3R18A

Chicken sulfite oxidase double mutant with altered activity and substrate affinity
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
373
structure length
373
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Sulfite oxidase
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
total genus 97
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r18A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r18A01
2A99A 3R19A 2A9CA 2A9BA 2BIIA 2BPBA 2CA3A 2BLFA 3HBPA 3HBQA 1OGPA 1XDYA 3HBGA 4PW9A 3R18A 4PW3A 2A9DA 2C9XA 1SOXA 2A9AA 1XDQA 2BIHA 2CA4A 2XTSA 3HC2A
chains in the Genus database with same CATH superfamily
2YO3A 3QK0A 3MV8E 3A67H 4M5TA 3WYRA 3OLGA 1CLCA 1ZJAA 4DEPB 1NBQA 1JNLL 3IN2A 4BZ2H 1AE6L 3TO4C 1UUNA 3FUMA 4HS6B 2IDTA 5FCSH 3QDMA 4GJTB 4Y5VA 1ZLDA 4GBXA 1B4RA 3RHWK 3TT3L 1QQDB 2J12B 4YXKH 3UADA 3VI3F 3H55A 2DLTA 4R4ND 3RDTB 3MODL 3IMUA 1MVYA 3B3IB 5FAAA 5FEBA 3H6JA 1MCBA 5A2KH 1JZFA 2WQUA 4GW1B 1GW6A 3IFNL 5LWYL 1CR9H 1VACB 1RP8A 4I48A 2FLRT 1OGTB 1R6VA 2EUXA 2IXQA 3OBAA 3V0GA 3RGVA 4D0DB 4QRFA 4M4RA 3EJSA 3PL6B 2ZX7A 3OZKA 1W91A 1TIUA 3ZMRA 5EEXA 3GSQB 1HHJA 4HBQA 4MLIA 1DANU 4XN4A 1KNOA 1IGTB 1NANI 4NKOB 1E4HA 5CM1A 1GAFH 4I7ZC 3BISA 1YA5A 1VFBA 3BUBA 3NQIA 4P9HC 1HS6A 4PG9A 3TONA 2RMNA 1FL6A 1S9WB 2ZXBA 4JUSA 1WSST 2LAAA 1IGJA 2HJLA 3TBVA 2ZCLL 1QZ1A 2J1WA 2Y69B 5DJZA 3VQ2C 1OF2B 3FO1B 2MPVA 3VMNA 5KJRH 5EOQL 4UTAA 5D70H 1S9VB 4HZAA 1UT9A 1K2DB 1S6NA 1VEPA 2VDQL 3BD3A 4PGDB 4DJMA 4MQXC 4MZ3A 2DAVA 2WZ0A 3TA3A 1F4WH 1YPZF 5GRYA 3OJVC 4NRYB 4XCEA 5JXEA 3WTUA 3L9BA 1CGSL 3FSVA 2BHFA 1F86A 2WXJA 3KWXA 1F8TH 1MWOA 1HAUA 1AFVL 2HTKD 5CP7A 4YSOA 3VFWA 2E7LC 1ETA1 1QTYT 5I1CH 5J11C 3AY4A 1M7IB 2ENYA 3ZDXB 1BBJA 4OM1H 1X9QA 3DYOA 4OUOA 2I7OA 2WQAA 5IFAL 3IMBA 2VWEC 2QSCH 1Q0XL 1KCRH 1H5BC 2G3NA 1XWVA 4G6KH 4XN2A 4IKNA 1Q0YL 3HLAA 1CD1B 4F8PA 1CC3A 3SO5A 2VDPH 2FRGP 3CLFL 5IMMA 5DFTA 3ZTJG 1KIUA 2WB7A 2WXMA 2K4WA 5DJDA 4P2OA 5FHAL 3QH3A 2JQAA 3X14A 4JM2C 5AYUL 5GXBB 4TTGA 1NFKA 1KPUB 1DVFB 1DUYB 1JXJA 2GSIA 3MJ7B 2AV7B 5IHUH 1CTMA 1BF2A 4M3HA 3UDWC 3CCHB 2IH1A 2M26A 4YO0B 1ZA3B 4X7CC 3P0GB 4LGPB 4GMTH 4I5BB 4NAMA 4CMMB 3NEEA 2XG5B 5T1DL 3V4VL 1BFTA 1YPZA 2WXNA 4J2QA 5TF0A 5C70A 3EZ8A 5MEPA 1M71B 1NUNB 4NCC2 1PZ2A 5I17A 2I9LA 1XF5B 1H0DB 5FUZH 4MQXD 2NSQA 4YGVA 2AJYH 2OQJA 1DFBH 2VDML 4NSKA 4NO3A 1IM3B 3T3MB 4NZTH 1SYVB 1RULL 1NBYA 3AREA 1X3DA 4JN1H 4JRXE 4HDIB 5GS2D 1HDMA 3KLQA 1JUFA 4YBLC 2YAMA 5D1XE 3T2QA 3S7GA 3T4YA 4PW9A 4ZQKB 3LXUX 3PJSA 1U33A 2LVCA 4POZC 5I2IA 4LCUB 5HYJE 5KSBE 4J6IA 3WS3A 3OL2A 1NTDA 1OTUD 1A9EA 3D39E 5KUKA 4YZFE 4J8RA 2XTSA 1J1OL 3LH2H 1RK0A 2GHWB 3O3BA 4JM2D 1T3FA 2A6IA 4UOW0 5DURB 4X8CA 1KG0A 1GS8A 1K5NA 5HDBB 1SEQH 3S34L 4EI0A 3CSPA 5KSAA 5CCKL 4RZKA 1AKJB 5DI8A 2UUDH 3K7UA 3K8MA 4J6RH 4FP8H 1V05A 2O5XH 3P73A 4DT2A 4NO5B 4O4YH 4Q4IA 4AGLA 1ZPLA 3UO8B 1E5UI 3FTGA 5FHBL 3SKNB 2XWTA 2C7UA 3HG1B 3L7FB 4P2QD 4B9JA 1FHGA 3U4EB 4Z3IA 1UHVA 5HHNA 3BQUB 4NQSB 3EYFB 1YN6B 1WV7T 4OF8A 3W1ZA 1BXXA 5EPMB 3TEXA 4YDJB 4RMTA 2AEPL 3H9SE 4QTFA 3GSWA 3EYUL 3GMQB 4JPWH 1BDYA 2M2DA 2A6KB 3ZBMA 1MQKH 4M7KH 3O11A 3V5HB 2WXRA 2BSBA 3DARA 1BCIA 3VXSB 1FF5A 2UWEF 2Y72A 3N50A 2MCPH 1MNUH 4NT6B 4S2SB 3DTDA 4LSRL 1ZAGA 3GJFA 5IVXA 1ADWA 3DX7A 3GSNL 3EYOB 3GIZH 3VAEA 4XNQA 5KS9F 3B6SA 4NKDA 4NO2B 4X9FA 1F1DA 4POZD 1QFUL 4X5LA 3IGUA 4TOYH 1AO7A 3B9EA 2F61A 2C3XA 1J8HA 3RJQB 5AVQB 4XWGL 3RWIA 4MNQE 2G2RB 3L5WA 3AAZA 1P7QB 3VGHA 5JIIA 3AS1A 5DJXB 3KLHD 1RP9A 2EYSB 2BDNH 1HSBA 5B22A 2AXHA 3FMGL 4G1MA 2G3MA 1V27A 4NDMA 3SD2A 1T20A 1W15A 3PWLA 4QTIH 5DFWH 5GGRB 3SGEH 1RIHL 2E3VA 1TZHA 5J6GB 2NY1B 4QXGH 3KYKL 5C0IB 3A4AA 3O3AB 4OD3L 5JOPD 4P2RD 5BMFL 2W94A 1JNNL 2PKDA 3KJ6L 4PJHF 5TE6L 3VXUA 2EVGA 5J1AA 3V4LA 3GB7A 1EFXA 4PS4L 3SGKC 4P9ML 1KENH 3UBXG 3EZJB 2Y07L 2DQCL 3TIEA 3QUYB 3BAXA 5CD3A 2DQEH 2DWSA 2D7OA 3ZJAA 4L9DA 2DS4A 2UWEA 3LZFH 5FS5A 1U6AL 3POHA 3QQDB 1FFPB 1KCSL 1WHOA 3CHSA 2WTPA 2FO1A 5C7ZA 3Q6GL 4YAQB 5J56B 3GRWL 3MNDA 2P5EB 1XD0A 1GC1H 4IOIB 3GSXA 3CZFA 1AZRA 4AQAB 1OAQL 1JZDC 1IB5A 3CX5J 2XQYA 4MD4A 5EU5B 3JTSB 3KDMA 3U1QA 4YHOL 4J3OF 4JPIA 2KZKA 3FQYA 3LPFA 3CDZA 2A6DB 2EO7A 1B6DA 3QHFH 4Z7NE 5J0BA 5D9SA 1CGWA 4Z8FL 1U0QA 5D4JA 3FSAA 2EH8H 4RAVA 2JKIS 2H2SC 3L8QA 2XI9A 3QULB 5EF0A 4ODTH 5JR1H 4KVCH 5BZWA 1TZGH 3LQAH 2CH8A 3EG9B 4FYRA 4XMUA 1FWXA 3B9VA 2O5ZH 4R7VA 4AGNA 4DTGH 5JMOC 1JPTH 4JVUA 1QBBA 4XWOC 1KWGA 3COOA 4EN3B 4TLTA 3QA3A 1HTYA 2YPVA 3AQYA 1F97A 4PV8B 3BZ4A 2IBGA 5J13B 2X2IA 3II1A 1JTTA 3QIUD 2VXVL 1OB0A 2DEXX 4FQJL 4CBZA 5FM5O 4JFQA 4OB5L 1MCDA 3BE1L 2B7DT 2EIKB 3UTZA 1CXIA 4I87A 4DZBA 4UANA 4HCRL 3S36X 2VLKE 5GRUH 3ZYJA 2J5LC 4JO5A 1UJ3A 5FGSA 2VN6A 4K7PX 3DX8A 4B7IA 3P4OA 4CADA 3GS4A 1XR9A 4W9JC 3ECUA 3P0YL 4L1DA 3TJEL 1DANT 4NCC1 1CGXA 1T0MA 2P7TA 4LEXH 2VXUH 2XXCB 3I3DA 3WJLC 4YSQA 4LSQH 5LAPA 3HVNA 1A3RL 1HI6B 1WDAA 4OLUL 5FKPB 2C4XA 3UTTD 3E8UL 2WBXA 4X6EB 2H2SD 3BT0A 4ZUUB 2FQFA 2O5NA 4RFOH 2VC2H 1TXKA 2DWEA 3MC0A 4OCWH 3W0WE 1IC4L 3FN3A 2BVEA 4XE5B 3OKDA 1RMFL 