3HBQA

Structure of recombinant chicken liver sulfite oxidase mutant cys 185 ala
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
373
structure length
373
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQAAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDYKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulphite oxide
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
source organism Gallus gallus
total genus 99
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbqA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbqA01
2XTSA 3R19A 1OGPA 3HBQA 3HBPA 2C9XA 2BLFA 2A9BA 2A99A 2A9AA 2A9DA 2BIHA 3HBGA 2A9CA 1XDYA 2BPBA 3HC2A 4PW3A 2CA3A 1XDQA 1SOXA 2CA4A 2BIIA 3R18A 4PW9A
chains in the Genus database with same CATH superfamily
4LT7A 1IEBA 2F2HA 4AM0Q 3LYRA 1K8DA 4NN7B 4FC3E 1V3JA 4UMGA 3KDMB 1P7HL 3FT3B 2VMFA 2C9XA 4A38A 2JI1A 3FL7A 3HI1B 2D3VA 2P43B 2XWBA 5FKPB 1I4FB 2NYKA 4JJOA 2KL6A 2XA3A 3HMWL 1NFIA 1JGEB 3T2OA 3MLZH 3X3FL 2NMSA 4CC4A 4U1MA 4RWYL 2BVYA 3VD2A 1FFTB 5L9DL 3H53A 1BEYH 5I0YA 3AY4A 4A1RA 5HHME 1U8HB 1MLBB 5LJYH 1PAMA 1L3WA 3LHPH 3HG1E 4AW7A 4XNMB 2VLRE 2ZWKA 3HUJF 2NTFA 1DVFC 1RUQL 4U31A 1GSKA 4PB0H 4F15B 1FRGL 2VDNB 1OCWL 4LESA 4L1BA 1KJ3H 2NNRA 2UY7B 4WIQA 5E0QA 5D96C 1UT9A 3S8FB 4B9PA 2OXGB 1IBBA 3MGOB 5D1XA 1ZHLA 1MQKL 3CDYA 5DUPH 3WE1A 2Z8WC 1XD1A 5ADPH 2CUIA 2X9ZA 3HI5H 1JZFA 1EZVX 4ZOAA 1L6PA 5DRWA 3LZNA 5D2NC 4WGVB 1M6OB 4FQCL 4PJXF 4R0LB 1H6FA 2DWTA 4GT0A 1RIHH 5LG1A 4WWKB 1WYJA 3U7YL 5F8RC 3HC0B 5KVGL 3EKCA 2WYIA 4TSCH 4W4OC 5IHZA 3BT2L 4IGBD 5HDWA 1LHZA 3S35X 3QWQB 3HS0A 2P5EA 3FQ4A 4HOWA 3QEQD 4BJLA 4G8IA 2Z1PA 4TLSA 1E9OB 3ESMA 3DIFB 3EDDA 3DK0A 5I6XC 4NJAH 2EIDA 1VHPA 3HEIB 5GS1C 1C8PA 1MAKA 4GAYA 1B4RA 4FHJA 4CGTA 1HESA 4J6RL 4UTAH 4PLKD 4XB8A 3B56A 5HTSA 1MVFA 3V0WH 1HINL 1KLUA 3KYNA 1UT2A 4UAOC 5D1XE 4YZWA 1MJJB 4L4TA 3DMMC 3L3OB 2IADB 4M6MH 3QIWD 3WFBH 1N59B 1IM3B 1NGYB 4I2XB 1PNDA 4XMLH 1JL8A 3IAQA 4CSTA 1K8IA 5AOLA 3V2AR 5E4EC 1PZ3A 4WO4D 3OAUH 4NP4H 3FTGB 2QSVA 4ZBJA 4KROD 1CFSA 1ZLUK 5L0QC 3UL4A 1WDAA 2YUZA 1U91A 1KGJA 1OD7A 2AJZB 3H4HA 4B5ZA 2VR8A 2HG5B 2P5EE 4MD0A 1HC1A 4UT9A 5JQHC 4WFFE 3JV4B 1H3XA 4IRZL 3GRWL 1AD0A 4G5ZH 3EYVA 3RX9A 3ULVE 1FL6A 1IC0A 1P5VB 3C08L 4FMFA 1KCWA 1OV8A 2VSDA 1HHHB 1T89C 1MAMH 2JE8A 2DBLL 5KSAB 5IR1B 4G8GD 4L4TE 5FUZL 3BW9A 4QRAA 4UDTB 4UQEA 1A65A 5AVWB 3KJ4C 5ADOH 3S37L 5LXVA 3C87A 3GKWL 4KZDH 4JFPA 5TQ0H 5C6TL 1ZA3A 5I1KL 1GZPA 2F74B 1JPGA 3SYCA 3ISRA 3QG6A 2QDWA 2Z35A 2XG5B 1KGWA 4LXFA 4YSUA 3UABA 5KVEH 2PYFB 2ZOTA 4PJCA 2NY2D 3ZVVA 4BZ2H 4JDVB 3IWVA 2W1NA 1X5FA 1ZDQA 5E00A 2AHIA 3PGFH 5D7SL 5HJGA 3MCG1 4DVBB 3LQAL 4MASA 4XOAA 3QQDA 5E94A 4ZD3L 3OZ9H 1J0IA 4XH2B 2EIEA 4Z3GA 5I16B 3JBG7 4K8RC 2E7HA 4NAJA 1N0LB 1N5AA 5FHBH 5JUEH 3AABA 3BX7C 2X9XA 3FQUA 1FNEA 3BGAA 3N43B 4PJEF 5IF0B 2XA8H 4GW4A 4AIZB 2E8YA 4E5XG 1EXHA 3OPZL 4MD4B 3G04A 2NXYC 5FYJE 5J3HD 3UBHA 1INEL 4Q7DA 1W15A 2Q7YB 1VZGA 3SGKC 3GSVA 3QZWG 1T4KB 3GIZH 1OGAA 4PJ8D 4Z76A 1ZIAA 2X2HA 1C5BL 1RERA 3HE7A 3JVFC 3KH4A 4NN5C 2VDLB 1J8RA 4PJCE 3TONA 1MCSA 5E7FA 5H94A 3ZUCA 5F6IB 3UDWC 3ZYJA 5I75B 1GGCH 2MPAL 4JRXA 2E9WA 1X5ZA 1KLGB 2XKNA 5DVKA 5T3XL 4LPCA 3ARSA 1CLOH 2DI9A 3KWWB 2HMIC 3G6JA 4DP6X 1JNNL 1SY6L 2P28B 5JOFA 1XF2A 2YC1A 1U8LA 3QI9D 5HYSG 4AQ1B 3IGKA 3LRMA 4WW2A 4ZX4A 3GHBH 1RMFL 3F65A 4ONHA 1P7QA 2D7NA 1Y6NR 5B1BB 5C70A 2ID5A 5H2BA 3RX8A 5I1IL 4G2AA 4FLRA 5D7IF 1YQ2A 3NN8B 2DQIH 3OKMB 4KO7A 1T5WB 3COOA 2P5PA 4K7FA 3K3QA 2CLVA 1NIFA 4X0NA 1SDYA 4OF0A 5I1LB 2QJDA 3Q8EA 3QULA 1PGRB 4RMBA 3EJYD 1JV5B 2HJLA 2OR7A 5E6SB 1OGAE 1I1AA 4WGWB 4U1GB 3Q8BA 3FO0L 3BDXA 5IQ7L 1G9NC 3NABH 4JAMB 2NY0D 2ADYA 1I9RL 3U46A 4JB9H 3KPOB 2CQVA 5ACZB 2IVFC 4JRXE 4P4RA 4MB3A 2IFGA 4U0RB 4JFEA 4X5PA 4PGJA 4E9LA 1Z5LA 5IHHA 1BG9A 2P3YA 3QDJA 5C0RH 3G6JE 2F19L 4BK8A 5C0FB 2BRQA 1RAMA 1NAKL 4PJ9C 3VACA 4QOKD 5IB1A 2I5YL 1IQDB 2Y6SC 1MOEA 1WBXA 2VXTH 1NGZA 1N7ML 3H42H 5F7DB 3WTWA 3O6MH 3OXRA 3L13A 3LMJL 3L08A 4IU3B 3GK8L 4YDIH 1JFHA 1CBVL 4HLJA 4N8VG 1U3HA 2WLIB 1HU8A 4P46B 4ZFZB 4U1IB 5JHLL 3S2CA 4ORGA 5DEGB 3BN3B 3SE3A 1SYSA 1SLWA 2YLHA 3GM0A 3IGAA 4JY5H 3BD3A 5A40E 3OR6A 3OG6B 4E9QA 3DV6A 3WXVH 1MCEA 5E2TH 1OAQH 3SGDI 3J8F7 3D7PA 4CC4C 3Q2WA 4P9MH 3FU0A 3V0FA 2IAMD 1F86A 3AY4C 3W9EB 3C09C 3PL6A 1S7XA 1OE2A 1R3LA 1B0WA 5AW1B 5SX5K 1KWGA 4G83A 4ECNA 3JWDC 4JFEE 2V2WB 2C3XA 2V17H 4AGNA 1R4XA 4RCAA 3QDJE 1GOHA 1A4JA 2ICCA 3Q8AA 3RDTA 3WXWH 3M8OH 4BFBD 4NZUL 2N3JA 4MKMA 4NHUB 2R0WH 1F11B 1WCBB 2OL3A 4M8VA 3N85L 2DMKA 5DYOA 2MQCA 1SBSL 1JWSB 3CPLA 2BFVH 4K3DL 1E27B 4Z23A 2BC4A 3U1QA 4DKTA 1HAUA 1PZBA 2YD0A 3JV5A 4QRQB 1JZEA 5D1XC 5L6YH 5LGJA 3NAAH 1BD2B 5DK2B 2ZKWA 5DJYA 1CFTA 1MCPH 2UVFA 2FECL 1MIEH 4FLOA 4PJ7F 2WC7A 2ZF8A 2ZTBA 4TUOA 4JKPH 2ZSVB 3FMGL 3KPTA 3ILEA 3FT4A 2HT4D 2FX8L 4KAQL 1NL0H 4FA7B 4WSGA 1FBIL 4U1KA 4EBQL 2Y24A 4RH4A 3HI6L 1RUAH 3GS7A 4ZG1A 3BGFB 3MGTA 4ZTOH 3VB9A 1KBGL 3HS0C 1TITA 2HVJA 4WI0B 4FMKA 5B3SB 3WJLA 3V8OA 4D8PA 2ZUSA 2NY6D 3KPMB 2BZCA 3NIGE 4KO5A 2RAMA 3ULVC 2DJSA 5FGBA 