1TSRA 3NA9L 3RBSA 2HMIC 5F8QC 4XNMB 3ZTNH 3ZYOA 4O02B 3H6AA 3CFBA 4LLAA 1QEWA 3KPSA 2FK9A 2XZAH 4GKZA 5HYFA 1SQMA 2DQHH 3O3UN 2LLNA 3QR0A 5KYNA 4TNVF 1D5IH 4FX5A 4JM2F 1D5XB 1NCJA 4KOBA 1GCYA 4YHLH 1JGDA 1EHLH 4P5TC 1TKWB 3HG2A 4L3CA 5F9JB 3CXHK 1A9EB 1RZIA 1RSYA 4JKKA 4H2CA 1SXSA 2XZQH 1YPZA 1AQHA 5FV1L 1CICD 2W60A 4GSQA 4NERA 4QRUA 4WUUD 2RAMA 3RWCB 3U4BH 3LQAH 4N26A 4XGZA 1I85A 1D7FA 4B60A 2A99A 3VFPB 5IBLC 1S7UB 3KPNA 3O3EB 3ZJAA 3ULSA 4ZTPH 4OT1L 4XPFH 4HHAA 4JFHD 1BVKB 4JANB 3VW3H 1TF4A 2QBWA 1CFMA 2VH5H 2BJMH 4I0CC 2O5XH 3P4OB 2OP4H 3ROOB 4GBXC 4UZGA 5E9NA 2UWEF 2CBQA 1UVQA 3CUPB 5DVMA 2FRGP 1NFDE 4ISVB 4FS0A 1LP9E 1P7KB 2GJ6D 4MXWH 5CUSL 2E4TA 5IG7B 4YIQA 1PBYA 1E2WA 3FO0H 1JZ4A 1P1ZA 3FFDA 4GAFB 1G7QB 2K0RA 4D9RE 1S7RB 3COOA 1OP3H 2AQ1A 4XTRC 1UGKA 4Y16D 1XH3A 2X4OB 3MLUH 4Y9EA 4B9ZA 4M6NH 1FF5A </