2ED7A 1A6PA 3BUPA 3IBEA 5CLWA 4F5CA 1ZV2A 1NGXA 1VLXA 4WI0A 2EDWA 3KS0J 2DICA 1XGRA 4BCZA 2CUMA 3MJGX 4M7JH 4YDLC 2VITB 2BNQB 3PG2A 1ZVNA 3PWJA 4EZJA 4TUJA 1JFQH 4XWOD 4L4JA 3JVGA 4F7CA 1U4FA 1ID2A 3ILQD 4CVXA 3D12B 2AITA 2Y7QA 4H8QA 3WHXA 5BQ7B 2EIZA 1W8EA 4AYFB 3IFPB 1NIDA 5IMOB 5AOMA 1UEMA 1XR8B 2F54D 2XWZA 5B1KA 1RZJH 4FNSA 4UDUA 4EUPG 3ELAT 3JVFC 4WSKA 5I1KL 4ZUTA 4PGBB 5E2VL 1L6XA 3CFIC 3UAJA 1UOLA 3OJDB 4JDEB 1WK0A 1DQJB 1GHFH 4PGEA 4MYPA 4QOKB 5E1HB 3T3PF 1UOKA 3LNDA 2V2TA 3ARDC 3OG4B 3FUKA 1SGKA 5L4IA 5IBTH 1U58A 3PQYE 3BP5A 3SE6A 3O45B 4MXVF 4GRLC 4M5ZH 3T2NL 5HHOB 3NFSL 3UC0H 2X4OB 3FAWA 2FCBA 3TBYA 4K3EH 1GIGH 4D9LH 1A4BA 4FXTA 1LO2H 4UT6L 3PY9A 5FKAB 4IRJB 1QW9A 5AYQA 2VDNH 5DTFB 3QI9C 4ZS7L 5EU7C 3J27A 4OLYH 1IGYA 3W5NA 1MW3A 1W8OA 1A7RL 4ZRGA 4HWNA 1YUKB 2ZOLA 1EJOH 1QSFB 5EBMB 2JKNA 3FBQA 2WUBL 4LCCA 1HL8A 4ILDA 2M83A 1J05B 3EJTA 1ZT7B 4O5LL 4YK4B 5HI3C 1S7VA 4X6CF 4TL5A 4RESB 5IMKB 1T83A 2V2XB 3G04B 1N6QH 2YWZA 3VFNA 1X5MA 3NSXA 3ARFB 1U36A 2Y23A 4EUPB 5AAWC 5BRQA 1CLZL 4WDIB 2OCCB 25C8L 2XN9E 3FUNA 1GR7A 3HKZA 4GXUN 1XH2A 5E23A 4BWUA 4PW3A 4TNWF 3PWVA 1NICA 4AZ8B 1KZYA 2UY7A 3DX6B 3G5YB 1XFPA 3S9DB 2DYPA 4L4VA 3WTYA 4L8CA 2H26B 2NMSA 1PD0A 5LN4A 2FJFA 2YQBA 4K8RH 4HGWB 1YRKA 3ARDD 2Y3AA 1SMDA 1M9SA 3ULSA 2V33A 2YRZA 3CXDH 3SQBA 3ISWA 1ZY9A 2J5WA 4XBMA 4GRLD 5DLML 2WP3T 4ODVH 2A74C 2HKHL 4XP6L 5BOZG 3QPQC 3WE1A 4PJAE 2P80A 5F7UA 3V8CA 2CGRH 4IDLA 1S7UB 5CUSH 1BJ1J 2Y36H 5CJBA 4JFXA 3QI9D 5DEJA 3WNKA 1SM3H 2P26A 2WXQA 2WINB 2VABA 3NJMA 5CMAA 4CGTA 1BLNB 5E2TL 4RRPA 4K71C 1XDQA 3FU7B 3UG5A 1NFDF 4QY8B 2E8ZA 5I15L 2BNUB 2YJQA 4A7QA 1JGVL 2Z91B 4LVNC 4WHCA 3P9LA 3II2A 3QDME 1W72B 4OGXL 2AK4E 5I18H 3KPSE 3NMEA 3S3PA 4XXDA 3CUPA 3WMPA 2J72A 1BQHA 2UYLA 1XCQA 3W57A 5FA4B 1I8UA 2JKTM 2F53A 4H8UA 3V6OA 5KUMA 1E4KC 1NAKH 2ALWA 4YHKH 3FTXA 1GYAA 3KNBA 4WTQA 4N2DA 3LSOB 2AEIT 3MV7A 4ODXB 1RZIA 1J7VR 2D0GA 4JL2A 2UXFA 1SFDA 1T1WB 2V17H 3PAVA 4JN2A 3V4PB 4AGPA 1S7QB 3GQFA 3ZR5A 2CO7B 4XBEH 3REVA 3Q2WA 3W5MA 2JIXB 3BYTA 3MUGA 2YMXL 2OX5B 1NCTA 2F1AA 4N0UA 2XBZA 5AVUB 4LRIA 5GJTH 2VN5A 4B27A 3L4UA 4FLOA 1C5CL 3DYPA 2KDYA 3IKKA 3PXLA 4JGNA 5C0EB 1NFDA 5KVFL 1WEJL 4L8DA 3TL5A 3MSPA 5LCVH 3PAYA 5I0ZA 4NQEA 3BJLA 4UM8B 2AQ3A 3BGFB 1FA4A 1T03H 2ILLA 4LP8A 5I8EA 5JPNB 4XHJC 1MRFH 4HHAB 4Q4EA 4UB0L 5KBLA 1MRDH 2BIMA 5EZJB 4WTZA 4NM4L 5IGXH 3RNKB 2NX5B 3UJJH 4N90E 3OHXC 2X2UA 1GYWA 4LLUA 5ICXA 2IQ9H 4GLRI 3HZMA 1GJIA 4BE6A 1A4AA 3GLDA 2EDYA 4UI2A 4Z7UA 1IL1A 2RACA 3NQKA 4TSCL 3WU1A 4KGLA 3V0WH 4JQIA 1U8HA 4HC1H 4DGIH 3LN9A 3MOBH 4G8EB 3D33A 2AEWA 2IFFH 5BVPH 4N6QA 4H26B 4HUXB 4XP1L 4M6OH 5KSUB 2MTPA 5I8CB 1UXWB 1K72A 3NAAH 4Q6YA 4QRRB 4M7ZC 3BSHA 1HEZA 3PYCA 4XGZB 1LE5B 1BMZA 4ZYKA 1NMAL 3PF2A 1WFUA 3HN3A 4FE9A 4HSCX 4HUUB 3ARRA 2J1XA 2J6WA 1U8OA 3HBQA 4X6FA 2PR4L 4IU2A 1BG1A 4OSUH 3GKWL 4V1DB 1F45A 1R3JA 2JK5B 3OC8A 1QTSA 1KXQE 3BKML 1NM9A 1P4BL 3CX2A 4XVOA 1CZ8L 4KO7A 4I85A 1AVAA 3V4UL 3TT1L 5JW4M 1N18A 3T6QC 1R19A 3T0EB 2G30A 4O9HH 3EF7A 1MHEA 2DQUL 3ARTA 4HMEA 4CNIB 5IJVA 5KBMA 2WXOA 4PJ6A 3U2SB 1JZ8A 4L5FL 4Y4KB 3KPRB 4ZX5A 3PP3K 5L8JB 1MVUA 1FZMB 3WD5H 2GVYA 1BV8A 1XXDC 3TO4A 3C2SA 2OK0H 2ZX9A 1WD9A 2DB8A 4PLOB 2J6EH 3O2VH 3OAWA 5T5NG 4AGOA 2Q2LA 5T1MB 5SWQA 4HUVB 3I02A 2YKKA 3UROR 5AOKA 1DBJH 1FZOB 1YHPA 3LCYA 4DVBA 1ZHKB 4FQCH 1YN7A 4NO0D 2VDRL 2YPLA 3NFNA 3PU7A 4NNYA 3ZVVA 1NGWB 4NUMA 2VW4A 3VD5A 1ADQL 3W37A 4PS7A 3QXTA 1SJMA 3GEFA 3ROLA 1BVOA 3MGTA 4IRZH 5ACZB 4Y5YC 2LE9A 3UYOD 3NCFB 4JKNA 3VXRD 3MCKB 2QADD 2MCAA 4QRQA 1KXHA 1SXBA 3QIBD 4AZUA 5DJ8A 4AQEA 3AQXA 1KF9B 4QGYA 5L7XH 4NC1C 3AXHA 1N2RB 2Y06L 2J8UB 3MRFA 5AVZB 3WOVA 1WS8A 1B0RB 4XXWC 1P0SE 3DGGB 2A1WL 3CU7A 4XAWL 1TQCC 3LHPL 1H8SA 2OTPA 2HRLA 2MQCA 4JM2F 3RI5F 2AC0A 5ID0A 1QI3A 2YRPA 1TFHA 3DVNA 4Y4FB 2B59A 3DV4B 2ENQA 2P42B 3QPXL 5B8CB 2AKRB 5SV4A 3BHBA 4JHAH 3VXPA 5DJYA 4Z6AT 3GMRB 1CVSC 3CXFA 3DXAB 1T0PB 5FUOL 4WCYH 2B0SL 3MJ8B 5KAQG 2AI0L 1ZANL 4I2XB 4PFEA 5EIIB 5HYEA 4L8BA 2O26U 3MBEB 2E7LA 4AEIL 3ABMB 4OLXL 3SKJL 2W92A 2QHRH 2WXLA 2NY2C 1M42A 1IGFH 3BP4A 3VQMA 2R56H 1ASPA 1JZ3A 1MNNA 1XL6A 5HGBA 2JCCB 4F9PC 4TL4A 5IVXE 4GAJH 1H5BA 1OZUA 4EDXA 3NPZB 2NY0C 4MJ5A 3UYPB 2EP6A 1J8HE 4JUTA 4N8VA 3ZE0B 4DKEH 2G3ZA 4JFYB 2LAGB 2BVYA 3NK4A 1D6EB 4PJ5D 5D7KE 3SD5A 3JV5A 4JM2A 3ULAB 3D0AA 3IJSA 4K9EL 4P06A 4X6BA 4HJ0C 3VRIB 3GO1L 2E47A 3B7UX 3MNMA 4HKXA 4UQ2A 2I5YL 3ARBB 4HD9A 4NJAL 4XP9L 1X7QA 3UDWA 1WHPA 2DQMA 3CLEL 1CBVH 1TKWA 2MCMA 1OP3H 3ARGD 1J1PL 2DMGA 3VXUE 2QHLA 3QCVH 5GGRY 4Q9RL 3NFPA 2PPEA 4LEOB 1AZCA 1NC4B 2H5UA 4OLEA 1KCUH 5F7FA 2EQDA 2MNWA 4R7NA 4P2QA 4U6VL 2FHFA 2NNAA 4AYEC 1OTTC 1JV5B 1S5HB 1CTNA 1EHAA 2X2JA 4GG8A 5HI5D 3FU3A 1MJ7L 5DJCB 1F4YH 4G5ZH 5HYQB 4ISVA 1A02N 2CLZA 4MMZC 5DGQA 1JPST 3KYAA 3C08H 4UF7C 3RUGB 5H37G 3GMLB 2D3NA 3GUTB 3MRLB 1S7SA 2WJ7A 1XDTT 5EOCJ 4WW2B 5DSCA 4HX1A 2BNRB 1S78C 5CJ8A 3TPUA 2NY3C 1KEML 1S2EA 1AD9A 4KQ0A 5MENA 3FNKA 4ZXBC 1RIVH 1M2VA 1QWNA 5GJSH 2JKWA 4X8JB 4Y9BA 1XGZA 2MSPA 4G43B 2NY0D 5HGGS 4K15A 3ZE2B 