2EUZA 1HXKA 1DLFH 4UTBH 2R29H 3VFUA 2CLZA 3I6KA 2A83B 1CGVA 4J5VA 1JVLA 4HUUB 2ZCLL 3L54A 4FXGC 1V05A 1NDMB 5IVNA 32C2B 1BEYL 1IGYA 3D6GA 5ENWB 2R2HB 3CUPB 3POCA 1MZYA 2CHZA 3IBEA 2R2CA 3QIUB 5FV1L 4YNYB 1UB5B 4Z18A 5JPMB 1E42A 1JV2B 2EDDA 3B34A 2H32B 1CFBA 3BZEB 2YAFA 4X6CF 2XZCH 4LARH 2E7DA 3MBXH 5DJCB 1T1YA 3GGWB 4WGKA 3TYGL 4HXAL 1URIA 4KRMB 3ARRA 4Y9FA 2VDRL 5FO2A 1IZKA 4NO2A 4UQ2B 5ADPL 4FULA 2IMMA 4LIQL 1BPLB 1MJ8H 1XF5B 2QPUA 4Y16A 5IV2A 5D72H 3HI5L 4R5XA 5DXWA 3II2A 3FUJA 3PNWB 4ZX3A 1HS6A 3M1CA 1RV6X 2VDKL 5KBNC 3U0WH 3CAFA 2ZAHA 1RIHL 5IJVA 3IDNB 4PY8I 4DGIL 4UV7H 2GJZB 3CXDH 3BT0A 3MTXA 5GRJH 1EEYA 1GGIL 1NPUA 2JV6A 3FCGA 2V9RA 4TSCL 2DLIA 2VB5A 3RVWC 4GQRA 3FFDB 1SVCP 4UUJB 3EOBB 1JYNA 2EYRA 3A6BH 1W6WA 2XFGB 4DGUA 5EZIH 2NW3A 2FIKA 3QHZH 1YEDA 4ZQKA 4NSKB 2R9HC 4NJAL 3FF8A 3WY1A 1QBAA 2NY1B 2AERT 5AVSB 2JXMB 4UTAL 3U82B 2M8XA 2R4RL 3QZNA 4X9HA 4YHNB 1FN4B 3WU1A 3V0WL 3GTVA 3LKNB 4AGOA 4NYLA 2OMYB 1WIPA 1YNLH 2WVTA 2DI7A 4ODXA 4M6ML 4TRPL 4JFXA 5HYQA 3QPXL 4K7PY 1U8IA 1K85A 1LK2A 1BHGA 4XMLL 2WXRA 1NGWB 2AMUA 2H2SD 4UQ3A 3UJIL 1M42A 1E5BA 1OARL 5IBLC 3D06A 5FIEA 1XGQB 3MV9B 5DHVH 1I3GL 4FQHA 4WHTA 1S7WA 4WWPA 3HLAB 4RWHA 4PIBA 3DJ9A 3DX8B 4BA0A 4LCWA 4I0PB 4MMZA 3VTTA 5J11B 5HHXH 4YN3A 4UCFA 3CHOA 1QLFA 4N22A 4K5MA 3EO9H 1TTAA 5JXAH 4LKCB 1VGKB 5T1LA 3O6FA 2DQDL 3FH7A 3HE7C 1HVXA 4Y4FA 1J11A 3VFTA 2ISDA 5JOPE 4AH2A 3O2DH 2Z7YA 1Y6KR 4HHAA 3TO4A 3OC5A 5B4MC 1E6OL 1RP8A 1WUNT 2GJJA 3KH3A 3PIQB 5ADOL 2V3EA 4H0IA 2IXQB 2XYBA 1LYQA 3JWNH 4OCSL 3QJVB 4EI5A 4CADA 4MQ7B 3MHZA 2NQCA 5C9JB 5KJRH 4WW2C 4V1DD 3OJDA 3SHSA 2GKIA 2FNBA 3LEXB 1OCZB 4OVUA 3TP4A 3REVA 4XBGA 1MAJA 4IM8A 2AJSL 3ZTDC 1IAII 3ECVA 1TVHA 1QLRA 1Z3RA 4XHQA 3D0VB 4LCWE 3S3DB 1TU2A 2EICA 5E1QA 5B1JA 2BLFA 4BIKA 2VITB 3NJKA 3KYMA 4P5MA 4XBEL 3D50A 5AYUL 1I1AC 2OM5A 1GZQB 4QT5A 1IC4H 5JUEL 5JIDA 3DIVA 4AMKH 1IKFL 5I8EB 1RJLB 2CA3A 5BRZD 3CBKB 1ZHKB 3DHUA 2X2IA 4TPRL 1WIOA 3E2HB 2ZCZA 4H4NA 3ZDYB 5E8NA 4NAMA 3GD1C 3RL2B 3S34L 4PQXA 4ODHH 3WD5H 5E1AA 5TQ2H 4APQD 3O11B 1XGPA 3FCUB 3WDHA 4KKNA 1PQZA 2NNFA 2BIPA 3F7VA 2W88A 4GIOA 4AYFA 1QFWM 5D6CA 1CN4A 1EUTA 3O8XA 2WCGA 3U30C 1LE5A 1F4YH 1T0NB 2JIXB 2NXZB 2VDMH 2YHGA 2E3VA 2X42A 3K0WA 3OJVC 5IW3A 1EHKB 1Q9LB 5CKAA 2X7LA 4CMHC 4NUGH 3DVGB 2WHVA 4AKOA 5IOKA 2J1YA 2VR6A 1Z3GL 4HS3B 1CGUA 1U3HC 1GGCL 4KXDA 5D1ZA 5AAWA 3QGVA 5EBLB 2PCYA 5CILH 1OAUH 4NRZB 3VFMB 1NBYB 4ACTA 3MBWA 4UQAA 3EIFA 1GKOA 3KJ6H 4OZIB 2AJYH 4S2SA 1KB5A 5KVDL 5TE7H 4BYHA 3PL6C 4Y4KA 4KMLB 2ENJA 3OXSB 3ARWA 4RA3A 1ZSDA 4HLZG 3DO7A 1DO5A 1WGOA 3ZDZB 3D18A 1OCOB 3HZMB 2DQIL 1C8QA 3SY0A 2WLHA 2LW3A 3RDTC 3D4ZA 2RIKA 2TSBA 4BWUA 5D5MA 5HI4D 4RDBA 5I26A 1ES0B 1ONQA 3MREB 4DUWA 4MZRA 5JA8B 5ICXA 5KYUB 4ILDA 4OFDA 4DVRH 4HUXA 3NABL 2WZ6A 1RP9A 1AXSB 1F4WL 1SDDB 2FEJA 3TGXA 5SX5H 3V4VA 3EH2A 2ZX7A 3EYUH 1INQB 1AOHA 4DNLA 2ZXQA 3S36X 4QYAA 5HGBB 2X4NA 3P30H 1GHFL 4MSWB 4ZFFA 5EA0H 1U41A 2VXTL 1SPDA 1LILA 1KTDA 1SHWA 3C60A 5BQ7A 1TXKA 3FFCB 1F3DH 2BP0A 5E9DA 5E8OA 1I9IH 2XWXA 4PVMA 1GPOL 1F42A 1QFHA 2YRZA 1S3KL 5FGBC 2IJ0C 5F9DC 1S7QB 4ZOBA 5D5ME 1HWHB 4C8XA 3L7EB 5TH2B 1MLCB 3L5WB 5E70A 4DZBA 2XBTA 1BQHA 2W92A 1Z2KA 4JRYA 1CE1H 2F54B 3FB5A 1CICD 2ENYA 3GDBA 1URZA 1B0RB 3LJ3A 3MFFB 4BZ1A 2FD6L 3SQOH 2BNRD 3QA3B 4KK6D 4R2GB 1A1OA 1HKLH 4BFEA 1R5WB 5JNYB 1QBMH 3WXWL 1V3LA 2A9NL 3IPEA 1N6UA 3M8OL 3DBXB 3HJ0A 4IHOA 2VISA 3RPIB 3OWRA 1J5OL 4UIMB 4D9RD 1LO0L 2WLLA 3QS2A 3QUYB 5BZDA 5TK4A 2DQFB 4OM0H 2XXGA 4HIEB 3H9SD 3NAAL 1U8CB 2QLYA 5E9DE 1QATA 5HI3D 4FQIL 2MTPA 4Y16C 5DUML 4C56B 4C59B 5I1EL 1K6QH 1N12A 1T0OA 3DTXA 1WFMA 3I9GH 1NMCB 5T1DH 4O58H 2XQBL 5TGBA 4XO9A 5DK0B 1R3HA 3DROB 3EF7A 1W9XA 1NL0L 1OAYH 3ENEA 4H25A 4YDLC 5CCJA 2QHRH 4NOFA 3VO0A 2X4SA 1FVEB 3E6HA 1R6VA 5I24A 2P47B 1LE9B 4P2QD 3MDJA 1QFPA 4JRYE 2WLZA 3INOA 4OCYL 1UXWB 3AQYA 4Y1AB 1MFUA 2D3JA 5I8CA 1OPGH 3WFHA 3VGDA 4P2RA 1ZVSA 3Q05A 3D85D 2XIBA 5SV4A 1GKEA 5FLVA 2EDWA 2R29L 1R5VA 3LPFA 4OKVB 2R1YB 4XVJH 2B5IB 1FVDB 1E5UI 4I87A 4OJEH 4JZOB 3ZHLA 4WCYH 2Y1ZA 2H2PD 3RAJL 4JDEA 5AG8A 1JERA 1KTRL 2KS0A 2J4WL 3EGSA 1XO8A 4BSVB 3IDYB 1U3YA 3O4OB 4H8QA 5C0JB 4KKAC 5FYKU 2I25N 5I18L 5C6WH 1DBJL 3RHWF 1G7HA 1LO2H 3GLEA 4LARL 4OZFB 4WI3A 4M1GL 2YN3A 4PRPB 5B21A 1AD9B 3PHOA 1KMGA 4LMQI 4PIRF 2OW6A 1NCHA 2MQGA 3EFOB 2ATPB 4I9WD 1VEOA 2DM2A 5HY9A 4NNXA 1XXDC 1ZHNB 3IFPA 1YN6A 3DTUB 4BFGA 4MMZC 4I5BA 1OOWA 4P2RE 4AOFA 3LN4A 5HDQH 2QLVB 5DMGD 3GBEA 3TZVD 3T0BA 3QJZA 3IAGC 2YRLA 3EZJB 3U0WL 3ZSSA 3O6FC 4JY4B 1IAKB 4Y4FC 4TNGA 4OFQA 4QF1A 1WBZB 4MBOA 3VD1A 2H45A 4XWGL 5GJSL 5FW8A 2HZHA 4IOSD 5L88L 5C07B 3ETSA 3QQ9D 5MENB 3GSQB 3WY4A 1KZQA 1SBBA 3ZGIA 5BS0D 1NGPL 5EZIL 5BXFA 3QHZL 4EI5C 4MRBA 4KX9A 1NEUA 1EVTC 3MRCA 3ESVF 5IKCB 1VFAA 3CVHB 3GIVB 2IH3B 5DLML 2AC0A 4HOMA 3QPQD 5F1OB 1KF9B 1YEGH 2E74C 4UNTA 4IRJD 1NMAH 5I15L 1HL9A 1SF3A 5HHNB 5BVJB 5G4OA 1H8SA 3S98A 5KANI 2ZOLA 2JNZA 3ARQA 5B1JC 4AEFA 4NQDA 4HZAA 1O9WA 2OK0L 3D2UB 4MJID 4E42A 5DVOA 3KLLA 4K94H 1UZ8B 4UQIM 1XZ0A 5TDOB 4JO3L 2NY3D 3GT6A 4YC2B 4Y9GA 