1WBZB 3VI4B 1CL7I 4NBZB 1G7HB 3MUJA 3PGCB 3RKPA 1KGWA 2UZPA 3QISA 1IFRA 3AG1B 3VFRA 1ES0B 3QEGH 1LWJA 2H3NA 4UTAH 3LHAA 5PCYA 5A2LH 3HNTL 3FHEA 1SOQA 2DRUA 4XMLH 3L2LA 1X5HA 1NCAL 3L1OL 3ZLQC 3O3DB 4P2RA 2NT1A 1MI5B 2QV2A 3T9WA 3DRQB 2OMVA 3IU4L 1KIPB 3QGVA 2O6DA 4GXVL 3IGFA 4QYAA 3FB5A 4IIQB 4NQCB 1NWPA 1XO8A 5D1ZD 1G9MH 1BZ7A 1RZGA 2UUDK 1E4XH 1URZA 2W91A 2IOIA 3QARA 4M6ML 4PJGE 4Q14A 4XNUH 1OTTD 4XO4A 3RTLA 3HZKB 2EO1A 2HPTA 1P7KB 1NEZA 3F58L 4G8GB 3WJMA 3ZSSA 3QCUH 5BVJA 1X5FA 5FYJL 5TE7H 3C87A 1FO0L 1N7ML 1WYJA 4HUWA 1AY1L 2XKUA 4MA1C 2XBTA 1FE8H 5DRZA 5LJYH 1IC0A 4F1ZA 5DFVC 1NC2D 4WU5B 3S8GB 5G55A 2ADJB 4PGZA 3THMH 1FFOA 1RHHB 5E5MA 2VKXA 1JS4A 1Y18B 3T8XB 5TPWL 2NY3D 3LQZB 3AW5A 3QS2A 4NWTL 2I60H 1HQ4A 4ZXBD 5E70A 1J5HA 2MCG1 3UFIA 5GRVK 4DK6A 3MBWA 3INUL 3NPSC 3PABA 4PGCA 1DQDL 2CK0H 5C71A 3AACA 2RB8A 3P2DA 1I3RA 4JFTA 5DVNA 2F9BT 4XMTA 1Q72H 3BKCL 4A38A 5JOFA 4PB0H 4LIQH 2ITDA 1LP9A 1UZ8B 3MDJA 4PRHB 1IC5H 1RQ5A 2BSTB 4BFNA 3TF7C 4CC4C 4WFEE 5EDXA 1I7RA 3DUUB 3QDGE 5ILTL 3TBBA 4F5CE 3H7BB 3W82A 4OZFG 4MCMA 4AJVA 2AV1A 3NSFA 1XGYL 2Q76A 2OMTB 1CBJA 2WGNB 4JFUA 1E5BA 5B3NA 4HIHA 4BZ1A 2ZOKA 3EYSL 3HE6C 4U0RC 5EOCL 1J1XL 4PG2C 3HS0B 3SGKA 1TLMA 5DK2B 1DR9A 3I6KB 1UB6A 2J56A 3AT8A 1VESA 2FGZA 3EGDB 3NZ8B 5MERA 3BN9D 2GABA 3ARZA 2AF2A 3KL0A 4P5TC 4ADGA 3OSVA 5C0BA 1E27A 4O2EA 2ZUUA 4HW6A 1J48A 3IGAB 5AVWB 2EO9A 5HYSG 1T1YB 3ILEA 4KQ3L 2GCYA 2LVEA 4H1LA 4Y4HC 1XVSA 1F11A 2ZXDA 3BQVA 4Z7WF 4YHZH 5CSBA 3CFDB 1A4KA 2AQ1A 4JZNA 2H32A 4Z7VF 4A2DA 4NFBA 4GW5A 4N3UA 4ZI8A 3TIDB 1EWHA 5ABDE 5D5MB 3CVHA 2OJZH 2VW7A 5J7CC 5IT2H 5HDOA 4IBSA 4JHZA 5MI0C 2AMGA 2VT0A 2V3EA 2Q6WB 2HZHA 4HF5L 3UTTA 1JPSL 4ALAH 4YFLF 4M3KB 2BSSA 4PRAB 3TEZA 5CLZA 5F3BA 4YC2C 2VH5L 2MOVA 5I23A 4IHOA 3N06B 4HFUH 1KACB 4P59L 3D69B 5BZXA 1OCWL 1RURL 3ZO0A 5ICYB 3WTXA 4S0SD 3RKDC 4UQ9A 4LKCA 1KJMA 4GAGL 5I1IH 2ED6A 3MRNB 1KCKA 2BIQA 3PP4H 3RFZA 3A0OA 4LBEA 3LN4B 3RWFB 3AC0A 4WY7H 4M43H 4QXUH 1A6UH 5C9KA 4M1DH 3GJFH 5E2UH 2VXQL 1CDUA 1ZMYA 5DEGA 2VDOL 5I0WA 4RFEA 5IEKA 2V5RA 1UM6L 4DETA 2VLRB 3QT2A 5DQ9B 4K5OA 3MV9D 4Z7WA 4D7BA 4PD4J 1H15A 4IGBB 1FUNA 2D3JA 2DLFL 4IU3A 4AVJA 2F54A 3T3PE 5MHSE 4JFWA 3MXWH 4PRID 1CE6B 2QVIA 3FRPB 4Y4HD 4Q6IC 2PCFB 3OMAB 3T6WA 3FT0A 4FEMA 2EEBA 2H9GB 2ESVD 5C1MB 3DVFA 5DDHA 1JZHA 4L4VE 1VDGA 4I3SH 1OSZB 3DBXB 1QLFB 5EUOB 3T8MA 1LD9B 2DH3A 4AXWA 1CFTB 3WJLA 5L8LB 4MZIA 1HHGA 3WNJA 2J73A 2BCMA 4JFPB 3A24A 4ZO6A 3HC2A 3RL1A 3SYCA 1F2XK 4GEIA 3F7VA 1P1ZA 1VSCA 4LAQL 4OD1H 4P2YA 3A3YB 3ECBB 4PV1C 5E8PA 1ACCA 2IGLA 5H4ZA 2FQGA 3KLAA 1EHNA 2XWCA 2R0LL 2QFPA 3WO3B 2YAEA 3UZVB 2A2QT 1I75A 3KPNB 4FFZL 5I1AA 5A6LA 3TESA 1FL5A 1WBYB 1M2OA 3JUYA 5E1QA 3ES6A 4KH9A 5D2LF 1R3HB 3KYNB 3QC5X 4I9XA 5AVSB 1HHKA 3K74B 5FA3B 4MA8L 2CJUH 5K33A 1DBAH 2DEWX 2F53E 3V6OE 4AUUA 3BPLC 2AVGA 3V0VA 5CBEA 1CFSA 3CPUA 1CG9B 4PWJA 1BPLB 3TH2T 2AERT 3MV7E 4X0NA 4AM0A 4Z7QE 1PYWB 5C0CD 3LIUA 5ID1A 3QQ4B 4P57B 2H6PB 2MIZA 2VAAB 3GSVA 3UJTL 2FBRA 1EEYB 3G5VB 3Q01A 3CC5B 3H9HA 4M48L 4OF0A 4LLMA 4LHUD 5I1LB 3DC0A 5JHDB 5K9QI 4K55A 5IW6A 4MJIB 1GPOL 5E8NB 3KPTA 3NJXA 1L0PA 3FCTA 3W38A 3ARDA 2ZCKL 2Z4TA 1DFXA 1WTGT 3KGTA 4MA7H 2P43B 1YJDH 3H42H 3TV8A 3EH2A 2YA2A 1PCSA 4N0UE 3HR5A 5F71A 5DVMA 1PY9A 2OR8A 4GRLA 2BSRB 1CF8H 2WO3B 3RP1A 1M56B 4IOFC 3VB8A 4HISA 2F7IA 2H7WA 1KYDA 2YPVH 1ZRUA 1NFDE 5BS0D 4H20H 2KT6A 3TBTB 4YNYB 3QI9A 3T2LA 4NQEE 1OE3A 2WKOF 3KPPA 3ZKXC 1WZMA 2QQLL 2CO6B 5TH2A 5CN1A 2IF7A 1SVZA 3FT2A 5HDRA 1S5IH 1YYLH 3K8LA 2B5IC 1A6VH 5EIVA 4H8WL 1KBWA 4RA0C 4WJ5A 4S1SL 4ZO8A 1CLYL 1MEXH 2OSLB 5CJOH 3ASWA 1IT9H 2CXGA 2PLTA 3SGDH 5IOPB 1KGJA 1FNAA 4U3HA 3L9RA 4Z7UE 4YEFA 5GRZA 3H6AA 1C16A 2OYMA 3D4ZA 4MMYA 4X80H 4ZUWB 3ASNB 4L3FA 5I9QB 3GNML 5IESH 1FAKT 4N3TA 3K2KA 5IQ9B 4FQ2L 4ZDHA 3S3BB 5AAWA 1FDLH 2DTMH 4JFSA 5IY5B 3KWUA 4AITA 3RIKA 2IMNA 1UM4H 4K9EC 2VDKH 4UQ3B 4Y9EA 4PV9A 3MFFB 4KJPD 4NNXB 4NYLB 4XNBA 5SWSB 4JY6A 4ELKA 4X4ZA 4AT6B 1CIUA 4UUJB 4OIIL 4R6UA 3G5WA 4YVNA 3APCA 4QHLB 2X1WL 3B8SA 1BOYA 1GZQB 1XGPB 2FYVA 3LZQA 5DLLA 2J21A 2QVTA 4PR5A 2HX7A 4WO4D 5HHMB 1C12B 2A74A 2LU7A 3H9YA 2WKOA 4JHUA 1WCBB 5LHDA 4IOFD 1CLOL 3L3DB 2WWMD 3VVWA 4YR6A 1RLBA 3IU3A 4WI5A 4AENA 1E7VA 4OGYH 4NP4H 2P5WD 4WUKL 3NDZE 2VR6A 3AWFA 2ATPA 2VYRE 4HK3J 4U1LB 2APFA 4L0ZA 5F7MC 3LQMA 4PBXA 3W9DA 5D4IA 5JW3H 4GKNB 1AP2A 3EGSA 2Q8AL 4FXGC 4LEEA 1RUKH 2YBRA 3CDGB 4XTRC 1P5UB 3VFSA 1X7TA 4KO9A 1OGSA 1VA9A 3QJFA 1GOHA 1A2YB 2X4SA 3CH1B 3D2TA 5E51A 3PXJA 2WXGA 1BD2B 4BKLB 1K5WA 2E6JA 4GG6E 5D72L 1XCTB 1E4KA 3A6BL 4JCMA 1WF5A 4ZTPL 1JCVA 5ENWB 2V5MA 4OBRA 4WTXA 3QYMA 1BW8A 4JG0H 4BFRA 4Y2DD 1G1CA 3WFEL 4AW7A 2FBJH 3CMGA 3SO3B 4AM0Q 4GH7B 1MZYA 2BFVH 2Y5QA 3IF1A 2D7TL 5DK0B 4W6WB 2FT8A 2Y0SA 2ZUSA 1IKFH 2CO2A 1AQHA 4XPAL 1T2XA 4Y5XA 1QNZH 1WGVA 2Y2YA 1ZLSL 5IFHL 1UH4A 3L81A 1A6ZA 4FKEA 4HULB 2HG5A 4ZAKB 4NFCA 4RQQA 4O02L 1MJUL 2ORBL 4FKHA 3TH3T 1ACYH 3U9PH 2ODIA 1HQRA 1ITBB 1Y07A 1INEL 4QRAA 3VXOA 3UPRB 2YSSB 3FQ4A 1NKOA 4LU5L 4AL8L 5EFIB 3CFCL 1QW8A 2HRHA 3MJ6A 4MNHB 1Z9LA 5I0YA 3HAEA 1KCVH 3HC0B 3KXFE 3QR1A 2HX8A 3ZTDC 4KKPA 3WAJA 3QW9A 4PJ7F 1YZZA 3ZDWA 4TVSa 1JVLA 1ZE3C 4P4RB 4P23B 4A39A 3BIKA 5HJ3A 1VADB 4L29A 4ZOAA 3UERA 5SWZB 4JDVB 3US1A 4XNYL 1N4XH 1FZKB 2K6ZA 2AJZB 2F7QA 2Z1PA 3D4CA 1QRND 3GSNA 3E0GA 3APMA 3C5JA 1B2WH 1SUJA 3P3RA 5EC1B 2UY6B 4PCKA 3W2DL 4L1SA 4CMHC 4U2YA 4NO0A 4ZQTA 3TYGL 1SJHB 5ICZB 1A47A 3SPGA 2ZYHA 4B9CA 2C4FU 1DVTA 3HW7A 3ATFA 3BAJA 1RKRA 3TNNB 2X3BA 4LSDA 4JR9H 4TUKL 1WC7A 1BAGA 4ZPTB 3VXRA 4KTEL 3IAGC 4RWYL 4A04A 3QIBA 1JXGA 4ZMXA 5L2JB 2ICWJ 3EJZC 2YS4A 4HJUA 3SE8L 4YHIB 1KYAA 1NLDH 1M7UA 1TDQA 3H2WA 4G70B 1U91A 2QR0B 4W1TA 5F7EH 1G1YA 4LHJB 3MREA 4FXKC 1PAMA 3EBHA 2NY4B 3FO2B 4NC2B 4TULH 2NW3B 1JOIA 4NM8H 1AANA 1FFNA 1OAYH 4N8CH 2P3YA 4WU7A 4PJ7A 3TLRA 1C8PA 2DQHL 4RGNB 4QO1A 5KW9L 3HZVB 5DD1L 1I1AC 5AKVA 1SBSL 3E6HB 1ZPUA 5FYJD 4JY4A 5GRJH 4ETYA 1HU8A 1G7PA 3REWA 3CFJA 3S8WA 5IBUB 2BY0A 3MA7A 4X7SL 3PS6A 5ESVA 3FT4B 3TJPA 3GRWA 4JMXA 1VCBC 4MMXC 3TOPA 3UP6A 5I24A 1VGEL 2Y9RT 3RIFF 1A3LL 2NUPA 2K3HA 3LRSB 3L3IA 2Z92B 1KT2B 3RIAK 3V0FA 3V7MA 1NPNA 1WRFA 5I30L 1A4CA 3T2OA 1OAKL 2R2BB 5TF1L 2W5PA 3B2MA 3HOGA 2F7PA 4Y5YA 5DJ6A 4ZD3H 3T0AA 4Z7OB 3A67L 3G6DL 2IH3B 5IB2A 2X44D 1YEKH 2FL5A 5ICUA 2VLJD 3FUEA 3EJZD 4MD0B 4PJ5A 2FUTA 4F27A 1I8KB 1MWAL 5AAMC 4TSBL 4URTB 4KKLC 4PTUA 5F3HA 4XXWA 3C2AH 3FQNA 5FECB 1LQSR 1IAOA 3O6LH 2CIKA 5J8OA 4FMKA 1H3GA 1OP9A 2XSKA 1HYRC 4P2RE 5JOPE 1A7OH 3TCLA 5J12C 5C6TL 1UWGL 5B1BB 1CU4H 2F58H 3R18A 1KEGH 3ECQA 1SJVA 1CR9L 4UQCA 3VXMD 2GY7B 2OLDA 1IQDA 1I1AD 3QEQD 5HTSA 2AEQL 2DJUA 5GIRB 1Q1JH 1N8ZA 4B0MB 3S4SG 2E4TA 4JQIH 2NTFA 3L4XA 4PCYA 3Q2LA 5E6IC 4ZMNA 5E08L 2WLKA 2ZOTA 2DLEA 3MV11 3S35L 2WIMA 3NN8B 2DWDA 5CIPA 4WAFA 2GFBB 3F04A 4JJOA 3X11A 4EI6B 2A83A 5E9DB 4J28A 2VCOA 4AIEA 4WHTB 3MRJB 5A2FA 5I6XB 1UZ6F 3BGAA 3MRIA 5ESQB 3TBSB 3GJEB 3D25A 2DIAA 3V6FB 3DX3A 3SJVD 1TMQA 4BUQA 3K6NA 4MB1A 3O6KH 2JB5H 5KJRL 1FVCA 1YEEH 1OARL 4G9FD 2OSWA 2A5UA 3O0RH 3MACH 4L4TD 2WOYA 4MA3A 2GHZA 2FO8A 1E40A 2BWIA 4XNMB 5FYLE 1N0LB 3LMJH 4MZRA 4K23H 1OB1B 2AJSH 1F8TL 1XIWB 1O6VA 2A38A 1LP9E 2VE6A 3F7PC 4KK5C 4ONOA 3VM5A 5I16A 5HHPA 5D7HA 1UADC 2ENPA 1KB9J 1ZWIA 4LSUH 3R8QA 2XDHA 5T8IA 5FB8B 4U2ZA 3EGXA 4OM1L 2CBMA 1KGCE 5DRWB 3MYJA 4Z0BL 2KLTA 3X12A 5L2KE 5JA8B 2IQAA 2QSCL 1KBGH 1KCRL 1DQQB 2J20A 2KLSA 4G6KL 4J4PD 1UJTA 4Y7MA 2VC2B 3F65A 5F7YC 3LKSB 4Z0XB 4DEWA 2Z35B 4W6YB 1G0XA 2VDPL 3E80A 4HK0B 4FLSA 4ODBD 4QHUA 1OP3K 3ECWA 1QEWA 2DF3A 4XN5A 5E4OA 3RPBA 1BFVL 1WZKA 4JRXB 3NZHL 2LGNA 5JA9A 2XC8A 3C60C 1JK9A 3AXIA 4MMZA 3QFGA 1DP0A 5INCA 3EXJA 4WI2A 1R3LA 2IPTH 4NENB 3NIDE 1PKOA 5DMIH 1QX1A 2Z7WA 5IQLA 1YDPA 2E9BA 3WL9B 2DQTH 4F24A 3EFDH 2R27A 2XWDA 3OZLA 5BQDA 4ZXBA 4XMWA 3FU0A 4ANKA 2YD7A 1UM5L 4P9HH 4AV5A 3L9YA 4JO1H 2WLIB 2W65A 4WLCA 3VDBA 2D8KA 4JKLA 5AW5B 1FLTX 2GJJA 3O9WC 1ONQB 3UTTE 2PCYA 4MD5A 3DHJA 2CDGA 4GS7B 1NFAA 3R7RA 4DNLA 2ZWZA 4JN1L 3MJWA 4H8WC 5I74C 3VCLB 2UZYB 5D93C 2PWFA 2X5PA 1JE6A 3IETA 1RJZA 3IBOA 2WGXA 1ZVSB 2Y5TB 3GXTA 1TQBC 3MX0B 5F88B 5K5YA 2N0MA 3GHBL 4C58B 2VDNB 1G7QB 2MKWA 2NTSP 1BWMA 3Q48A 2ADGB 2ZP0T 1LWHA 4P8QA 5BJTB 3EAKA 2ZF8A 4UOJA 2FWOB 5JIPA 1EAOA 1ZLWH 1KFAL 4ETQA 2WBJC 3LH2L 1TCMA 2BP0A 3UGXA 1NMBL 1BZ9A 3C60D 5EO0B 1JWMB 4WUUB 2F54E 1AGEA 2KQMA 3MRMB 4GRWF 3U6XS 1IKNC 3T71A 4J6RL 5EO9B 2O5XL 3GGWB 4FULA 2EUZA 4DN4H 1V3KA 1IBYA 5E5RB 1KIQA 4O4YL 5F7WC 3VG9C 2FSEA 2ZUVA 4BH7A 1R17A 1C7TA 4GP5B 3CSYB 3VD4A 2PF6A 3ZYZA 3DOSA 1DDHA 4XO8A 5DJAA 5IP4A 5LNDA 2ZTBA 3SE4C 2R1YB 4P3DB 2W9EL 4TF4A 4IKJA 3B2VH 1R5WB 2HMIC 4XOAA 4UOW1 3EDEA 4RA3A 5JPMC 1IEAA 3MLXL 4HH9B 4PI0A 3BUIA 3O9WD 4WNQA 4L23A 2IO5A 4ZUSA 4JPWL 6PCYA 5D71L 2NLJA 1ZDQA 4CC4A 3ASOB 1QWUA 4NUJA 1OPGL 1T21B 2F1BA 1P6FA 1MNUL 3O2WH 4N2OA 3TASA 4R4BA 2ZKXA 3VWKB 3WIFB 1IEBA 4V33A 2GC7C 1OHZA 1SY6L 3HE6A 3IMVA 3GIZL 4PG2A 3TV3L 4D0CB 4MVBC 3MMEB 4WSJA 2HRPH 4HSAC 1NBCA 5I6LA 1EQWA 1MLBA 1SN2A 2GJ6D 4X7FC 4TOYL 3TJHC 3MNZA 1NGZA 3BGMB 2ZF9A 4GKSA 4EI5C 4EIBA 5CHNA 2KL6A 5DJ2A 2ZSVA 1CK0H 3V9FA 1GGIL 2Y24A 1TOXA 4P5TA 5F7BA 2BDNL 3DMMB 2FX9L 1T1XA 5J6SA 4F57H 3O6FB 3B5TA 4FQQA 4OQTL 4QTIL 3PJNA 3L3KA 4PRIA 4Y4HA 4UIKL 2VO5A 3VSQA 2HN7A 2A9MH 4QXGL 5TGBA 3WEAA 1RERA 2JJTC 3HA0A 3HI6H 1EHLH 2ESVA 3HUJF 2VMCA 1B4JH 1OAXH 2H0PA 5K9KB 1IBFA 1YQ2A 4JO2L 1LE9B 3QWQB 1W0VB 3O4OC 3ET9F 4O51B 3WNNA 2COVD 3MV01 4HETA 2JTYA 4NN5B 3DWTA 1TCRA 2X0WA 2DQEL 5DVKA 2XV2A 1LTXA 1VFAA 4AL8C 1O7DE 3U4AA 1MLCB 3ATDA 4MDJB 2ZXCA 1BGXH 3LZFL 5FDYA 3Q8CA 4NZJA 4P49A 1XGUB 5EZIH 4IKIA 2CO1A 1E9PB 5L9DL 2AS5M 3JWDC 4J3WA 1OKEA 4Y16C 3TWCL 2OCJA 4NRXA 2EDMA 3EUUA 4OY9A 5EBWA 1G0YR 3N6YA 3LJ3A 2XTJC 4HKZB 4PRDA 4XB8A 2I7SA 3PUCA 2Z8WC 4D9QD 2OTUB 4HLZH 4MVBD 1E6JH 5DQJB 4PJCE 5ANME 4I1PA 1FNEB 1NIFA 3LY6A 3QAZC 4Z7AA 1NCCH 4EI5D 5GGSB 4ZFGL 1LXMA 1U3HC 2FX7L 2VQ4A 3JWNC 3FBKA 3QHFL 1IE5A 2UXGA 3UBXA 9PCYA 5AAPA 2ZKHH 2EH8L 1BX2A 3QUMB 2NY6D 4BGLA 2V9UA 2VLKB 4L1HA 4C83B 3X3FH 2GUOA 5EU3B 5CGYC 5C0CA 1T1ZB 5DD0H 5JR1L 1EUTA 3MBXH 4Q6IA 3GJFK 2Z93A 2NZIA 5I75B 3GBML 