4R90H 4FLQA 1CYXA 5CGYC 5CN1A 3UGUA 5F1KC 1HYRC 4JLRB 5CUSL 4C4UA 4NQUA 4WW1A 1AY1L 1YUHB 4ZW7A 4OLEA 2JKLA 1TT6A 3DVFA 2EE3A 3WHXB 2BW4A 4B9FA 1NCWH 3LH8A 4RRPG 4PGCB 1JD9A 2XRAL 3PABB 4IKLA 4W9KC 2APXA 4ZFOB 4BH8A 2BSSB 4N1EA 3M7FB 5JXAL 3BZ4A 3TEXA 3SDAC 2WWNA 1A7BA 1QKZH 5EDSA 3WLBB 2ARJA 5A1AA 5LBSH 2R15A 1CGSH 5K9QI 3CSYB 5GGQL 4JO1H 3ARFB 1K5WA 3O2DL 4XPGH 4ATWA 2XV3A 2MKWA 5D1ZC 5AAWC 4TSAH 1UD4A 2QEJA 5T8IA 1L7IH 2WQUA 2WXKA 2HPOA 3LKSB 3U0PA 1HIMH 3G08A 4NQDE 3APCA 5DZAA 3V6BR 2UUDK 3FU6A 3K6FA 3RUGB 4KK8D 5IT2H 1P7KB 2HTKD 3KDMA 4HUKB 3GRGA 3LDBC 1MCWM 4YPGB 5KJRL 4LASH 2YD7A 4Y4KC 1B4JH 1W8OA 2XN9D 3EJQA 2F58L 5FKPA 1I4FA 3PXJA 4ODVH 5HPOA 1KLFB 3L95B 1XDQA 4KKRA 5K9OB 2G5RA 4JFVA 1QO3B 4F1ZA 3SKNB 2N01B 5DEJA 3W0WD 3ULVF 1U8HA 3SGEI 3JWOL 3BWZA 2YZ8A 4P59L 2WXGA 3QW9A 4PR5B 3W56A 4HWBL 3ZU8A 1EHAA 3NJNA 4YS4A 4MMXC 4MA1C 4XNMA 3BZDA 1UD8A 3AFLA 1NIEA 3SO3B 4DUXA 5I0XA 2FX7L 3CNKA 1K4DB 5AW8B 2AMGA 4L05A 4MB4A 3LKOB 2UY7A 5IHZB 4ZYKB 1BXVA 2OXGA 1L7TH 3MGOA 5T5NF 2I85A 3GMQB 2WO4A 3HC3H 4XTRC 2Q7NA 4BZ2A 4XNAA 4FEIA 1F4YL 3BMVA 3ZOAA 5KVMC 1JF1B 3DHPA 4IU2B 4YBQC 1DVFD 2AEPL 3C60C 4P3DA 1M6OA 1VFOA 4R0LA 5IOPB 4W9DC 5GS0L 3D0AA 1JGLH 4WWKA 4N25A 4TVPH 3HC0A 3VSVA 3VGAC 1MCJA 1KIUB 3QJRB 2XFXB 3AQZA 5B1AB 5I71C 2WN2A 2VKWA 4EO5A 3MXWH 3ZDXF 2EXYC 2VXUL 4LSQH 3T0EB 1EHLH 1DVUA 3FONB 5CILL 1HAWA 4Q56A 1A7PH 2GPZA 3BMWA 4UILL 3S48A 1E9OA 2WLJA 3DIFA 5AYQA 1G9HA 1JTPA 5D71L 1BWWA 3RX7A 1GA2A 3BZFB 1E2WA 3AXIA 3EBHA 2PF6A 3HLKA 3S4SB 3VGFA 3QJOA 4DPAX 2A1WH 2IO5A 2KLRA 3GQFA 4AL8H 3F8UB 1C12B 1MJJA 1J9TA 4X4ZA 5L7XH 1VEPA 3L3OA 2IADA 2ZWYA 3L3JB 1KTBA 1N59A 5F2FA 1IM3A 3ULUF 1V7MH 3L45A 2PKDA 4MAUH 4JY6B 3RPBA 2J1KA 1SHMA 4PJCF 1ACYH 1UWEL 5HHVH 1IBYA 4JE4B 2ZUVA 4DVRL 2AXHA 3PGCB 3FTGA 4KUCF 4WWOA 3ATDA 2BP3A 3F58L 4XNZB 2AJZA 2FSDA 2J3SA 2AFNA 1KTLB 2C9VA 3DMMD 4DT2A 3UJTH 4FAAB 3FB6A 3GBMH 2HG5A 3P30L 5J8OA 1GGTA 3JV4A 3NJXA 4JKLA 3OLDA 1TFPA 5J13C 4OGXL 5IW1B 5EA0L 1G7QB 3KXFB 4RZCB 4YLBA 3X1NA 2J6EH 2W91A 3NFNA 4AYBA 3ATBA 1P5VA 5F0LB 1ZLSH 1BSIA 3UTPE 1J0YA 2B15A 5IR1A 3DX4A 3V52H 3WAJA 5IK3B 4FNUA 3U4BH 3FU3A 4OTXH 1LO5B 3CMGA 4UDTA 2P46B 3ZIMA 3LEYH 1PLBA 2AGJH 1GYUA 3L81A 5I1HH 3S35L 3US0A 1N26A 2F74A 4ZMWA 4POUB 5DWUH 2EDTA 2BSEA 2KLSA 2XG5A 3VXMB 1YEWA 3QO0A 3SOTA 4LFHG 2PYFA 4PTUB 4UZUA 1UVQB 4JDVA 1AQKH 2O5YL 2O26U 1I85A 3G6JF 3PP3K 4XC3H 5H37H 1UXLA 3TFBA 2ZCKL 3WTYA 4PREB 3D9AL 5L4FA 1C08B 4MZIA 4TLTA 3SE9H 3CN2A 2CD0A 3DI2B 1MW2A 1TLMA 3C6LB 4DVBA 3KDPB 3N91A 4XP5L 1ETJA 3LNHA 1TTCA 4XH2A 4HFWB 5AAMA 4HD9A 4F93B 5I16A 3LN5A 3MA7A 1FO0H 4FMVA 1N0LA 3T04D 2WSPA 3WN5B 5F7BA 1ADQH 5IF0A 1G6RL 5T1DL 4O58L 1D9KB 4AIZA 5JPNB 1DP0A 4QXVA 1F18A 4MD4A 2WAHA 3GNMH 2X89D 4NKIL 1MFEH 5DK3A 1PJWA 1XQ4A 1WS8A 2Q7YA 2OZ4L 4N2OA 1CDGA 1DTUA 1E90A 1X6NA 3IAPA 2ZUTA 1ZGLA 1H19A 4K8RD 2D3LA 2BHUA 2XY2A 1T4KA 4S1SH 4J1UB 3Q44A 5AB1A 5IROA 3CFMA 2IAND 3BWUC 4QXUH 4AKQA 1DQLH 1M7IA 2NXYD 2OR8A 3CFBB 1F90H 3D25B 3K46A 3GC3A 3MV11 1KLGA 4PP1C 3B2VH 2D0HA 3ZLQC 3GBNL 3K0YA 5CCGE 4AQ1A 1T2QH 1JUFB 3ARGB 3TEYA 2DKMA 1DQMH 1CI5A 2X44D 1DR9A 2ROXA 3AAZB 4TL5A 4N0UB 3GMLB 3SDXB 3O3BB 1J86A 4LRNL 4LZKA 5C0AD 4YX2H 3EUUA 4J3WA 3HNVH 1I9EA 4FFYA 3WUWB 1FZMB 2VQUA 4A55A 2APBA 4OBSA 3QZMA 4WI5A 3NN8A 1NAMB 3OKMA 3P0VL 2GYSA 4RFNC 3QUMB 4FYSA 2A9ML 4AQAA 4GH7B 5I1LA 1TKWB 2G0KA 3UERA 3T3MB 1JV5A 3FT9A 1N8ZB 3H3BC 4M5SA 4EEEA 4PY7B 1CLYH 3FQNB 4JAMA 5HDQL 2YEZB 4BKLA 1JPTH 2ZPKH 1YSOA 5ACZA 3PP4H 4W9GC 2WCPA 2CRYA 4D0DB 4MAYB 3TEZA 5ESAB 1PS3A 3BLKA 3BKYL 2PPFA 5C0FA 3FUEA 1BP3B 3FN3A 1S9YB 3V6OC 1IC1A 3W1ZA 2C9QA 4YGVB 2VXQL 3TNNB 2ZWSA 3BYYA 3MV8B 3RYMA 2CHXA 5F7DA 1IRAY 2XICA 3A4FA 3PJNA 4YXLH 5HHMD 1BVKB 1VF5C 4GSUA 1CIDA 2O4EA 2I07B 4LEXH 4CL7A 4M4RB 3U48A 4UV4L 4NN7C 5FO7A 3MJ9L 4L9LB 2WLIA 2CALA 3HG1D 4P46A 2VLRD 4U1IA 4ZFZA 1OKEA 2DQGH 1J8KA 2F15A 4OQTL 3WNIA 4PJ9D 1PD6A 1BGXL 2Y6SD 2XN2A 2J5WA 2EDHA 2EXSA 2VQTA 3K6IA 5BMFH 1RULH 1HSBB 3BSZH 3LPOA 3KLSA 4PM1A 3QO1B 1FIGH 2KC0A 5ALCH 4C83B 3QQ4B 4YSSA 3E3QE 1U92B 3RZCA 1BAWA 4TQ8A 1B4LA 2UUDH 4MWFB 3MLYL 4YE0A 2MH4A 5AG9A 4K94L 2OBGA 4AC2A 1IFGA 2GVYA 2ZG2A 3TWCL 2PTUA 2Y25A 2P8PB 3BAKA 3K5RA 2EKSB 4F15C 1NLBL 1F11A 1WCBA 4RRPM 1KPRA 1CR9H 1AZCA 1BXAA 4QRQA 2A4CA 5DK2A 3BPOC 1CURA 4UT6A 2N0MA 1QSFB 1UA6H 5B22A 1NUFA 3V7AG 3ARXA 4PD4J 5ABAA 5CGBA 4J2QA 4NRYA 3DDGA 3EH1A 2ZSVA 3LQZB 3P2TA 4R0LC 3DYMA 3NCWA 4WWKC 4V11A 3BFQG 4OCLC 2CDFB 1VSCA 1G7PB 3AXLA 5D1XD 3BDBA 3L3GA 2ITEA 5EMYA 2WQXA 1HIML 5KS9B 4WI0A 4XNQB 4UINH 3RP1A 4FKKA 4TNVK 2VDRB 1YVLA 1G1KA 2XETA 3AREB 5IT2L 4HEMA 3KPMA 4G6JL 3VI4E 4QHUB 1NMBL 5ALBL 3RY4A 3WFEL 1MXGA 3CSGA 2A83A 4YDKL 4DGYL 1ZPUA 4HUUA 3M7OA 3MOBH 1CXHA 4G6AC 3RU8L 4HWUA 2P5ED 1NDMA 32C2A 1G6VK 3FUMA 4KHXH 3L3OC 1AH1A 5ENWA 1WFOA 3A6CL 4JQXA 3CUPA 1PNCA 2XT1B 4Z7QB 1JRHL 1HL8A 5JPMA 1T5KA 3QIUA 3PAZA 1QFWI 1UB5A 4YNYA 3ULVD 1JV2A 2Y6TE 1RZ8B 5ABZA 2MRYA 2H32A 4Q74A 3BZEA 2R2EB 4XN5A 3S5LB 2WBXA 3VJ6B 4CKQA 4KTGA 5DJCA 4I85A 3CXFA 2RD0A 1I8KB 3GGWA 2VN6A 