3HVDA 2G5UA 4LHUA 4MYWB 3R1GL 3EH3B 3VWJC 3PIQA 4I0PC 1OK0A 4G8FA 1JPTL 3NIFE 3S5LG 1M6OA 1UOWA 3O4LD 4PJ8C 3DX9A 2C1PB 1QABA 1MFEH 4PEEA 2WIIA 3AXLB 2WXKA 3DPDA 4BZ1H 1URIA 5D7LB 4BFEA 1G7JA 1MDTA 1GJWA 1Q9LB 2QKIC 4NUGH 3LZPA 5BS0A 2WCGA 2J4WH 2JJUA 4RMSA 4XMXA 4I18C 3OKYA 4Y16D 3EYQC 1SLXA 3WKMH 1U4EA 3GINA 4HS8H 2YUWA 3QUKB 4FN0A 3S98A 2CUIA 3CIAA 2QPSA 3CSGA 2FVNA 4O2CA 2P8MB 1OLZA 4H1LH 3C6LC 4FG2A 4QHNA 4LEXL 2VXUL 3OX8B 1FG2A 4ZTOL 3L5XL 4GO9A 1GZPB 3U30B 4E5XB 2CMRL 3QRLA 5T5FL 4KY1H 4GI6A 4LSQL 4DHLA 3GMNA 1CT8B 4K0OA 5BUAA 1U3HD 1SQ2N 4N2AA 1CIDA 1ADQA 2E9IA 3QWOB 5AWNH 3BUDA 3WDJA 5C0DA 2H32H 3K6SB 2X4RB 2DIJA 3ROOA 1AQDB 3CQFA 3I50H 5GGUB 3CVHH 4OCWL 2H6UA 5CGYD 1RK1A 3SBPA 1XF4A 2WZ5A 2WQXA 2X42A 5JORA 2FO4A 1WZ1H 3O3UN 1DQMH 1K9TA 2XQYK 4JW3A 2OI9C 2F18A 3VWJD 4M7JL 2HJFA 4I0PD 5GZOC 3PQYB 3EDJA 4PLKC 2R39A 4IMLA 4RNRA 1KLFB 2EDQA 4PJ8D 1ICTA 3IJ7A 1FNLA 3I6GA 3BDYH 3GXDA 1DLFH 1WQVT 3HKFA 5CFHA 4A2MA 3LKQB 5E0QA 4POYA 1EZUA 4A2HA 4X6DF 3KPOB 1M1SA 5IIEA 1F1GA 1AHWA 2P5WA 3AUWB 1AS6A 1RZJL 3EYQD 1OQOA 1SEBB 2QTVA 3F6LA 3V79C 1BZDA 4BFJA 1CFVH 3SDCC 2XQ0A 4YHYC 3L54A 5T1KB 4X5XA 1F6FB 1VKXA 4Z23A 4N9GA 5DJ0B 4PRBB 2QDWA 4LCWD 5FM8A 3UPCA 1T66C 2GI0A 1K4DB 2X9ZA 1E2VA 4EXKA 4WWPA 4OIBA 2YFOA 3QRFM 2FWSA 4HIEA 4H44C 3OGCA 1Q9KB 4P2CG 1JI1A 3KW8A 5FV1L 4M5ZL 1Q9OB 4ODHL 4DKAA 5CZVL 4JPVL 2HFEA 2YWYA 1J5OH 1L7IH 1BF5A 4QAWA 3TZVC 1YEDA 1J10A 4K3EL 3P77A 4PRNB 4R0LC 1LO2L 3BP7A 5HGDB 5GGQL 5AFAA 2VERA 4FQHA 4Y2DA 5J6HA 3K72B 3T4AC 3VXRE 1INQB 5H2BA 4KKCC 4QCIB 1LHZA 1QRKA 1TFPA 3DIFA 3RZCB 4NAJA 4OCMC 1P5VB 2ZICA 3IXTB 5GZOD 1U8JB 1ANUA 2WLLA 2UZIL 4PLKD 3V5DB 3LRHA 4MDRA 3UO1L 3V0EA 1AE6H 3I6LE 4M9OA 4P5KB 3QS3A 1UXSA 3C09C 3TT3H 4MQTB 4H25A 2EE9A 2DH2A 1CICD 3L3JA 2FECI 4U3SA 1P6WA 3IFNH 5LWYH 4JGJA 2FHCA 2WYHA 4XC3L 2AABH 4JQVC 3VH8A 4G80A 3SDCD 5KYNA 1CFNA 4LL4A 4UZSA 5FYKU 2NXZC 4FXGA 4LZKA 1UWEH 1E90A 4Y5VB 1L0YA 3ZT7A 4RSYA 3CSBA 4RMBA 4NQUA 1E67A 4OU3A 5C0GA 1DVZA 1ILSA 1QRNA 5BRPA 1N3NB 2FATH 3ZDYF 3V95A 4FYSA 3GTVA 4LP5A 3MUHL 3TZVD 4FOMA 1J86A 1KY7A 3MOAL 3Q5OA 2AXJA 4UWQB 5DZPA 2CGRL 4I48B 3LKRB 2F2HA 5CUSL 2IXQB 2YC1A 3NIGE 2Y36L 3C6EA 4FQLL 4KTDL 3RGVB 5FDWA 2WSPA 1H3TA 2WNGA 4KV5F 3U2JA 3G5ZA 2BMKA 1HHJB 5EOQH 2H45A 1YC8A 3SGEI 1X4YA 1DLHA 1KNOB 3E3QC 4FQIL 2YKLH 4ORGA 1YY8A 3SDAC 1N67A 4YHLH 4R97C 2ATKB 5ECGA 3RWHA 5I18L 1CGSH 1MFUA 1VFBB 3EHBB 5T3ZD 1AFVH 4PG9B 4BJLA 1SBBA 1FL6B 2XZQH 2ZX6A 1NAML 2HJLB 3TBVB 1U8LB 2C1OA 1PZSA 2W0FB 4PJEA 1NAKL 4NN6B 4QTHA 4WEEA 5KBNC 5IFAH 4DO6A 1QSED 4RFNB 1K3ZA 1Q0XH 4QRPB 4YL9A 3G9VA 1FLRL 1OGAD 4ICXA 2ZNWA 1COBA 2Y1ZA 4HJGA 4XCEB 2R2EB 4PBVC 3VI3B 5IVNA 3BCFA 1FO0A 3CLFH 2G2NA 1U2YA 1YC7A 2NXZD 2V17L 3IFLL 3N5AA 5D7IA 2ZWYA 5FGBC 2C3WA 5FO8A 1NCGA 3DSNB 5BUGA 2X1XR 5AYUH 1ZHNA 3S97C 1TQWA 2GB2A 1S9XB 3BD5A 5JW4R 4WWKC 5H8DA 2ZXWB 3OV6A 3ZHKA 3HLAB 2IAAC 2Y7NA 3C5ZC 3P4LA 4MCZA 3F00A 1DVYA 2KI6A 1HAWA 1NMCB 5T1DH 5DJDB 4JL1A 5KVDE 1T03L 3QH3B 1GGBL 1NQBA 5DO8A 3CDCA 1MRFL 4ONHA 2D7QA 2GSIB 5GGVH 3SDAD 1SHMA 1MRDL 3F64A 4DP6X 5JIMA 4B9GA 3LH9A 5IGXL 4J3TA 1MCNA 1KXTB 4N2NA 2AHIA 1GMEA 2VDMH 4HMCA 3WUWG 2OMWA 1E2WA 4FXKA 3CMOH 2L04A 4Z3JA 1YPZB 3V0WL 3P3YA 3DV6A 4DGIL 4YQXH 2Y6SC 2IFFL 5MEPB 2QLYA 3WIIH 3BZEA 3DJTA 1WIPA 4M6OL 1NCNA 4ONGL 5B7MA 2WN2A 5I17B 3IVKB 2I9LB 5I19H 3VXMA 4WNSA 2J44A 3QEQA 1EEZB 4Y8AA 1I1AA 5GQBA 4YGVB 2GBVA 3MLSL 3P9MB 4JS7A 2J8UF 1JAEA 1YEHL 4HJ1A 1OCOB 2IANB 1KTJA 3ZYIA 4NSKB 1BVKB 5DHYA 4NO3B 2OYPA 1KV3A 2K7PA 1JWUA 3AREB 2VL4A 1HDMB 4MMXA 3O8XB 4KNTA 4WK4B 3NP3A 3VFTA 4EIZC 4OSUL 3GZOA 1JUFB 1L5GA 5F96L 1DE4A 4TNWK 4QKXB 3S34H 5JW4Q 5J5EA 2X70B 3RWJB 3T4YB 4WWKD 1O7VA 5A7EA 5F9JA 3PJSB 5E4EB 5I2IB 1I8MA 3C5ZD 1IE4A 3WS3B 1S7RA 1RJLB 4KROB 3SJVA 2NDFA 3WFDL 1A9EB 3VD0A 4IBUA 4HFWA 4QHPA 1R24A 4M61A 4G9FA 3EBIA 5T5NF 4L4TA 3EFFA 1RK0B 3LH8A 1WBXB 3O3BB 2A6IB 4MWFA 2W0PA 1T4KA 1F3JA 1K5NB 3BVNA 1A1NA 2WLJA 3HG3A 5AAMA 2YGQA 5KSAB 4PY8J 1KYFA 2AEPH 4LVHC 5C0BB 5DI8B 3HAEH 4L37A 2R8SL 3EYUH 3O2VL 3K80A 3FQ1A 3CPLB 4OZGA 1HCZA 3AABA 1DVFC 3HS8A 5DHMC 3LYRA 5HJGA 5GHWL 35C8H 3FTGB 1IZJA 2W0KA 3QCTH 4KZEL 2XWTB 2Y6SD 2E5EA 3K2IA 4FQCL 5EEZA 2C7UB 4PI2A 5SX4H 1OEZW 3QFDA 4J4PA 4LSRH 4OZIE 2HH0L 5HHNB 2P45B 2VXQA 3GSNH 2RGSA 5EZPA 1EMTL 3DHUA 4FMVA 2Q7YA 2Q3ZA 1F41A 3CFTA 4CU8A 2IADA 1OD7A 5JO5A 3IS0X 1ZLEA 3BAEL 1MG3C 4OCXL 3MV8D 3OKOB 1JGUH 5KANG 3QZNA 3VQLA 2IDFA 4PHXA 4BKTC 3PWPB 3O41B 3EO1B 4ZMVA 4OT1L 3FHAA 4XOEA 2DBJA 4GQZA 1FNFA 5ERWB 5HBBA 4HH8A 4Y1AA 3DX7B 2YEVB 2XFXB 3MZGB 1JYWA 1RIHH 4XNQB 3B6SB 4NKDB 1JXFA 2JJVA 1RPQA 3MLTA 3KYKH 4F2MA 2X9XA 5KAQF 2IVFC 4DWHA 2OMXB 1MQ8A 1JNNH 3KJ6H 4N0CC 3OLEA 1AO7B 4P46B 3ZOAA 3MLZH 5DUML 3RWIB 4FABH 4GUPA 2YD4A 3K46A 3AAZB 2M1KA 4P9MH 4DO4A 3QIWC 4MNGA 4L0YA 4WCYL 4LFHG 1EXGA 3LKNA 1XH3A 5DD5L 1RFDH 1ZS2A 3WHE0 1PIGA 4BSWA 2MEJB 4J1UA 5IHZA 5TK2A 1MRCH 4NDMB 1T20B 3PWLB 4UQDA 1ZHBA 5I6MA 2CJSA 3W3BA 4CRPA 2NPLX 4GEJA 1U6AH 3ZDZE 1CDBA 1C1EL 4FFZA 1VFOA 1RZKC 4Z78B 3MZTA 1DVFD 4UQAA 1KCSH 4HIIB 3WTWA 3DA0A 4E0RB 2BRQA 3GMMA 2I69A 3Q6GH 2R56L 4HEMA 4OR1A 3GRWH 1TQVA 2DQGL 2QZQA 5EUKA 1OAQH 4KJWC 3KYMB 4AW4A 5CD3B 3RVXD 2KERA 2JJSC 4YOKA 4JRYE 2UWEB 1UQSA 3U6RB 4DKEL 4XP4H 4GRWE 2LQRA 5DZAA 4GIOA 5KTEL 4BFIB 2CHNA 4FG6C 3L16A 5KS9B 3MV9E 4Z8FH 3C60A 4HJEA 3RNQA 4X4YA 1HOEA 3GSXB 3CZFB 4JHWH 3AT9A 4F15C 4PRIE 5JQHC 1IM3D 4FHKA 4MD4B 5K9JL 1CBVL 2H1PL 2ITEA 4LF3A 2ESVE 3QCVL 4QKTA 3CZUB 4LK4A 4JPIB 4BIKA 4PY7B 5D2NE 4N0CD 3CDZB 2DQ6A 5D1XC 6CGTA 1OTSC 1ZSDA 1E9OA 1KCUL 3TEWA 3ZE1F 3HMXL 3MRKA 2CKBB 3BOVA 3ULVD 3QIWD 2OL3L 1KGUA 3KH3A 4PJHB 5CAYB 1DVQA 5DEFA 1TTGA 3O9WA 2VM9A 1RZJC 3SPIA 3QZBA 4AEEA 1F4YL 2VXVH 1YECL 1CFMA 4FQJH 4Q58C 3BH8A 3MUY1 4OB5H 1BXAA 5FC9A 3BE1H 3LXBA 3QUGA 5DURD 2D4FA 5FGCB 1RK7A 5ANHA 4Y2NA 1PZ3A 1AKJD 4I3GA 5B3JF 5I71B 1F02I 5CIPH 1S9KC 1XDYA 2B4CC 4R90L 4XH2A 1A3QA 1RIVL 3SDXE 2GJ6A 5GJSL 3P0YH 3TJEH 1CTOA 4JFQB 3HG1D 4OKVA 1A7BA 2XETA 3BLPX 3S36H 3X1EA 1D2OA 1S7TA 3UTZB 1QLRB 1A3RH 4YUEH 4Z3FA 4K7PH 1BWWA 2AXFA 4OLUH 3N42F 5GGSY 3QEGL 4TQEL 4TSAL 3F05A 3E8UH 1UJ3B 2XG4A 2K3TA 4CADB 2B39A 3DX8B 1IKNA 2PP9A 2E27H 1FH2A 1I7TA 1DJGA 3MLVL 1PCXA 1IC4H 4MHHG 1XR9B 1I8IA 4HWUA 1RMFH 1ZLWK 5KSVA 1KJ2A 1T0MB 2IG2L 2Z65C 4NQQA 2N01B 2F74A 5DHXB 5E6RB 2XNAA 1FIGL 3MR9A 2E6QA 3EO0B 3L4VA 2WTRA 2VAJA 3AG4B 4PRPB 4KH2A 3SE4A 3QUXB 4XNUL 4J3VA 1XV8A 1A7NH 3QZWG 3QO1A 2VDKB 4XCNA 4C56A 5I5MA 1BA9A 5JPMA 1GGCH 2G9HA 3QCUL 3D39D 5CKGA 1PAZA 5F97E 5A2AA 5DR5L 3OKDB 3ISYA 1V54B 1XSKA 5BS0E 1GY1A 2J71A 1N64H 4DESA 3QRGL 1KELL 1NGXB 4L5FE 1QSVA 1JGDB 1XGRB 2YGVA 3KBFA 1ZS8A 5CJQL 4M03A 3EOTH 3OWEA 3RB7A 4TUJB 4B96A 5I1KH 4JLRB 3L5IA 2NY1D 5B38A 4YH6A 2WLYA 4F7CB 3GYRA 1EAPB 4CVXB 3DO7A 2XLLA 2Y7QB 3WHXB 3SPJA 5FR3A 3IJYA 4F7EA 5AZ2L 4EI5A 2VSMB 2YA1A 3KCWA 2JMRA 5LO7A 3VD1A 3MA9H 4N1EA 3E6FA 4UT9A 5D6CA 3ZZQA 4UAHA 3NFSH 3QUYD 3F7YA 4YSRA 2JFCA 5K1JA 4UDUB 1VF5C 2X4UB 1NKGA 3GHPA 4PB0L 5F7AA 3H9SD 3RX5A 4CKVX 1IC5L 4W68A 5CZRA 1TETH 5KYWB 2ZP9A 3PWUA 3UTQA 5CLXA 4M93C 4ZS7H 2JJTA 4LKXA 4PGEB 1A7RH 4JO4H 3ZTJH 1BIIA 5E7BA 5FIEA 1U58B 4JHVA 1PW3A 4J3UA 3QJXA 1LLAA 2FH8A 1J18A 5EMYA 1Q9WA 1Y7VA 2DWXA 2HCZX 1H3XA 3O4LA 2WUBH 4JPKL 4O02A 1QHQA 2VUOA 4K3GA 1H6TA 3DKHA 3GSUB 3TBYB 2EICA 1KDIA 3MRQA 5LAXA 2TRYA 2WMPA 3VGEA 4MJJA 1UD3A 4O5LH 4MTMA 1U93B 2ZWSA 3MNWA 4H7VA 2CK2A 3GS0A 3T6XA 2P5WE 5EBGA 4Y16A 1E3XA 2C34A 2ZOLB 3MUUA 1ZK5A 4M02A 1PY0A 1UACL 1VEMA 4HS3A 25C8H 5IK3B 5IG7A 1IAKB 5EEVA 1WIOA 3G08A 4YHZL 3OXSA 5F72S 3GSOA 3T04D 3GUFA 5IJKA 1JYVA 4LLQB 1GL4B 1JGEA 3N0AA 1BQHG 3P4NB 1L9QA 1S7VB 2Z8RA 3KS0H 4BRVA 4GPVA 5F8RC 4L18A 1BMWA 1F18A 3L3OC 5FO9A 1LL1A 5IT2L 1QO3A 3E1ZA 4XODA 1U3HA 2WQ8A 3AB0C 3STZB 5IW3A 4L3CB 3TFKD 1KBPA 2WLMA 5HY9A 3GC3A 4GSUA 1KTCA 3CHRA 4JVPA 4PP1C 3T3PB 4XP6H 4ALAL 2BSED 2Z7ZA 3LKPB 4XZUB 1TZ8A 4DP8X 3C5SB 4PS3A 2UY7B 1YUHA 3F84A 2DYPB 4W9KC 2JXMA 2DLIA 2OXHA 4L8CB 3JV6A 1L6PA 1L9OA 3ULSB 3VWJA 5GZNC 4I0PA 1XHHA 5BRZD 1U8CB 4R4FH 4Y8DC 2DQDH 3GZPA 7FABL 3QXUA 4JMNA 3SQBB 1N6VA 5I15H 4N2FA 3DPBA 4XI5D 4ZMTA 1RH8A 4PJ8A 1QFWL 3OLIA 1JGVH 3R4RA 2FJGA 4WY7L 1L7TL 4M43L 3SDDC 1A6UL 4OGXH 1HSAB 4GKZA 2DJMA 3QJSB 2ERJC 1I82A 3SOTA 2XKNB 4DQAA 2EYRA 4JFXB 3MPCA 4RGMC 5JMRA 2QKIA 1MIEH 4KK9C 3IDIA 5FOBB 5IMLA 2VABB 5T1JA 1EHKB 1GOFA 4I18A 5HYIA 4GRWH 4UNUA 3MXWL 2CXKA 3BJ91 3IDYB 4X6CB 4X2UA 1AXTH 2XXGA 3RDJA 1SUHA 3GHEH 1KXVC 4ZFZA 4WTZG 1A6TA 3P9LB 4ZK8A 2FEDC 1K85A 4XXDB 3CUPB 5D1QB 2FGWH 3CE1A 4UZGA 2UYLB 4PJBE 3C6LA 4GUOA 2IH8A 5EV7A 5E00B 4DGYH 3QQNA 2F53B 5KVMC 2OXGB 1T89C 1X9UA 4ANUA 1NGQL 4DOHB 3KNBB 1YG9A 3IS1X 5HDQH 4Q9CA 1WAPA 4DVRH 4PP1D 4HEPA 3MV7B 4LQ1A 1RZIB 3BUYA 3EYVA 1WAEA 2WLNA 4QMEA 5F1IB 4LVEA 5I66B 5IB4A 1HKLH 3J07A 3MNVA 5DUPL 2YUZA 4IKKA 4LCVA 4D0BB 2YFNA 5KVFH 1YNTF 2PPDA 1MWAA 1EXUA 1MXDA 5FO7A 4K5MA 5GZND 4E42B 5GZOA 3LKOA 2WVVB 4WEBL 5TFSH 1KTDB 2IH9A 3M1BA 2Z0UA 3ZL2A 4NM4H 4TM9A 3WI9A 5JYLA 2CE6A 4QOKD 3LDBC 4TRPL 5I28A 5LGHL 3SDDD 5CSGA 3B5GA 4IW4C 1DBAL 2J8OA 1NFDB 5ADPH 4XP5L 1X9LA 1IARB 2B3IA 2M8XA 4FD0A 4L8DB 4PJEE 4TSCH 5BNXD 1OQXA 3PHQA 1MFVA 3OKNA 4X4XA 4KK9D 3JWOL 1E2ZA 1QSZA 4Y89A 5D4QA 4LSTL 4AIZA 4XP1H 1CICA 2EDFA 4LLVB 1D5ZB 2XJLA 3KMDA 5FYJE 1MFNA 2ICWA 3SDCA 4K3JH 1BJ1H 3RA7L 1VB9A 2YRLA 3VA2C 1RCYA 3L95A 1RY7B 4LLUB 1FYTD 3IKCA 5D7IE 1NMAH 5ICXB 3HFML 4FA6A 1QSFD 5I0XA 2X0UA 1IRAY 4NHCH 3LEVH 1Z9PA 2PR4H 2X09A 1U8HB 3LTVA 1TSRA 2HRGA 2F5AL 3GIVA 2JKRM 1YNTA 3UBHA 3TZVA 4KV5E 1WUNT 2VZVA 4R0LA 3BKMH 1P4BH 4DP7X 1X5XA 4LPXA 3U9UB 4H20L 4ZYKB 5E6ZA 5DUJA 3RVUC 1SDDB 2E7HA 3SQOH 2E9WA 4FJYA 3ARFD 3FT9A 5EG6C 2DQUH 4TUOB 1ZIBA 1U8OB 1XF3B 2MNUA 4X6FB 2VLJE 2F8OA 4IU2B 1LDSA 4XPHH 4F91B 5FW7A 4L5FH 2A0LC 4M1CC 1JPFA 1J87A 3Q8FA 1IT9L 3RYMA 2MH4A 4YZWA 2EIJB 1Q0EA 3VXNA 4GAAA 4X80L 3V10A 1OWRM 5F1NB 5C3IA 1E4XI 1MHEB 1RV6X 3BAIA 5IESL 2RQ8A 1QSEA 4MS6A 1X44A 3U6XA 5IJVB 4PJIF 1GH7A 3DROA 1FDLL 1FV1A 1OGAA 3MOQA 4FFYL 2DTML 1ADQH 4RGOH 5IVZA 5EOTA 1UM4L 4JQVA 3TO4B 2PXYB 2ZOWA 4ZPVA 4LMQE 5JPNC 3T6VA 4LT7A 4CVUA 4KNUA 2HT2C 