1WA0X 1UM6L 2DTSA 4KGLA 4L4TD 1L7TL 3HC3L 4UQ2A 4JRLA 4P57A 1XF5A 1BFVL 3VM7A 4HEME 2WN3A 3P3TA 3PNWA 5D6DA 4N85A 3TM6A 2A74B 4KQ3L 4G9FB 3MRQB 4Z3TA 4X80H 1JGLL 2AANA 3IDNA 2GJZA 4WSJA 4TVPL 4FFWC 5KSAC 4GMTH 4HCIA 3W3BA 3V4UH 2P9RA 3FFDA 1EHLL 4UUJA 4JM4L 4DKEH 1PZSA 1F45A 3EOBA 3KL5A 4F9LA 1SEQH 4N3UA 4EUPH 4NSKA 5DHDA 3GSOB 4BFKA 1TO5A 3H6AA 2BY1A 5IVZB 1GMIA 2JXMA 2W0FB 3N0AA 1SXAA 1EZLA 3RVWD 1G0XA 1I85C 1LK3H 1UH2A 2A1WL 5FV2A 2ZUUA 4CKVX 3LKNA 5FYJD 3KS0J 1JZ5A 4WY7H 3OZLA 1J12A 1XGUB 2Z4TA 5FC9A 4N90D 3MLXH 2R9HD 3CZGA 1S78C 4XR8C 1AJ7H 5LKNA 3L1OH 2ENQA 2E5EA 3O41B 5AAMC 3GMMB 5JIPA 1ASOA 4AEHH 5J6HB 4XO8A 5LAPA 1I8AA 4ZUUB 4K15A 1XGQA 2Q76B 3MV9A 4KUCD 4FCHA 1UGKA 3PP3H 5TE6H 3RWDA 3V5HB 2NY7H 3BYTA 3GBML 3KCPB 4X7FC 3HLAA 5EZJA 3DX8A 1X5YA 5K9KB 5CCKH 4JM2A 4Z7NB 5AVXB 1NCJA 2X70B 4L29B 1FPTH 3UTQB 2VL4A 2G2RB 3O2WL 4HHWA 4MAZA 3CN1A 3OVUB 5AQ0A 3ZPDA 1SUJA 3SKOB 4LKCA 5F7EH 1ZLSL 1VGKA 3RWJB 5IROC 5IBLD 1HWGB 4PRHB 4FHKA 5AENA 4R83A 3A6OA 3HE6B 5JIHA 2DOCA 4JFFB 1I7ZB 5F6IC 3T1FB 1JZ2A 4BQ6A 5PAZA 5I75C 3U4BL 2MJWA 5C09A 4YDVB 3H6JA 2YRBA 3PIQA 1RPKA 2YA0A 2IXQA 2OCCB 3ZYOA 1OGAD 1E43A 1KB9J 4AQ1C 1T04B 3HE7D 1FUNA 1QP1A 1ZE3C 5C9JA 2XHNA 3LEXA 1BZ7B 3O0LA 2XPZA 1EXGA 3MV9E 4JRXD 1X5IA 2EDMA 5B4MD 1P1ZA 3QFJA 1J0JA 3PYCA 1MHCB 4QIRA 1AMYA 4HQQH 5ICYB 2EDKA 1B88A 3D0VA 1GS8A 1P4UA 3Q43A 5DMJB 5FA3B 4RLDA 1IGJB 5HHPB 2QQLH 3NIDB 1T1XA 2VITA 4WHYH 1HFUA 2XLLA 3L4ZA 2JVUA 2WJ5A 1VCAA 4TSBL 1EMTH 1I3UA 1GZQA 1P7QD 1TVDA 3E3QC 3LKRB 4S0TD 4U1GC 2HT3D 5I9QB 4AEEA 2Q86B 5E56A 1RJLA 5I8EA 3UEZA 5DHEA 3C5SB 3MUGB 1OO2A 5C09E 4HJ0C 4U0RC 3RL2A 5D5MF 1A6VH 3N04A 1WWBX 1MFEL 4IS6B 1LP9A 5EU3A 3QJXA 1UM4H 2QV2A 4M61B 5FOBB 3ILDA 4JW3A 5B38G 1M05B 1UATA 3MTRA 1I1AD 1T0NA 1GIGL 2JIXA 5FECB 5IBUB 1K3IA 3G6AB 4GB9A 1BV8A 2C3VB 1D5ZA 4KZ0A 4YVNA 4ERSH 3GBLA 3DVGA 1KYAA 2UWEF 1QTSA 1RU9L 3PU7A 4QXUL 3QFJE 4JFED 4HS3A 2E6QA 4DERA 3NQKA 4P46C 3QDJD 5A2BA 4LBAA 4ODSL 4LF3B 4EMZA 1XR8A 4ZRGA 3ZE1B 5EBLA 4G6MH 2K6ZA 4NRZA 3DGGA 1KENL 1OAZL 1NBYA 3HRPA 5DURB 3VFMA 2WYHA 1XBRA 4HAKA 4FXLA 1UASA 4Z3HA 1YHPA 1C16A 2ICWA 3KBHE 5IMKB 4OZIA 5BQDA 5HGGS 3K7UA 3L4CA 4H8WH 1OSPL 3SDDB 3OXSA 1U3HD 1TO4A 4QRPA 4I8DA 3ZDYE 3HNVL 1OALA 1X7TA 3NJLA 4KRPD 4N9GB 1BYNA 3HZMA 3NJHA 2KZKA 3ECWA 3ARUA 1LP9E 3BFWA 5EULV 1AHWB 1AXIB 3IMSA 1KPUB 5EWIH 2ZNXA 4NQXB 5SWSB 3H1ZA 5GJTL 3U0TB 2P1YA 1ES0A 2YPVH 1NLDL 2Z8SA 3MREA 3T5WA 3PL6D 2Z91A 3TV3H 3HKFA 5IJDC 3HOGA 2PMZA 4HA1A 3T2PA 1AXSA 1QSZA 2QMJA 1Z0NA 3LNIA 4IBLT 3RDTD 3KAAA 2PTVA 3SJVB 2VXSL 3BIAX 4Q9QL 3AU1B 3RA7L 1URLA 4PWJA 4KZEH 3QEGH 4URKA 4ZODA 1JNJA 5IP4A 4OZIE 3BGFC 1M57B 4GXVL 3FFCA 4LEXL 3EHBB 5F3HB 2VGLM 4QRPE 2KUTA 3CTTA 3ML9A 4WZ9A 2LLNA 1KT2B 5F96H 4F80A 3ZDZE 2CU9A 2PPCA 2DQGL 4XNUH 3KGSA 4LSRL 4XOCA 1EDHA 4Q0XH 1J9CT 5KW9H 3V0AC 5EEVA 1R34A 3BSZL 3NIFB 2B2XL 3L7EA 1FIGL 1DBKH 4FL4B 1MLCA 3L5WA 3KLQA 4PS4L 4OLZL 5J6SA 5JTWA 5T1MB 3KR3L 2F1AA 1A4KB 3FO9B 4QEGA 1X4ZA 3WEBA 1A3RL 1UD3A 2F54A 4JQXC 3CPUA 1B0RA 2IF7A 3QIUC 3VXUB 5JPMC 4MCYB 3QA3A 1IFHL 5FKAA 1R5WA 3PAUA 3N1FC 5JNYA 5AFAA 3RPIA 1YY8A 3DBXA 5ICZB 3QUYA 4FGMA 4OGYL 5I5IA 3HN8A 2DQFA 4PI2A 4R97C 1AGDB 4HIEA 1QRKA 3FFCE 2UV3A 1YNTB 2A73B 1U8CA 1AGFB 3RNKB 3TEUA 3WNLA 1UZGA 2X0VA 2BVPB 1A7QH 2VDOH 4AZUA 4JZJB 2HWZL 2G5BB 4NQCB 5DK0A 2YLKA 3DROA 4DPCX 3DVNB 1E3FA 4JEGB 4GI9A 1FVEA 4N6QA 3S36L 3BXNB 3NFSH 1LE9A 5AB9A 1WAPA 4U4IA 4F58L 3C8KB 4ODTH 4D3CL 1EHNA 1MJUL 4MKTA 2F54E 4Y16D 1ECYA 1UXWA 1GGUA 4WLCA 4Y1AA 2IOMA 1R5IB 2IH1B 4PTTB 4F9LC 1TYJA 5DJ2B 2MOGA 3U1SH 2K78A 1O6TA 3NCBB 5E5MB 3V55A 2NY1C 4JANB 2C4FU 4BUQA 3MLUH 4YUEL 2O6EA 3BUDA 4OKVA 2KZWA 4LLQA 1FVDA 1NWOA 4JZOA 4KWUA 3W38A 2FE0A 3BWUF 3ECBB 1DANT 1FHGA 2ARWA 1OP3K 4N9OB 3WIAA 1KXVA 4BSVA 4PVLA 1P9MA 4OLYL 1JCVA 5C0JA 1IJNA 3WNMA 3QUGA 4OCWH 3B7UX 1PY0A 2EIMB 4OZFA 5FCUH 5JOPD 3MLSH 4PRPA 2WXMA 4AG4H 3L4YA 3UZVB 3ZT7A 2EYTA 2ED7A 3WMSA 3HTLX 5C6PB 4H8UA 4FCAA 4Y1AE 2EH7H 2G9KA 1P5UA 4JM2C 2K1MA 4KKAD 3K2UH 4HBCL 5GGVL 5J11C 1DO6A 3CC1A 3T1WA 4JY4A 5IFAL 1GMEA 4BM7A 2K3HA 2H3NB 2PTTB 3NSYA 1WBZA 1XSJA 3MODH 4OLVL 5BW7A 4N0YH 5EN2B 3GSWB 1U8KB 1QPPA 4LCWD 5C07A 5JHDB 5MENA 3G6DL 3AM8A 2FH8A 1UWGH 2DQMA 4FI6A 4DEPB 4KHTL 5AVZB 5T1LD 3O6FD 4Y4FD 4JFOA 5IKCA 3CVHA 2Q5BA 3GIVA 2IH3A 2ZXDA 5K33A 3FSOA 4PRPE 3T3PE 4S0SD 3T0AA 4PAZA 1RZJL 2ZKMX 1TZAA 2PO6B 3FRPB 1B2WL 1LK3L 2EZ0C 3TO4D 4V33A 3ZKXB 1KC5L 2VN3A 5DD1L 3H4FA 1J9SA 3BZ5A 3ZGHA 5BVJA 5HHNA 3I02B 4PWFA 4UOQA 1UZ6E 4FLHA 4GNKB 4EI5D 3HAEG 3MLXL 1AQHA 2B4CL 5B3JF 1AJ7L 4BQ9A 3TX4A 1YECH 3WSQH 4NI6A 2Q6WB 5EU6E 1CDCA 4Y19D 1NCCH 3ZBMA 1F1GA 4GP5B 1EXUA 5TDOA 5CEZL 3INUL 1TETH 1W72H 3V0EA 1TZIB 5J9PB 5T3ZE 2JB6B 2OFQA 4L1HA 3E2HC 3AGWA 3O4LB 1UJ3B 4JLRA 1A0QH 2X4PB 5TE6L 3VTAA 1SQMA 1ZT4B 5C07E 3F7KA 4PHZA 1GCFA 1ANUA 4Z7OB 4CRPA 5MENE 3WHXA 1BZ9B 3WGUB 3PABA 4OUUB 2NXZC 2FJGA 3HFML 3QJHB 2BSSA 2LAAA 3GSUB 2EH8L 3L4TA 2ZXAA 3P11H 4HIIA 4GLRH 3WLBA 5CGYD 2GQHA 1GC1C 3K91A 3CSYA 1U8NB 4EOWH 2QT6A 3ARFA 3I84A 3GINA 3VYNA 3FW6A 