1IZKA 1DBML 4UAOC 5SWQB 1T04A 1XSOA 4KJQC 3B83A 3DDGA 3GLAA 5T3XD 3B43A 3WMSA 1KB5A 2Y06H 3ZKMD 2DY2A 3DBSA 4NNYB 2EC9U 5EZLA 2YPLB 3S3SA 4PJFE 1ZEAH 4GBXC 1KN4H 5JIDA 2A1WH 4NKMA 4XAWH 2O6PA 3VFVA 3MGTB 4KI5D 3BZFA 4LO9A 2FE0A 2JELL 1Y6KR 1HJBC 3KZ8A 1FFTB 3SJVE 1DJXA 4FKKA 3RVUD 4N8VG 1J9SA 2AK1L 4G9FE 4W6XB 4JFHD 5JW3L 1ZTXL 3ZHNA 4A55A 5LGJA 1HE8A 5FUOH 3SDAA 3BWUF 1QMUA 1PX4A 2B0SH 2ZT9C 2AI0H 2A0LD 4YDMA 4M1CD 2ZONA 3VQ1C 3BX7C 2P8PA 4ZSOB 3V2AR 1FG9C 3VFUA 5SX5K 1U21A 4OZGE 2A6JB 3CXHJ 5ID0B 4NGHL 5TTRA 4PP2A 4AEIH 2JIXD 2IOOA 2C9QA 4OLXH 3V9EA 1KBVA 3SKJH 1P4LA 1J8KA 4V2CB 3BHBB 4CJ0A 4H8HA 3VXPB 2YQGA 3FQWA 1HWHB 1L6ZA 2P46B 4A6YA 3P02A 4JG0L 1HZLA 1XMEB 2W0LA 4Z18A 1R5IA 4PWFA 4QXWA 4XCFL 3BAYA 1S9YA 2BFVL 2Y3NA 4YBLB 4EF3A 3TEUA 4L8BB 5FGBA 3TA3C 1B6UA 5J11B 2HT2D 4OCNC 3MCG1 2NYYC 3A4EA 4KJQD 4AV0A 1FNSL 2J2ZA 1E4JA 4EZLA 3BP4B 4PJXF 4K9EH 2XZAL 3QNZB 5HGBB 3TTYA 2NX5D 3GO1H 4HS6A 2AK4D 3KPSD 1KZQA 4XP9H 3WLBB 2AXGB 5FM5M 3JQOB 4CBPA 3AY4C 3U9PL 1AGDA 4IEFA 4WWKA 4E36A 4F2ME 3CLEH 3BSGA 3HZ3A 3C5ZA 1XSJA 1PZDA 1NOFA 2XN1A 4EDXB 2PCPA 1AZUA 1QLEL 4MJ5B 4PTTB 4Q9RH 4N8VB 1ET8A 3B3IA 1H3UA 4E9XA 1KJ3L 4GW1A 2Q20A 1AQ8A 1KCVL 3WNIA 2EVIA 1JN6A 3NTCL 4QRRD 3K4AA 4JM2B 1VACA 3IJSB 2IMMA 2HLFC 2XYCA 3IDXH 4HKXB 4N5EC 5HXMA 1M53A 4ZG1A 1MFBH 1FVDA 2YN5A 4P2OC 5EO1B 1CYXA 1MJ7H 3ZSTA 1BOGA 3MLYL 1TKWB 3VUAA 3GSQA 3BPOC 1SY6A 1JGIA 1RAMA 2F5BL 4X5QA 1GTNA 2VSKB 4R7NB 4K4KA 4P2QB 1O6SB 3QXDB 1S9WA 3OD3A 1KEMH 3T0ED 3ABLB 4GG8B 2V6HA 2B08A 3ZK0A 2ZXGA 4PJXA 3P30H 3FO1A 4ISVB 3BPNC 3MV8A 2ICES 1X5JA 3CD4A 4OQTA 2CLZB 2OW6A 3ZKNC 1BM3L 2E7DA 1DSWA 1K2DA 4MASA 3ZIMA 4QR7A 5BXFA 2NYYD 4HLZG 4DF9A 3KPRD 4P99A 1S7SB 4FCHA 4HWBA 5DSCB 2F7RA 3WN5C 3R06B 2LOEA 4M8QB 3TPUB 2BP8B 3UABA 3WSQL 5E9AA 3L1OH 1AD9B 5MENB 1G6RL 4TULL 1PNCA 1OAYL 4N8CL 3IU4H 3LRGA 5AOLA 1AAJA 4A7TA 1V3MA 5GRWA 3S37X 4PU2A 1JZ4A 4WNJA 3CK0H 5I0VA 2EINB 1CD1A 3V9CA 3K91A 4HSQA 1LNUA 2IALB 4LARH 3B1UA 1KWKA 2H3NB 4OI7A 2HLFD 2EIEA 1P2CA 3MGOA 1FZJB 4N5ED 3RWDA 4G7QB 3F58H 1D7BA 5FYJH 2GAZA 2GBTA 4OKDA 3GM0A 1NA8A 1FO0H 1DVFA 1N7MH 1AY1H 2AV7A 3NCXA 1ZE3H 3ARBC 3VYNA 3CCHA 4AYBA 1BZ7B 4CMMA 2XG5A 2GJ6E 4Y4FD 1NEZB 4ZD3L 3WJMB 5C0AB 5BVJB 5E7FA 1TPXC 1M71A 4ALAC 2EE0A 1FCGA 3LEXA 1KYOJ 2WNXA 1XF5A 3INUH 5KYXB 3DXAD 1DQDH 5DRZB 1IU1A 2JNZA 2PTTA 1WFNA 2V5YA 4UNTA 4D7PA 3BKCH 3AS2A 4WJG3 1MIMH 2QVKA 2VLME 1E28A 1IM3A 1SYVA 3MBED 1FFOB 3KGUA 1NCDL 3FCBA 3FKUS 2OFQA 1A8ZA 5D8JH 2FHBA 5F44A 4X0KA 3S88L 2K6YA 5ALCH 4PVMA 1CU4L 2F58L 4FI7A 4AYDC 1WAAA 2Q1EA 5EOCH 3PABB 4QNPE 1J1XH 2AQTA 3VDAA 4BDVB 3GK8L 1Q1JL 2XIIA 3QIWA 1I3RB 3PLYA 4JQIL 3QO0B 1MW0A 3QDJD 4LCUA 4QJ4B 3HE7C 3TXAA 2ITDB 4XMPH 2P28B 3QQXA 4XN7A 3SYQA 3FZUC 5AD0B 2EDBA 1ID5I 3ARSA 4AYID 4B0MM 5KSBF 1C08B 1AACA 1J12A 1JV2B 4B7LA 2AV1B 2XICA 1YQVL 4KDVA 4KRPC 4KNSA 2Q76B 4CA4A 3N1MC 3CJJA 3ARBD 2YOAA 2AQQA 4YZFF 4OLZH 4DGUA 1AKJA 1MCEA 4N22A 2Q87A 1JZ2A 3HC4H 5T5FA 1UB6B 3VFMA 4W9EC 1TMCB 2BINA 2JB5L 5MERB 4MXQC 2XU9A 2H8PA 2DL2A 3H7LA 3O0RL 4PREB 1R5VB 3HG1A 3L7FA 3KLLA 3TBCA 1OOAA 4LVOC 1QBLL 4O2EB 3U4EA 1N5AA 5K9OB 1GKOA 1TNMA 4ELDA 3S4SA 1JPGA 1Z6JT 2YEZB 5DWUL 5EPMA 2AJSL 2GCYB 4H1LB 2QGEA 1PTZA 1JPSH 1VERA 5LNGA 3GMQA 3US0A 4Q8BA 1U3ZA 2A6KA 4ABUA 4HGMA 1MHCA 1CE1H 2BK8A 2VH5H 2D31A 4ZZFA 2VDLH 2H32B 4P59H 4B9FA 1OCWH 4GW5B 4M6NL 1KBGL 2TSBA 3CU1A 4NT6A 3DUHA 4S2SA 3FK3A 2YXFA 3O4LE 4GAGH 2BNRD 3D85D 3EYOA 4NO2A 5EZOL 3DRTA 3JWOC 4I4WA 3IDGB 2CHZA 1PLGL 4E9TA 3HE7D 3Q43A 3VVVA 2BSSB 3FJTA 2SEBA 1XD1A 3D39A 2VXQH 5DC9B 3FZUD 2VDOH 4YSSA 1TENA 4IHOB 1UM6H 2NT0A 3DHMA 4L3EB 3JYBA 2E7BA 3K1DA 5AG9A 2IPTL 1W16A 3LEYL 4HJIA 4KRPD 3MRGB 1AOHA 2VZ3A 2DLFH 4LKCB 3UGUA 1X5GA 4G7YL 5GGRA 4F2FA 5C0IA 4W9ZA 3BPCB 3FOLA 1MI5D 3K0WA 5K39A 4YSEA 1XBRA 4MXQD 4U1HA 5JHAA 1BEYH 5DEGB 5DA4A 4P9HL 4RFEB 2D73A 4FZ8L 4L2LA 3FCSA 3JTTA 4B9IA 1J0HA 3EH5B 3JWNE 1J0KA 2YAHA 2J55A 2MKLC 5DS8A 2H1XA 3UZEC 4Z7WB 3FO9A 1H15B 4XC1L 4G6JH 2DIEA 1CYWA 1X6LA 4Z7VB 2J5LB 3H9SA 3JTBA 5C09D 3FRUB 3S96A 2K6WA 3N1PC 1J9QA 5DDHB 1FFPA 1F56A 3LN5A 4ES8A 1FFRA 5M95B 2C5DC 1E3ZA 2X6AA 3AU0A 3DX0A 2R0LH 3FU6A 3H8NA 2JCWA 5AKTA 2X0VA 3RVTC 3T1WA 2XWRA 4FFZH 4AXWB 5BW7C 4OF7A 3EUDA 1HHGB 4AQAA 1CGYA 3RL1B 2BY3A 4MKMA 3F7VB 2WHVA 4TQIA 1P1ZB 4YE4H 2AQSA 1HNFA 2BVQA 3N1FC 5E8PB 1LK3L 2CCWA 4MA8H 3D1MC 4U6HB 4WO0A 3KLAB 3U1SH 5C7XL 2Z31B 4LFHD 1HZKA 1R47A 2OMUB 2YGPA 3CX5K 4YDLB 4PRHD 4DUXA 3WEMA 4Z7NF 2O6FA 3ES6B 3L13A 5M94B 4OCYL 1H6FA 1LYQA 1QZNA 3EG9A 4LCWE 4ELME 2EEXA 3RZWA 1HHKB 3D05A 5E6YA 2ZAGA 4JANA 3LVEA 2HFFB 4NHUA 2CLVB 2XZCH 2ZCKH 5L8KB 1I3UA 2UVEA 3JVGC 4K5LA 2FJHA 2YQ2A 3V0VB 5CBEB 1CFSB 3GXIA 2Z0BA 3AT0A 4PV8A 1YNKL 5JIKA 5BO1L 3WKYA 5AB0A 3HG2A 1OZTG 1H8NA 2BSEA 4F8TA 3AS0A 3GSVB 3ZY7A 2V5SA 3H9HB 4LLMB 4FI8A 2EDXA 4Z3GA 5IW6B 4IGBC 1DEEA 3RGHA 4YIQA 3ZW3A 2QQLH 3FCTB 3QQ3A 4AEFA 3ATBA 3ARDB 5GGTL 1MCWW 4OGZA 4KXZI 5BRZA 2L7UA 3RVTD 5IW1A 1P7HL 5I73C 2HRPL 3GLZA 4S1SH 1CLYH 4GRLB 1NAMA 4IRSC 4U1GC 2R0KL 2ICEC 1PKQE 1JF1B 5AVYB 2R83A 3RE0A 1I9JH 3LOWA 2VDQB 3E1F1 3QI9B 3IMSA 3KPPB 3FN9A 3DJRA 5D2LB 4F57L 1BQLL 1S46A 4ZUUA 4WJ5B 4C4UA 1JFHA 3B9KB 5CZXC 1EHLL 4WFED 3FFOA 2Y2TA 2HWZH 4FS0A 3PFUA 2R0ZL 3SB3A 3U7AA 4BSVA 1NDTA 1QATA 2PUQT 3L9RB 2QT6A 4LCCC 4A7GF 4OIIH 1OV8A 3L3OA 2AJ3B 1R1CA 1ZK9A 5D96C 4DUWA 1KGIA 1KJ2H 1LM8V 3KCPA 3T8VA 3L3HA 4KO6A 5I1HH 3AWEA 3ENEA 4YDZA 4YWGL 1BGXL 5AKSA 2VQ1B 4ZDHB 4F58L 5EZIL 2GSGA 2WO4A 3ORJA 4AYFA 3QUZB 3IFPA 3FUHA 2VLRD 1XF2A 3JT0A 4PV9B 4WUKH 4FYTA 3Q13A 4GFXA 3U7WH 4IGBD 3VGFA 1VFUA 5I1DB 2KUTA 5CLTA 1XR8A 5F0LB 1F58L 3BWZA 1OCCB 3NJJA 3DTXA 5GZNA 4PGBA 2KQNA 4X98B 3T77B 3CV5A 3V4VB 4IRSD 2VRKA 1PD1A 2A74B 1F13A 4QOKA 5T3ZE 3SDDA 1NCCL 4YR6B 4AIOA 2OPCA 2EUVA 4QD2E 2X2HA 2D7NA 2ATPB 2L0DA 3ZO9A 1AC6A 4KKAC 2X4OA 3TWYA 1QSEE 3V52L 5D72H 3WTTA 3V7AE 3HAEG 4ZTPH 3X3FL 2RFXA 1OGAE 4K71B 3W9DB 3RPIB 5BCAA 3TCTA 1JP5A 1AP2B 2EEDA 3BKYH 4UT9H 2AJUL 5CZXD 5DTFA 3WFEH 1IIKA 1KXVA 4LVNB 5FYLL 2YBRB 1NPJA 3VFSB 1W80A 3TM6A 1FYTA 2D7TH 3Q44A 1I85C 3QJFB 1QSFA 4TKWA 2X4SB 2O61B 5F21B 1K4CA 1J88A 4HJJL 1TJIL 1ZLSH 1T89A 1U92B 3G6JF 1J05A 2X28A 3MRPA 3SKMB 4YPGB 1ZT7A 4LLYA 2IFGA 3VXTB 2EVFA 4AX3A 3ZTNL 4O02H 3ZL4L 2Y2WA 1MJUH 1OE2A 2IDUA 2NUTB 3B4NA 4NUGL 5IMKA 2V2XA 5E94B 5JDSB 5DS2A 3IF1B 2HVJA 3PV7A 4JFDB 4JZJC 4AL8H 3ARFA 1JHKL 3OVUB 3APDA 4Z77A 2DQJH 4KZCA 3FHQA 3CN0A 2XWEA 4LP4A 4RMWA 1TYJA 4LSVL 3E3QE 2WZPD 4A37A 3JWDH 2GTQA 3VYOA 5JHDD 4LL9A 3G5YA 1CLVA 2KPWA 4MJID 3QR0A 4A2EA 2NXYC 3CBJB 2VZ1A 4HGWA 4KY1L 4I0CC 1HQRB 5E6UB 4DO5A 4XNYH 5B39G 3S5LA 2IDCA 2EXYC 2DQIL 3FW6A 4KKAD 4PVLA 4ZS6C 3W2DH 3GBNL 2CCLA 3I50L 4YVUA 3CVHL 4XAKD 3TYGH 2FX8L 3JWNH 3V6ZA 2XVKA 1S7UA 3Q9PA 1WZ1L 1DQML 4NQDE 2GK0A 2JLPA 2WINA 3OHXB 3BUQA 3G6JA 3FTYA 4KTEH 2W38A 1OIOA 4L29B 4PJAF 1MZZA 5HJ3B 5C07B 3ZZ1A 1E5YA 2N1TE 3FU7A 3ZGIA 4OFVA 3GSNB 5JIHA 4B5ZA 3KPQB 2BNUA 4HV8B 1MJJB 2Z91A 3WXVL 3BDYL 4NO0B 5E99L 2AVFA 1NDGB 1W72A 1XB6A 1MFDL 4JPSA 1MUJA 4NBXB 3HMWL 4R7XA 1W6LA 4M7ZB 3KEDA 5FA4A 3ABKB 2FLBT 1A0QL 3STLA 4R4NC 4L1TA 5FCUL 4C57C 3WE6A 3V5KB 2DQHH 4FNRA 3HB3C 3S0PA 1RLWA 4J5VA 1EZLA 4E9QA 2OV0A 3CLWA 3ZT5A 1CFVL 1SBSH 3D0LB 3M17B 4QRBA 1MELA 3G6AA 2CA4A 2AGJH 2ALAA 3HN5A 2I9TA 1T1WA 1ZT4B 2AXWA 1UCTA 4X7SH 5TE4L 3DURA 4YSPA 2NXYD 1G1KA 4YN3A 5CLYA 4JPQA 4M4PA 2NW2A 1PDKA 1DDTA 1VGEH 1J5OL 1FFNB 1EJ8A 1YNLL 2BS9A 3D87B 2OX5A 4PJ7B 1A3LH 1LWRA 1OWWA 2BC4B 3J7HA 5HHMD 4QO1B 4BFFA 1UD5A 4ZS6D 5KBDA 4G3YL 5E8EB 3KBPA 4JY4B 5I30H 1OAKH 2IOMA 3REWB 3CFJB 1OAJA 3LPPA 3MA7B 3F2LA 5ESVB 1AXIB 3PPSA 3RWEB 4FHBD 2F6AA 4LCYB 4UM8A 3G6DH 1X7SA 4EOWL 5JPNA 3UZQB 1HE7A 3AY2A 4EZKA 3LS4L 4KTGA 3T65A 1FAIH 1MWAH 2Q8BL 4N0YL 4PJDF 4TSBH 1H3VA 3W39A 5J9PA 2F8XC 2HTKC 2NX5A 2J88H 3LNFA 2AK4A 3KPSA 4LGRB 1O9VA 3HMXA 3V0IA 1TZAA 3ZDXE 4HWZA 1I7UA 2V2WB 4GXUM 3M07A 1Z9SA 2OL3A 4NJ9L 4G8IA 3LB6D 5C6TH 1E5AA 1UWGH 4H26A 5IB2B 5DU7A 2XUWA 1NH6A 4DK3A 3HB3D 3S3DB 4PJ5B 4QRRA 2R1WA 2AABL 2AEQH 1MCOL 3P40A 5ESAB 5ITBL 4PMFA 1UWEL 4PTUB 5F3HB 3W9EA 3FQNB 3MKKA 3IMWA 2FYYB 2CIKB 1RUAL 5E08H 2F68X 3ERXA 1TQCB 3A4DA 2QQNL 1QKZH 4NX0A 3S35H 5GS1C 3TCLB 3U48A 3QFJD 2FATL 4AVIA 3OHMB 1A7QL 1JRHL 5K59F 2KYIA 4ZAKD 1DZ0A 2JK5A 1UFGA 2J43A 1VGKA 1N8ZB 2Z3FA 1PNDA 2NTFB 3PNWA 3T0EA 5IEHA 1N19A 3FUIA 4FFVC 2HUHA 1JPEA 4PJDA 1HOCB 1OARH 3QZMA 1QAWA 2YKLL 4WGVB 1AHKA 3U2SA 5CIPB 3X11B 4YHLL 3RG1C 1LO0L 5KZCD 3KPRA 2NDGA 3LRLA 3OJMB 5AEAA 2A83B 2OULB 3WFZA 2NY2B 2ITCB 2Z7YA 4P23D 4TUKH 3MRIB 4WTWA 1CD0A 3T3ME 1AXSA 2XZQL 4KX7A 5AVVB 2W95A 3FFDA 4I88A 4X42A 4W81A 4ADIA 4Z0BH 2NY0B 2A9CA 1WAAE 5T3ZH 1ZHKA 2N4IA 5HVGB 1GTFA 4MA3B 4IOSD 1PGRB 3ULVE 3ME0A 1YY9C 4KX9A 3UTPD 4KHTH 4YFEA 4GW4B 4BXSV 4WFHD 5I16B 1OTUC 2PWEA 4IBZA 5EWIL 5HHPB 3ML9A 4G59C 3I9GL 1TZIB 5E5UB 1BFVH 1PJWA 1G9HA 3NZHH 2R69A 3MYJB 3X12B 1Z1WA 4KJYA 1UGNA 1EVUA 2O5YL 3Q3GA 5HDBE 1B0RA 2SODB 2F8IA 1A1OA 1KXQA 2CD0A 3GZQA 1RHFA 1SYSB 3DI3B 2K45A 2NY4D 4WHYH 1KB5H 4TXVB 4U1MA 4JREB 3INOA 4QHUB 1E8XA 3FT1A 3VU1A 3RL2A 4FFVD 2AKRA 1YYML 4AQOA 1K8DA 3HG1E 1USQA 1UM5H 2WVTA 5J1SC 3KXFD 4LAJH 5J1TC 5GGVL 5KOVC 3DXAA 5INCB 4EIGB 3PFQA 3SPVB 5L0QC 4HZ1A 4LRNH 2EDNA 5EIIA 5CJXC 1YDPB 1KDJA 3WN5A 5FFLA 3MBEA 4JFOA 1OP4A 1RUPH 3CMOL 3B7TA 4EXPX 3VFGH 1OP5H 3ZUNC 5B7EA 3CFKA 1B90A 4YQXL 2CUHA 1M3IA 3WIIL 1KTBA 4E9LA 3KPLB 2D0HA 3AGWA 4B50A 2JCCA 3SY6A 5I6XC 3GHBH 4HPYH 3LV3B 2ZG2A 2W65B 5I19L 4PW4A 5JHMA 3ZN6A 3BVUA 3QDJA 1YY9D 5A43C 4MD5B 4U1KA 2CDGB 1BQRA 3WIAA 5DF0A 4RMVA 5IVXF 3TC9A 3UYPA 4HP5A 4NZRL 4A6YH 5BOJA 4H2CA 5F3FA 2FNWA 4JFYA 4HZLA 1KFAH 2P8LA 3WELA 1WFIA 3IETB 3KLHC 1DN0A 1NMBH 1AQMA 2X4QA 3RLSA 1W9XA 3VRIA 32C2A 3PV6B 2PCXA 3ARBA 5GS0D 2XN2A 1BFOB 3WUWA 2Q9OA 3BCDA 2I25N 4KQ4L 2XWBB 4P4KB 5FK9A 4JO8A 5HJBA 1ZA6B 3P2TA 4XHQA 4ZMOA 3VTTA 3BT2H 3K8KA 1P6AB 2G60L 4TVPE 3L4CA 1I53A 3QJOA 3WGVB 1TVBA 1IM9A 4ETQB 1TLKA 3L45A 2BP0B 4QRUB 4F8OA 2W9EH 4LPCA 5F6HI 4AG4L 5T1LD 1JV5A 1AGEB 4G9DB 3MLXH 3MROA 4FADA 3Q8AA 4R3SA 3AQDA 3BVXA 5LBSL 5C0FB 5D71H 2FSEB 5AVTB 3QB7C 3RUGA 35C8L 3QCTL 2EUWA