3KZ8A 3FRUB 3O8XD 1A3LH 5GRWA 4KKLC 1I3VA 2FATH 5TJWK 3RUGA 3U4EB 2CO6B 1P7KA 3IMUA 4YPGA 4JGNA 4LVOB 2DQCL 2BS9A 1R47A 2EDJA 5D1ZD 1VZIA 4U49A 2J6EA 1KLFA 3L95A 4Z1PA 4EDWH 4HQQL 5K9OA 2E86A 3ALPA 4HP5A 4OT1L 3RTLA 1QO3A 5HDOA 2YPLB 3SKNA 3C12A 3QHFH 3MA9H 4KRLB 2Q8BH 3GB7B 3S3SA 1FA4A 3AC0A 3DKHA 4BK4A 4PR5A 4X0KB 4EQ2A 1EMTL 4JG1H 4M43H 5TPWL 3DURB 3EDJA 4Y4KD 4UT7L 43CAA 1OTUC 3VXTB 1FE8H 5IW6B 3LKQB 2LABA 3B83A 2FRGP 5BCAA 3BUYB 1I7UA 2L3BA 3LKOA 2P8MB 3GPSA 2XWZA 1FC1A 4HIHB 3S0PA 4DTGH 4ZYKA 2XQYK 5ACLA 1X5MA 4JO4L 1NUGA 3GMQA 5TE4H 1PSKH 3P0YH 1VFBA 3RUGE 5H37A 5JDJA 1JF1A 5G2NA 4IU2A 3B2PA 4L8DB 3BWAB 1EK3A 3PHAA 3UBFA 5IOPA 1MWAH 4F20A 2Q10A 3QZOA 3NJVA 3SGDH 4JQVA 2VMJA 2X2YA 1J9RA 3CC5B 2CZNA 2XFXA 2WB7A 1UEYA 4QHPA 2X38A 2YGNA 4F3FB 1DVQA 2CNYA 3QPKA 3LX9A 4HDIB 1EGJH 4XTRD 4ZO9A 5I74B 1XX9C 3FONA 1ADQA 5J1AB 4ZAKA 1YA5A 5L2JB 3C60D 2QZ5A 4AV4A 1QNIA 2G60H 5E9DD 3BZFA 5T1JA 5CZRA 1TQVA 1P0SE 5I0ZA 1PD1A 4WTZA 3S4SA 1H8LA 1OIOA 3OKNB 1DUYB 3DJTA 3VX1A 3QR2A 4UDUB 2EXYD 4HCFA 1LEGB 4R2GC 1IC5H 3QWNA 4ELMB 3QJUB 3RWCB 1W16A 2CGRL 1C12A 4EE2A 2P49B 4MNHB 3RY6A 3L3JA 3QUYC 1EBAA 2A77H 5DDHB 2B3IA 1AI1H 4JY6A 1J8SA 2QVFB 4JRYD 3UAFA 4HOZA 4X6BB 2AJUL 4KFMA 1HNGA 5E6IB 4MMYA 4QHKJ 3PGCA 1OK8A 4ICWA 2X1OA 4OI9A 2V37A 2AK4A 4K9JA 1NMCC 4XP6H 3D4YA 3QRGL 1MFVA 1ZGLP 3QEGL 1U2HA 2YD1A 4UWQB 2QR0B 5IW1A 3MRIB 1G7QA 2CK0H 1XEDA 4YHOL 3B5GA 4G7YL 4RZCA 2EUVA 4M02A 3N43F 3PRZA 1WFUA 2E46A 4ZX5A 2DM3A 2R69L 4MDIA 4WNQB 4W6XB 4OU3A 1QWUA 1RZIB 4YAQB 4Z95H 2Z1KA 3UO1H 2Q2LA 5J6GB 3S88L 3QR0A 5EIQA 5KW9L 1HZKA 2OMVB 4IRSB 3DJSA 1G6RB 1KTCA 2B5IC 1DBKL 2FLBT 3MLVL 1E9PB 1BQKA 2VWEE 1KXVC 4S10A 4FRWA 3VXMA 3IDYC 4P2RD 1P9MC 5IMLA 4OLWH 2AK4E 3O4OC 4OD1H 4TMPA 3WI9A 2Z64C 4K7PX 5A6MA 1J5IA 4PREA 4KDTA 1C08A 3U7WH 5TPWH 3PXLA 1T5XB 2CUAA 4CNIB 3C6LA 1G9MH 4PRBB 4A39A 1NBCA 4HFWA 2CR0A 1OP3H 3FBKA 3CGTA 3HC4H 4HH8A 3WN5A 3HG3A 3S96B 4L3EB 4XMKH 3QAZB 1FV1B 2VDOL 3MNZA 3Q5OA 1D9KA 8CGTA 5JPNA 1PX3A 4NWUH 2O72A 4FQQB 4G6KL 3DSFL 1AKJB 2XXMB 3MKGA 1C1EH 1DQIA 4AVIA 1MCQA 2ZX5A 1M71B 3MUY1 2J73A 3K1KC 3AQXA 5B7EA 3VXME 4X8CA 4J1UA 4PU2A 4IOFC 3AM8C 5HHQA 4CUCA 4HFUH 1SXSA 4OF5A 2WQ8A 3H56A 3WFZA 3MRKB 4F7TB 4MX7B 3LH9A 1IKNA 1LEKB 3D25A 4XCCH 2GBVA 4Y5XA 5C0BB 4JFWA 3RNQB 3LAFA 2CBPA 1OVZA 1A3QA 2OP4H 4QPEA 4ZZKA 1JUFA 3ARGA 3FCBA 4YHPB 4D9LL 3AAZA 2E4FA 3FT2B 4N0UA 1JFQL 3GMLA 4GQPH 2EADA 3O3BA 3RVVC 3SDXA 3WUWG 5J06A 3ZQWA 5J4MA 1JVKA 1D7FA 2W9EH 3H8NA 3VWJB 3D39B 3S7GA 5J7CC 1FZMA 1NEPA 1VENA 4PP1D 5F3BB 1F4XL 1ZHBB 4OCWL 1NAMA 4HYTB 2BSTA 3HBPA 3QUMA 4TNFA 4YC2C 4UM9B 5FK9B 2OMUA 2QGCA 4P5TB 1E4XI 1TKWA 3N1MC 5JHLA 1S4IA 3BP7B 5E1HB 1BJ1H 1FNSH 2G3ZA 1N8ZA 5CIPH 1AG6A 5DVLA 5HYEA 4YO0B 4FN0A 4L8SA 4OCRH 3P4LA 4NQDD 4PY7A 3VI4F 1PU0A 3K2UL 3BLBA 3FQNA 4D0BB 3JUZA 3ZHFA 2Y72A 4D0DA 2WBJB 3IGUA 5DZNA 1I1YB 4MAYA 3CZSA 2XNAB 5ESAA 1M7DB 4BSJA 4UM8B 2GW5A 2WLNA 2AV1B 3ARFC 2GIYA 4M5ZH 1UD6A 1MNUH 3QJSB 2ZKYA 4XP1H 3TNNA 4YGVA 5DEZA 4Q9CA 3MV8A 4XXDB 4N0UE 3SDXE 1UWGL 2NTSP 1BVKA 5CLXA 1V7NH 1PDKB 2I07A 3K8LA 5KOMC 1ZEAL 2AXWA 5KVFH 5IG7B 2NSXA 2YFOA 1J5CA 1PIGA 3KGTA 4L9LA 4XCFH 1CMOA 3IMRA 2OSXA 4J28A 1TCRB 4YR6B 3VE0B 2XI9A 1QG3A 3JTTA 1WEJL 3PWPB 2CO7B 4FNQA 5A2AA 4ZMOA 3T3ME 4PJBA 1M1SA 3F64A 1HSBA 4YSAA 3BLPX 4C83A 5D8JL 4DEUA 4NNYB 5EU4B 1U92A 1JZJA 1PYWB 2JK5A 3C8DA 4M7LT 3VD0A 4EKJA 2BNUB 1YRKA 3CFCH 3HS9A 4MWFA 3L3KB 3JZ7A 1JXJA 5IEKA 3PV7A 2UZXB 1TETL 1W72L 4XGZB 4N2LA 4QHNB 1YYML 4F7EB 4X6FB 4F7MB 2P8PA 3SO3C 2IEPA 2HKHL 4WJKB 3TJHC 2EKSA 3BESR 3MV8E 5JW4N 2DTMH 3OSKA 2DPKA 3MRLB 3B2MA 3EOAB 3KG5A 4K5OA 1DBML 3N44F 1COBA 1QSFA 2IGFH 2YFNA 3A24A 5AOJA 1CF8H 3G9VA 3QNFA 4KJWC 4OFYA 3P11L 2AZUA 1KNOA 2LFEA 3LQZA 5IMOB 4JX0A 1D5RA 3PE9A 1JZHA 4LHUA 4PJBE 4LNVA 4I3GA 3HG4A 4JQVC 2CDFA 3MMEB 1G7PA 1NGQH 3BUPA 1ZLDA 2OA9A 4ZS7H 4M1DH 3T0EC 3DRTA 1A3LL 2DWEB 2ADJA 2FATL 4XNQA 1I8IB 2EYSA 3BH8B 5AWNH 4OF8A 2YQGA 3NTCL 1ZVHA 3AREA 4PV9A 1CFVL 3F12B 1L9PA 2APSA 3Q1EA 4YSDA 5JR1L 4H8HA 4WWKD 2J6WA 4R7NB 2FJHA 1Z66A 1TJIL 3A3YB 4JPVH 2B1HH 3KWVA 1U4FA 1JMXA 2N7SA 2V2XB 4EDWL 1DE4B 2A9CA 3HZ3A 3FC8A 3PAYA 4W6WB 2JI3A 5DEFB 4NCC1 3RY6C 5FPIA 1QSFE 1BFSA 1RK1A 4JCLA 4JG1L 5FS5A 3CLEL 1RZ8A 3MC0A 3S5LG 3DUSB 1H3GA 3UTPD 2ARJQ 1SN0A 2VWEC 2R2EA 1P53A 1JWUB 1U8PB 3KPQA 4M6NL 3QG7H 4XNZC 1I8KA 4G6AD 3KYOB 4KH2A 3Q2VA 3LIZH 4WKZB 1E2VA 3BGMB 3DLQR 5TE4L 1IM3D 2H41A 1MFDL 3OKYA 3MNVB 2EDLA 4A67A 1Z9NA 2Z31B 4P49A 5CLYA 5HXMA 3L7FB 4BFIB 1DL7L 4HWZB 2A74A 4CN4A 3LQAC 5L8KB 3PJSB 1MWAL 2ZWNA 3VI3A 2SODB 4ZMVA 2WMPB 5KOVC 2D31B 4JNXA 2VIRB 3MLWH 1KJ2L 3KNBB 2E7BA 4JM2F 5AW0B 4Y2DB 1L0XA 3BAXA 1BBJB 1EGJL 3FTZA 3TTSA 2AQ2A 1YEFH 5BRPA 2MNUA 4R8WL 3MRBB 4Z7QE 1A9EA 4H1LB 4ONFH 3ALXA 3D33A 2FB4L 3GSOA 4IQHA 4HMEA 5IVZA 4HK3N 1A5FH 4FFWD 4LKXB 1U8MB 4WF7A 2W0FA 1OB0A 3BOVA 5I8OL 1KFAH 3O3DA 2DEXX 1CIUA 3FHAA 1AC6A 3P9MB 4KDTC 5CJQH 4YXKH 2OTWB 1XGUA 3FSZA 3VD3A 5HSFA 3HMXH 3C6LC 5F88B 3OR7B 4GP4B 2BSED 25C8L 3O41A 3H0TB 3GMMA 1B2YA 1GR7A 4LPYA 3RKPA 1P6FA 2E9GA 1XH0A 2VC2B 3MBEB 3VI3E 4LPXA 3WN5C 5J6HA 4U33A 4QKXB 4GY4A 2OZNA 4PJAB 3ZTNH 1AE6H 2K7PA 4ZUUA 4L8BB 2WM0A 2P8LB 4HIXL 5FUCE 2Q76A 3X14A 3V5HA 1BLNB 2A38A 4PFEA 1D9KC 5JPNC 4EN2A 3WNPA 3KE0A 3PFUA 1ZTXH 3KCPA 43C9B 3WKML 2HYMA 4W68A 2VN4A 2ALAA 4QMEA 3FO2B 5K9KA 3SPHA 3CFKA 2EXWC 2X70A 4L29A 4DK5A 5F44A 2FUTA 3UTQA 2KZBA 2G2RA 1E67A 1FF5A 3RWJA 3ZDYF 4A7UA 2G30A 4OJDH 2JMRA 4PRHA 1CE6B 1HCFX 1OAKH 3HE6A 1LP9F 3UO1L 4JFFA 3T1FA 4YHKL 2J1ZA 1IKNC 2RB8A 4LQ1A 5I19L 1PY9A 3R06B 3ZR6A 4YDVA 4R26H 2IWKA 4PRAA 4K23L 2X12A 2O5XL 2TRHA 1MFMA 4IDJH 5B8CB 4NWTH 3RDJA 4KX8A 3ZE0B 4W1TA 3ARGC 1T04A 5IROD 1YPZB 3BH9B 1ZVNA 1X9UA 2EEXA 1P4IL 3S2AA 1VPOH 2Y07H 2O5ZH 5F7FA 1QLEB 3VFVB 5DR5L 3MRFB 4J8RB 2B08A 1DBAL 4MA7H 1DQJB 3OKEB 5EZLB 3RBSA 3CH1B 4Z7AA 1MHCA 4FZ8H 3ABZA 5ICYA 2ICEB 1EJ6A 4Z7NE 5E2VL 1F6AB 3TWYA 1V5JA 5DC2A 1P69B 5HHPA 1UOKA 1QHQA 3OB8A 3U2SB 4HPYL 3GUTB 1EAOA 3H55A 4HCRL 1LMKA 3LKRA 1QW8A 3OTTA 2Y22A 4L8SC 4PRHE 5DZPA 3ZDZF 3HC4L 4H26B 2Q86A 1OHQA 2WUCL 3MYJB 1G7JA 3BSHA 1DJYA 4JFFE 3US1A 1E7VA 3C5SA 3MUGA 4UBDC 5KZCB 2C4XA 1OGSA 1NIDA 5A2CA 4MAYC 3L4WA 4IS6A 1X5HA 4CA4A 5EEXA 4IMLB 4M61A 1XGYH 5FOBA 4BFNA 2J8UB 1M05A 1XV8A 5DS2A 5FECA 3G6AA 2C3VA 1XHHA 2DQUL 2HH0H 5CGMA 1TTUA 3EYSL 1NFKA 1CDBA 5GRXG 4UTCA 3PG2A 2FEDC 2QSQA 4X5RA 2WBWB 4HJ0D 5A16A 2ZP8A 4HETA 5L8JB 4L9LC 1W0YT 1Q0XH 2Z3FA 4LF3A 4XNXH 2UX6A 3E8UL 3BUQA 2VC2H 2DIJA 2WD0A 3NIDE 2F5BL 4KPHL 3WS3B 1ZS2A 3KMDA 3CLWA 3CX5K 4OM1L 4QJ3B 4NM8H 2Y5QA 5IMKA 1OT1A 4TQHA 1IFRA 5LNGA 4GG6A 4KXZI 2FWLB 3AW5A 3SDDA 4NM4H 1YEHH 2J88H 4P46D 2WQAA 3RRQA 1E6JL 1ERNA 2UZYB 3LIUA 4M62L 3SN6N 4O2FB 3B1UA 4N9GA 4FTVB 5I5JA 2O6FA 4NI3A 3MO1A 1AHWA 3B43A 4QRRB 3IDIB 1KPUA 2F7RA 3L3IB 1T22B 4HW6A 3HCVB 5SWSA 1KB3A 4LSSL 4M6AA 1FNSL 3U0TA 35C8H 4KI5E 2C4FT 5EF3A 2P80A 5GGSB 1F3DJ 3RZCD 3UX9B 3DETC 1CXIA 4MZ3A 4PBVC 4RMQA 3SQRA 4A6YB 2VAJA 5EEWA 3VFPB 1JGVH 4M3KB 3IS0X 4MXVE 3ZE1E 3SJVA 3ZHNA 1KIPB 1UACL 3FTUA 5GGRB 4EPSA 3IFLL 4K3GA 5IB2A 4XP1L 5CJXA 2RCSH 5DQJB 1QLEH 2YMXL 1BD2D 1TPXB 5IFHH 1O6SB 4GG6E 2OMWB 5CKGA 5JW4R 4FQJH 4UZSA 2HN7A 5KTEL 1NIBA 3M17B 2WKLA 1D2OA 2P4AB 5KVFL 3WDIA 2ZZUT 1KT2A 3AREC 1IEAB 2WTRB 4AVKA 4YDNA 2NW2B 2IBBA 4G5AA 4JZNA 3UTZB 3IEAA 3SGEH 5SWSE 2BSRB 3DGDA 1J1PH 4GO9A 1RFDL 2WPGA 4RFEB 5IY5B 1A4KA 3FO9A 2XTJB 4D8OA 4BCXA 1XZWA 1F6LL 2F0CA 3CFCL 1M2VB 4N5UA 5J0BA 2M83A 1H5BB 3SKMB 4MCYA 1TENA 3SJVE 5JIIA 3JTSB 1T2XA 4JKKA 2ICWJ 3KBEA 3DX9A 3T8VA 5I1JH 3P2DA 4AGLA 3IFNL 3VW3L 2IWGA 2HKFH 4MTMA 5ICZA 3T0DA 2Q8AH 4YSEA 3PNRB 2WQVA 3MLRH 4D0CB 1AP2B 2GTZB 5TF1L 1J8HB 2VQ4A 1AGDA 4FXKB 1A4CA 1A21A 1YNTA 2A73A 3CQQA 1FZJB 4JFQB 5DFAA 4AV0A 3QIUD 3RNKA 1EX0A 1IBZA 3RVUC 2IGFL 1W8EA 4LSVH 3T3PF 2A74C 1MFBH 4AYEC 2G5BA 4K8RH 1SNRA 3DVNA 4KNUA 3VGEA 3X11B 1D6VL 1FH5H 2Y7MA 1NCGA 3EOTL 3NIFE 4KVNH 5GHWL 3BXNA 4BCZA 2ZG1A 1UZ6F 5FUCC 3ZTCC 1E3XA 1A7OL 2W8CA 4ZS7L 4M1DL 5FM8A 3C8KA 2BP5M 2AAVA 1FGNH 4XX1G 2DWYA 1R5IA 2IH1A 2J56A 2C5DC 4PTTA 2FL5B 5DJ2A 1N18A 1ZAGA 2C8NA 2F5AH 3D05A 1Z6JT 3GSNB 4O2EB 5E5MA 1IGCL 2V7NB 4AJYV 3BO8B 3B5HA 2DQEH 4N2HA 1LGVA 2CJ3A 1QFUH 4IBYA 5LNDA 1INDH 4HF5L 2B1HL 4ONGL 4DHLA 3ECBA 1QEWB 3TCLB 2C26A 3VTMA 2AVFA 3ZK0A 3WLWD 5I8KL 3CCHB 4OZHA 4XP9L 2BVQB 5C0IB 2ODHA 2QQKL 3WHE1 3B6SB 4AIOA 2NY1D 3ZJAA 1DDHA 4DP8X 5C86A 1ZLEA 3LS4H 2H1XA 3B8YA 4GG8B 1RZFL 4K7PH 1WTGT 2AEWA 1NDGB 1ORSA 2OYMA 3KW7A 3UZVA 3NP4A 4KTYA 5C0DA 3LIZL 1DFBL 3FYEB 3NBNA 4P06A 1KV3A 1MZZA 4MDJB 5HGDB 2WGNB 5KSVA 3TS8A 1OF2B 4ZPTB 5AZEL 5G5DB 3TT3H 4RFOH 4GRWB 5DRXB 1BQRA 2K9UA 3BH4A 4GFTB 4F37K 5J5EA 3MV9D 1G9NH 2H3NA 3GMNB 3V4PB 1Q0EA 2E6PA 3HE6C 3TIDB 1H3PL 3WGVB 4YSCA 4XXCA 5EN2A 2ZIDA 3GSWA 4PMFA 1U8KA 3EUDA 5IB5B 3RG1C 3S97C 4CU8A 1JZ8A 4OZHE 4JM2D 5JHDA 3RJOA 1N2RB 3WL9B 3LQMA 4M93B 4ONFL 1F1AA 4TF4A 5CU9A 4E9TA 1NCIA 1CD8A 3EGXB 2ATAA 5DD5H 2FVNA 4QGYA 4LLWB 1OTSC 2L0DA 1DSYA 1R3KA 3FRPA 2PO6A 4KNTA 4WVRA 5C09D 3WIFA 2Y2TA 4YHZH 2IOOA 4G72B 3ZRCC 4IKKA 2DQTL 5CJQL 3I02A 4Y9BA 4H20H 3HMXL 4GP8B 3P3YA 3O3EB 1UXSB 1LQBC 1Q9KB 2C1PB 3JWNG 2Q6WA 1HN1A 1OXYA 2WAQA 3ATEA 1OAXL 2VCOA 3OMNB 3MCKB 4DN4H 4PJHF 5I9QC 1ACZA 2AEIT 5J9PA 1TJHH 1TZIA 5AUMB 2V9UA 2ZKHH 2FDBP 4FXTA 1WPCA 2EZ0D 1AE6L 4QRTB 2JB6A 1BM3H 3QFJD 5A7EA 3UOAB 4J6IA 4GEIA 5TFSH 2X4PA 3JWDH 2PR9A 1QWHA 1ZT4A 5JHDE 1ZTXL 3B3BA 2GY5A 3GSNH 1M9SA 3P73B 4M8QB 2LV4A 1BZ9A 5EIIG 6PCYA 1CDIA 1QVOB 1HYSC 1NEZB 4OUUA 2YARA 5CJOL 4FFZH 3QJHA 2QQNH 3IPFA 3GSUA 4NZTH 4KI5C 1JZ3A 2JJWA 4O9HH 3JV0A 1F8TL 2B1AH 1U8NA 4HWBA 5HHOB 3BIBX 3D12B 5CF3A 1HCVA 1B90A 4XN9A 2C9UA 2FQEA 2LT9A 4Y9CA 4R26L 4XMXA 3FRUA 2EO9A 4WI2A 2NXZD 1XBDA 2JIXD 4NWTL 1JGUH 1WFIA 3U4EA 2CO6A 4YHYB 3FQRA 1P84K 1USZA 5EU7E 3KL3A 4J8QA 3NZ8B 4L5FL 3SDDC 2WZAA 2VNCA 1ID2A 2HJFB 4MA7L 4JGMA 5AZ2L 4GW1B 2FWUA 3VG0L 1A7NL 4Z7OE 2V5TA 2HSIA 2XX1A 4FZ8L 4HXBH 4KKLD 4MXWL 4YWGL 1AHWC 5IQNA 4E5XB 4RDQG 5K1NA 4GI8A 4NENA 1SOQA 2YPLA 3W2DH 2QKIB 4JGUA 1NFDB 1P2CB 5AW5B 4X0KA 3X3GH 4ACPA 1WA1X 1SJEB 3DURA 4ZO8A 3R8QA 5JW5B 3VXTA 5IW6A 3LKQA 1SUHA 3HPLA 4L4VB 3VXPA 3MV7B 1ZS8B 4N3TA 4NKOB 2YAMA 2BMKB 3BUYA 4HIHA 2P8MA 1SM3L 2FTAA 2FJUB 4JPWL 4WK4B 3IDMA 1DSWA 3NJGA 1K5NA 2J20A 1OTUD 1JP5A 5E9AA 4OLXL 2ALWA 1UURA 2DQHL 4L8DA 5GRVK 3BWAA 3SBPA 2AS5M 2Z8VC 2CH8A 4KXAA 4OZGF 3EHBC 4ODWA 4UT9H 5KEZA 4HC1L 2GAZB 3FSAA 5SWZB 1MCOH 3LKPB 5AEAA 3TJPA 2VRKA 1Q0XL 2X1XR 3BAEL 2YPLE 1N5YL 2CA4A 2CKBB 5J1AA 2HJKB 1CI3M 4JFUA 4U0QB 4AQEB 5ES4B 4PUBL 3L9RB 4UIKH 2XWCA 2GHZA 5L2JA 4FL4C 1LD9B 3CVCA 4NM8L 3FFCD 1ZLVK 1A4BA 4X5QA 2HP4A 1OSZB 5BO1H 1X5AA 1GGBL 1XCXA 1CLCA 3UCQA 5FYJH 4R4FL 4GSXA 3N40P 4YE4L 3IN2A 4HS8L 1WJ3A 4U1LB 3OKNA 4G7QB 4LSUL 1YEJH 4UDUA 3LZOA 2Z0BA 1LEGA 4Y5VB 4ELMA 4X6DB 4S1QH 3RWCA 2Q1EA 2PWGA 3QXWA 1BM7A 4MNHA 1BZDA 5DDHA 4P0DA 1RUKH 1TZGH 2XJLA 4LBEB 3NCXA 5TTRA 2DLFH 35C8L 4AMWA 4X6BA 4LNRA 1YQVH 2F54D 4OD2A 2QGBA 5FYKL 5E6IA 2NSQA 2R39A 4X7DC 2WLYA 1KULA 1KELL 2DLEA 2V7HA 1NUDA 1PG7W 1JI1A 2VM4A 5DA0B 3CZFB 5B39A 4N8VB 3QUYD 1G5GA 2AQSA 2VLKB 4RX4A 1T21B 3VFGH 5F6HJ 3QJTB 2QR0A 1WISA 5C8JB 2RCSL 3MRIA 3DECA 3O2VH 4Z7VA 4RESB 3SEPA 4LCYB 2W94A 4XMVA 4PGDB 3T2NL 2BX5A 3GHEL 1BF2A 4ENEC 4YXHH 3HBZA 2C7FA 2CLRB 4G3YH 3SPIA 2FT6A 3EGDB 2MCPH 4WNQA 1RZIA 3BD4A 4YAQA 4HV8A 4ELKB 4Z7UA 4ELME 5J6GA 4N0RA 4TUKH 4J3OG 3RPKA 2BCKB 2OMVA 3MSPA 4IRSA 1UXMA 2GUOB 2Z0UA 3LOWA 1DZBA 1G6RA 3MLPA 3TA4D 2YGPA 5SX4I 1Q1JH 1BMGA 2WZ0A 4JPIB 1E9PA 2H8PB 2FX9L 3X17A 2I9LB 2OZ4A 2N0KA 4Y1AD 5F21B 3RWFA 3UG5A 2R23B 5ICUA 3B9EA 2C1OB 2YR3A 4UU9B 2APFA 1IT9L 5H4ZA 1MUJB 1HZHH 1CU4H 2LHAA 1T5XA 3NDZE 4NNPH 4CNIA 3MLRL 4Z7VE 3QI9B 3AT0A 5KYXA 4AVHA 4FNRA 4Z3EA 4PRBA 4IBSA 3NP3A 3RWHB 3F62A 3LS5H 3WE6A 2TSAA 3B8SA 5JW4M 1UB6B 4KKCC 1T0PB 2A9BA 4DWHA 4LB8A 3PV6B 5ID0B 4QCIB 1AMXA 2YQ2A 4Z7UE 2CWRA 2JQZA 2Y9RT 1FV1A 3ZL4L 3VDCA 3QC6X 4LVNB 1M53A 3HZYB 4XPAH 3T3MF 5CD5C 1QX1A 3ME0B 4PRPD 1FH5L 5T5FL 1AKJA 3DX6B 1U33A 4M48L 4KVNL 3BKMH 1T20A 4XXCC 2WNWA 3BKCL 3K2IA 1HDMB 1YN7B 2JKWA 1F00I 4ZTPH 1BAGA 3HJEA 5EF1A 3ILQC 4KFZC 4DEPC 2BVTA 1FNHA 2F5AL 2X4QB 3BCDA 1MDTA 2F7QA 3MRKA 4MX7A 5I6MA 5I6NA 1LEKA 3HRZB 5C0BA 1UJTA 4F33B 5T3ZD 4K3EL 2DQEL 3LRKA 4Y5YB 1QFUL 3DIDA 3TBSB 3IJHB 4HKXB 4HD5A 3RNQA 2ZSWB 4KBPA 2PO6C 3OBAA 5F1NB 3KLHC 3ZKXC 5A2JH 4P3CH 5C07D 5LWYH 3MRJB 5MEND 4F1SA 1DUZB 3FT2A 2RGSA 4FA8A 4U1JB 3VWJA 1DHKA 1BBDL 1CG9B 2MSPA 1KUMA 3UC2A 5F3BA 5T33L 3O0RH 4XPFH 4PJBF 3OMZA 1N4XH 1QNZH 4AJWA 3UYOD 5EU7C 3RWEB 1FFNB 4UM9A 1RIUL 4P5TA 3MJ9A 3VD4A 3BP7A 3L8QA 4GOSA 4RQQA 5DT1H 4OQTA 3PDDA 4N2DA 2K7QA 5JO5B 4ABWA 5HDBB 3RVVD 2AJXH 4YO0A 1IGFH 1IGMH 5I1AA 1ACXA 4NQQA 5DVNA 5LNEA 3S3JA 4D0BA 4D7BA 3R4DA 5DZJA 2GSGB 4JHUA 5C0BE 1WAEA 2HFGH 1I1YA 2GFBA 1HXMB 2IMNA 2XNAA 3JWOC 1M7DA 1MW3A 2AV1A 3DHMA 4XC1H 5IEHB 4ZUTB 4XXDA 3WS6A 4X9YA 3MRPB 4TOYH 1IM9B 3A22A 2V2TB 5DQ9B 1PDKA 2A6IB 1TIUA 1ADWA 2FJFB 4HJTA 4QGTA 5IG7A 2XZQL 5EG6C 2C7UB 4I1PA 2EVGA 4M7LH 3BQUA 4GKNB 3OZKA 4KDWA 1TCRA 4YR6A 3ARFD 4GI6A 2VKXA 4LVOC 4OZ4B 1CFNB 3VE0A 4FNLH 1YEEL 2EIZB 3PWPA 2CO7A 2HFFB 1OAJA 2BIMA 4P23B 4PGBB 5DRZB 3WJMB 2QMKA 4H0LC 3BVNB 5TF0A 1KV7A 4NNYA 5EU4A 3D48R 3WEXB 1PYWA 1Y1DA 1KCSH 2BNUA 1IAOB 4PCYA 3L3KA 5BS0A 1QACA 1THCA 1Z7JA 4FLSA 3ZTJG 1TJHL 2JLLA 3LZLA 4QHNA 2ZKHL 4XGZA 4F7EA 3ABLB 1FLRH 4X6FA 1CUOA 1ZV2A 1BM3L 3MFGB 4I1RA 4I3SL 4OGZA 3JWDL 3F01A 3V0IA 3DOHA 3CD4A 1MHPL 2CPCA 3MRLA 2PPAA 5JIMA 5ISZB 3EOAA 1HI6A 4HUNB 2MCG1 3W39B 1DDTA 2X10A 4A2MA 3A4EA 1Y6MR 1JZIA 3QBTB 5FA4B 2DF3A 1SJVA 4MJIA 4BBWA 5ITBH 2CO4A 5F9AC 5FWRA 1F3JA 3TJHD 5IMOA 3PWPE 2J5LB 3HUJB 4M5YH 1JZDC 4CVXB 1G9MC 4PG9A 3MMEA 1ITCA 3AGVA 1RURH 2VDQL 2Y1YA 2YJQA 5I74C 5HPMB 2QBWA 4JDZB 4Q52A 3BH8A 5BS0E 1A6PA 4WK2B 1M7UA 4KJWD 2GI7A 3VI3F 1PFCA 3N5AA 3F12A 3ZMEA 4FYQA 4XN8A 3TOPA 5HJDA 4PJXB 4R7NA 5KBLA 4U3XA 1I9JL 4KVCH 2DJ4A 2YUVA 4HXBL 2V2XA 3T0ED 4Q9RH 4OV5B 1DE4A 4DKFH 3ULVL 5F7KC 4FYTA 1KJ2B 4N6RB 5DEFA 4ZAKD 1CTNA 4OIBA 4KOBA 1GXEA 4RSVA 1S9KC 1XF1A 2XQ0A 1RUML 1YDPB 1BDYA 1G87A 4P4KA 4MJIE 1ZLVH 3BE1L 3DUSA 1YC8A 5E6IC 3KEDA 5FDYA 1ZT1B 3T4AB 5I5MA 1JWUA 1U8PA 1OCRB 2XWRA 5K39A 2PPEA 2WNGA 1TUPA 2BP8B 4DGVL 1EO5A 3KYOA 5DMYA 4WKZA 3ZKQD 4JRFA 1KEMH 3BGMA 5C0GA 1S9WA 5FCSH 5LN8A 2KMWA 2Y0SA 1G7MB 2VAAB 4YJZL 3MNVA 2WWOA 3L7FA 4YHLH 1H3UA 4BFIA 2F1EA 5EEZA 3OJ2C 5KSBA 4HWZA 3TPKA 4NBZB 3PJSA 4UT9L 3THMH 2WMPA 1WF5A 2AK4D 2D31A 3UP6A 5T1KB 5GRYA 4LLVB 1EDQA 4Y2DA 2Z92A 1G4RA 1SJMA 2YD5A 4IDLA 2AXFB 3IU4L 4OSUL 1BBJA 3BIKB 3U9UB 3VXOB 4IRSC 1VGEH 2X40A 4F5CA 3MRBA 2V9QA 3OG4B 4H1LA 4J3OC 4HMCA 4UIKL 1EEQA 4N2GA 4N8CH 4XMPL 5BO1L 1PCSA 3B9AA 4LKXA 1UADC 1NJ9B 1U8MA 3G7TA 1LO4H 2BVUA 2IALB 5FW7A 3DNKA 2IV9A 2OJ1A 4NUJA 2YK1L 4F2EA 3P9MA 3ULUL 3WENA 4FP8L 2O93L 2OTWA 4LMQE 1TZGL 5F88A 3RBGA 3OR7A 3FN0L 5KSBE 4J3VA 2FGWL 2GI0A 2XV0A 2IG2H 3N55A 4M6OL 2BRRH 3VXMD 4P5RA 1CT8B 4E9RA 4N2IA 4ZFGH 3MBEA 1KYFA 3ESUF 2ICES 4HWNA 1FZOB 3B3IB 4PJAA 2FECI 1DQKA 5ELIA 3H9ZA 5JIQA 4L8BA 2X4UB 4GUQA 1BLNA 4HPOH 4UB0H 3UG3A 43C9A 4LL9A 3C6LD 4F5CE 3OF6A 2H26B 3EDEA 4NUPA 3FO2A 4YFDB 2DD8H 2O30A 4YSTA 4Z0BL 2VXVH 4H5SB 4JN2B 3PFQA 5HJ3B 4A04A 1E4WL 5JYLA 4JG5A 3NCJH 2QGDA 2H4EA 2FUQA 5ERWA 2EO7A 4Y1TA 4YXHL 4L48A 1G9EA 5BRZB 2BWDA 4G3YL 4DPBX 5BUGA 3E9TA 5ID1B 1D9KD 2B0SL 1ZANL 3OQRA 4TNVF 4G8AC 4B9GA 1IGIH 3R06A 3T08A 4QHMB 2ADIA 2DWDB 5E4AA 4KI5F 2K4WA 1KYUA 2GC7C 5B8CA 1Q1JL 2AK1L 1ZA6B 5BO0D 1NBVH 4GO8A 1PPIA 3HZKB 5DF0A 4YEFA 2D9QB 3AG2B 1YPZA 3BH9A 3U1PA 1RLWA 1FL3B 2DLTA 4G7VL 4PJAE 3S3CB 4JQIA 1NCDH 4O5LH 3ZE1F 3IDJA 5DSCB 1A9BB 3VWJC 5EO9B 5C71A 5EOTA 4JFYB 4J8RA 2W5PA 1T66D 5EZLA 2RMNA 3CH1A 3WIHA 2QVMA 4FFVC 1KB5H 1R0AH 2ICEA 4PEEA 5CEYB 1T7VA 4H13C 2Y7QA 4P5TC 1F6AA 2ZWZA 4KUZH 5AW9B 3ARGD 4GG6F 1UYWH 1YZZA 2MCMA 3MJGX 4OF6A 3U2SA 3GUTA 3TF7C 4N2MA 3DX0A 4NZ8A 3HNTL 5CLTA 2ZAIA 4HLZH 4EXKA 5EO0B 3UBGA 4XNDA 3ZUNC 4GBXB 3CSBA 4HUWB 4LEEA 3VA6A 3VH8G 3E6FB 4YPJA 1MNNA 1FNFA 3NCYP 4B97A 3W5NA 2WBJC 4XPAL 1JF5A 1J1XH 5D7IB 2COQA 3U4AA 3VXRB 2X5PA 2X9WA 1LQSR 2F7PA 2RA1A 4IMLA 3BKML 4HIPA 1BQUA 2IPUK 1JHKL 7PCYA 3ZE0E 2J8UA 3V4VH 1C5CL 5FHAL 3EG9B 1YPZE 2E47A 3WS6C 4NO0A 1CC3A 5IHUH 3RZWA 3DJRA 2E59A 2ZUYA 2ZX9A 2JJTC 4UBDD 3TEWA 3UBXI 4IKNA 1BXXA 2W60A 4MAYD 2NUTB 3GYRA 3VAEA 2I24N 2O6DA 4M7KL 3DX7A 4NC0B 1FG2B 1BX2B 1WD8A 1EFXB 1UH4A 5GSVB 3WS3A 3MV8D 2KQNA 2X6UA 1SYVB 1CCZA 4AQOA 4OD3L 1U6AL 1CD1B 1VACB 1HWWA 1CPUA 3KD4A 3E8VA 1XCTB 2A5UA 2FEDD 3NSDA 1BZEA 4KK5C 1U3NA 4RGNB 3FTWA 4A63A 4AW4A 5CSZA 2UZYA 4H2CA 3O0RL 1N4XL 4FTVA 3IETB 3NIFF 1TTFA 1KN4L 4EN3B 1FJ1B 2JF1A 3AWGA 1HX0A 2FLMA 3LY6A 2BDNL 4QRRA 3IDIA 1DFXA 2J8UE 3L3IA 1T22A 4CDHA 3HCVA 1NDTA 3NH7H 1QUNA 2ZX8A 2EACA 1QMUA 3GUFA 4L8CA 4N5EC 3ZHKA 3OB0K 4R5TA 1E5AA 4LLAA 2E4TA 3D2TA 4RMRA 4WO0A 2OL3L 2ZJSL 4A6YA 1IBDA 2BNRB 1PVHA 3FOLB 5HI5C 4QHKI 1X9QA 1LJMA 1KIPA 2D2CC 1DN0B 2BOBB 5GGRA 1MIMH 1RI8A 3IMTA 3E0GA 1YNTF 2A6KB 4AYSA 1WCQA 1EAPB 4N2CA 5DQJA 4QTHB 2A2QT 1V54B 4GSDL 5GISL 3DETD 1O6SA 1QYGH 1O0VA 3AS1A 1U36A 5F97E 4BZYA 1QSFD 3M17A 3MACH 1RJYB 5FW6A 5DFTA 4OFYD 1HT6A 4FTVE 1RZQA 2WTRA 2YGOA 4Z7WA 1YEIH 1NCBH 2GCYB 2NW2A 2X0UA 4LHUD 1EHXA 1I31A 4QRRE 4FNLL 2QZQA 3UTZA 1WHPA 2JQMA 4G80B 1S9XB 3KWUA 3PCYA 3BAWA 4X7EC 1YEKH 4Z5RB 2XBDA 4AY0A 4U6VH 4RFEA 1HQ4B 1YMMB 3T09A 5ILTH 2EDYA 2J12B 1KCSL 2Y7LA 3FUHA 3H3PL 2MTAA 3ARED 1M2VA 2N4IA 3SDYL 5AB2A 1H3TA 3QXUA 1A7RL 2ED8A 1H5BA 4P4KC 4X42A 3SKMA 4YSQA 5BUAA 1PG7X 4KMTL 4E9YA 3STBA 2E27L 1LMIA 1FLRL 5AKVA 2ITFA 4IBTA 1XL6A 1KCVL 2ORBL 2NOYA 3PWNB 4OZHF 4YFLI 3UYRL 2CHNA 2ZF9A 4D0CA 5AD0B 1AP2A 2GTZA 2ZX6A 1HSAB 1SOXA 4OH2A 4U3HA 4KXBA 4FXKA 2HXAA 4JFQA 4O51B 4AUYA 3DSNB 1FZJA 5GRZA 1YAZA 3VSTA 2VDPH 2Z31C 5FF6B 1D3CA 4GMSH 5A6LA 2EVFA 2PCPB 2Y36L 4Z7WE 1CBJA 5KYYB 5ITBL 5DFVC 1MFAH 5A7BA 1X5JA 4G6FB 4LRIA 3ARZA 2OSLB 4LAQL 1E8WA 3X11A 2B8OT 2HCZX 3EDKA 1S8DB 3QCUH 4L37B 4NKDB 4X6CB 2JKNA 4XCEB 5DQDL 2GJPA 1JHLL 1SOSA 4Y2DC 5DC9B 2UZIL 5D1QB 1SEBB 2XTJE 4M8UA 1NKGA 3RVUD 4JFHE 4DFHA 2D0FA 2J55A 3TZVB 2FL5A 2QSTA 2CMRH 3GSNA 4O2EA 2V7NA 4TUUA 3BO8A 2ADFH 1XF4B 1W6LA 4FFZA 2JTDA 3NACL 4BHUI 4PVBA 4OJCA 1KWKA 4DKFL 2Q7AA 1QEWA 4NQEB 3TCLA 1TQUA 3CCHA 4N8UA 2BVQA 5C0IA 4EI0A 1ET7A 5FB8A 5KBPA 3IGFA 3B6SA 1BQLL 2YWYA 5E5LA 4C54A 3L3DA 4EUPG 1CVSC 4B9JA 3L16A 4F8OA 5CP3A 3MBEC 3QFGA 4N0FB 1O9ZA 4FX5A 4KRNA 3U6RB 2QDVA 3C9NB 2KERA 1NDGA 4XPTL 1JNHB 4KH9A 1N6VA 1PKQA 3HR5A 2YD9A 2VMCA 3VXNB 1BVNT 1KEML 3EJCA 3ARDB 4MDJA 2DDQH 3NYKA 1L0QA 4UOW1 5HGDA 4JHAH 4YHLL 1BF8A 4MVBD 4ZPTA 4GS7B 5G5DA 2X1PA 5DRXA 4FQ2H 1UA7A 5D7HA 4L0PB 3V4PA 3GMNA 5KBKA 3TIDA 3C5ZB 4AJVA 5HVFB 4WQOA 2BS8A 4A2EA 4FXGA 4ZUSB 2EAEA 2ZG3A 5IB5A 4FNTA 4W81A 3Q48A 2ZYRA 1BPVA 1N2RA 3WL9A 1MPAL 4JPQA 4O02L 5FYLE 2P5WB 4OFIA 5B8CC 3L4XA 4NJ9L 1TJGL 2PWDA 3OL2A 1KCKA 2AQRA 3P1VA 3VVWA 1SFHA 3CFDB 4N2NA 2FBOJ 4OCXH 4PRHD 5ANMB 1F2QA 2AABL 5DUBB 2J2ZB 3HE6D 5EORH 1E5CA 3MGAA 4LLWA 4YSPA 2PP8A 4JFFD 2RQ8A 4HSQA 1PKQE 4E9VA 2GIMA 4ZT1A 2X41A 1THAA 3IXTB 4TULH 2F53B 2ICEC 4BH7B 2X3BA 3ROOB 3BPLB 2R7EB 5TDNB 4NEHB 4QXTB 1UXSA 1RVFH 2Y69B 1Q9KA 3CU7A 4GRWE 2C1PA 2IFFL 3QEUA 2HUEA 3MCKA 1OTSD 5AUMA 4FFTA 2LGNA 4QRTA 5CEZE 1U9KA 5ABDE 1Z0MA 1UCBL 4JO8A 2B14A 3HC2A 3IDXH 1A6WL 2DIAA 4HPOL 1NEZG 1KEGH 3M86A 4ADJA 5BVPH 2DD8L 1SFDA 2GC4C 2VDNH 4MB5A 2WVSA 2H9GB 1NSNL 1J88A 3D4CA 4WI9A 4P07A 1N64H 5GGTA 3EADA 1OM3L 3L6FB 3PDGA 1FH2A 1Y7VA 1IL1B 4KTEH 3REWB 5FUOH 5FXCH 1UWYA 5HHOA 3I3BA 4URTB 1H3WM 1UWXK 1HYSD 4PN6A 5C2BH 1DVTA 2X4RA 4Q6YA 1SF5A 4CW1B 4HAGA 1NBVL 4WUUB 4KI5D 5HVWA 1Q4NX 3UJJL 3SBQA 1J18A 2TAAA 2YBRB 3FHQA 1JZ6A 3N9GL 4XOBA 4OLUL 1NCDL 2IQ9H 3NZ8A 4N2EA 3T6VA 4XAWL 5D96B 5IVOA 4PYHA 2HJFA 3EO0B 4GW1A 4Y4HB 1MF2H 2R8SH 3FOMA 1XWVA 1CFMA 2XXCB 2YQBA 3FZUC 1KB5L 3HNSH 4HJEA 1HOEA 4E5XA 3B7RL 4Q9BA 4HJ1A 5DURD 4N90E 4X83A 2YAOA 1CDUA 2QKIA 2XTLA 3CJJA 1NFDA 1RHHB 2DL2A 3FSVA 5F8QC 2NZ9D 1P2CA 3AUWB 3LH2H 2R0LH 2VZTA 3UGXA 2XVKA 5KYWB 1SJEA 3PY9A 1BAFL 5JW5A 5LGHL 3SDDD 1S7SB 3QZWA 5D93B 3B2DC 3QRFM 4ELMF 5HHOE 2Z8RA 4L4VA 12E8L 5EBWB 3MV7A 3MNWA 1JPFA 2R2BA 4HK3J 1ZS8A 4CN1A 2GHWB 1HHKB 1OHZA 2BMKA 4WTWA 3FO1B 3IMWA 1BFTA 4MYWB 1UEMA 3P77A 5SWSD 3N1PC 5J1SC 3MUHL 4Y9EA 3CHXA 2XZAH 3TNMB 5JHBA 4KQ4H