3R18A

Chicken sulfite oxidase double mutant with altered activity and substrate affinity
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
373
structure length
373
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDNKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLMGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite oxidase
publication title Structure-based alteration of substrate specificity and catalytic activity of sulfite oxidase from sulfite oxidation to nitrate reduction.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 97
structure length 373
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3r18A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3r18A01
1XDYA 2C9XA 2BIIA 2CA4A 1OGPA 3R19A 3R18A 3HBQA 4PW9A 2A9DA 2CA3A 3HBPA 3HC2A 2BIHA 4PW3A 2BLFA 1SOXA 2A99A 2A9CA 3HBGA 1XDQA 2A9BA 2XTSA 2A9AA 2BPBA
chains in the Genus database with same CATH superfamily
2A9NH 2BIIA 5F71A 4AMKL 1ET5A 2FTAA 1IGYA 3QWRD 3S4SB 2ESVA 4EUPB 2P1YA 1AY1L 4MCZB 4OLWH 3ULUE 5FCUH 5IHUL 1A9BA 3VJ6B 5CJOL 3G6AA 3MBWB 2YSTA 2OYKA 1E4JA 2LU7A 1HINL 2D9CA 3E1F1 5CILL 1JOIA 4MD5B 1ZLUH 1IAOB 4O58L 3GHBH 2MCG1 4AX3A 3S2CA 1P0SE 1X9UA 1BQ5A 3WIFB 1F2QA 1NEUA 2WVSA 4Y16C 1N7ML 1QSEB 3BYTA 3TH4T 2W07B 3LN5B 3D05A 4PJ6A 5C0BB 1UVQB 2A4ZA 5BZWA 4UT6L 3HC4H 3WO4C 3BGFB 1BAFH 3VWKD 1FVEA 2AP2A 2VWEC 4KPHL 4LEBA 4DIXA 4IOSA 3LH2L 4MAUH 1Z9SA 2J4WH 3N41F 4W9ZA 5K33A 5GS0C 3ULVD 5FM5M 3IVKB 1OOAA 1CZ8H 1MCCA 3MRNB 5A7BA 3PLYA 2WVVB 1XO8A 4GAJL 4HIJB 3VI4B 4F7PA 1H19A 1VEMA 1GC1H 1ED3B 1HNGA 4HPOL 4O5LL 4QRUA 4Y4HB 2FB4H 3FFOA 1OCWH 4Z3JA 5JHLL 2B1AH 4Z7QE 1AANA 1XZ0A 2VDQH 3HKFA 2XOTA 1QA9A 3WAJA 3D34A 4OGYH 3HMXA 4Q4EA 5IF0B 1QABA 4YSDA 5EU6D 2GSGB 1FN4A 1D6EB 4WSJA 3D0VB 1F02I 4YAQA 2YD3A 1RHHB 1KJ2H 1KCKA 2GKIA 1JGVH 4Y4KA 1BBJB 1I8KA 1NCHA 2G9HB 5AYUH 3V0FA 4UQ3B 1YPZE 2J72A 1QTPA 3VRJB 2OSLA 3U1SL 4M7ZB 5E94A 4FADA 4ECNA 4X6CB 7PCYA 3L13A 3DLQR 2PCYA 2X1PA 1A7BA 4G8AC 4L4TB 1HYRC 1IE4A 1NGPH 2W9EL 4UT7H 4P2CG 1WUZA 2E46A 5DZVA 5BV7B 2VUOA 3HE6A 3MNWA 5IWLC 4UAOC 1KCVL 2LOEA 1S7WA 1U8CB 1HHJA 1IKNC 1OTSD 4OM1L 4RFEA 5ICZB 3MUGB 1VB9A 1NBCA 4E9VA 4ZO6A 3KH4A 4Y2LA 3FOMB 4NX0A 4GFTB 5L2KD 3DJRA 1D7DA 1YPZA 3PHSA 4MJID 4YL4A 4JDEA 1TXKA 3SN6N 2XV3A 5DHEA 1KB3A 3L6FA 2WTPA 3NGBB 1TSRA 4LL4A 4UMGA 2VLJB 2Q0ZX 2W1NA 5SWQA 1JXGA 1KG0B 4M6NH 2NRDA 3AG4B 4J39A 4K7FB 1UOLA 2BDNH 4P3CL 3K74B 4NAQA 4XBEH 4B27A 3BRDA 1MY7A 3VB8A 3BSZH 5CGYC 3TO4B 3UZQA 3FBKA 4IM8A 5D7KE 2H3KA 1EHNA 5I1HL 3VXPA 4DOHE 2WINB 3B8SA 1H3VA 3FJTA 1OL0A 3GSXA 1NM9A 1UQSA 3FH5A 1N6QH 4HCRA 5DK0B 4XZUB 1E5UI 4AYGA 2LGNA 5E2TH 2H26B 1FORL 2OMZB 3Q5TA 4YDJB 3V10A 4AH2B 1LK3L 3AXLB 3QAQA 4PJCE 4XI5D 1WCBB 3UABA 4E2OA 3BZEA 1RFDH 4MWFA 4HQQL 4XO3A 4JZJA 1RV6X 1AGDA 4P2RE 5T1JA 4U4IA 5D7LD 1M7UA 2YRBA 4BWWA 1YNLL 3MRQB 2WXFA 1A6VH 4GBXC 3GIZH 4GAYB 2Q3AA 2HT2C 3GDCA 1GZHA 5DS2A 1F42A 1ORSB 3L5XL 2WMPA 3CZUB 3QC6X 5DYOA 1CFSA 2WO3B 3BP6B 2O72A 3UAAA 4OTXL 5IJBC 4PJCA 1MNNA 1XX9C 1XH3A 3K72B 5T1DH 5DC2A 3SE9H 3AREC 1LJMA 1I8LC 1DYZA 3D3VB 2CO6A 3RE0A 3GDBA 2ZAHA 3EYFA 5DC0A 2BSTA 2F54B 1E8XA 1NUDA 3HZVA 3MZGB 5JHDE 2VLMD 4FCAA 4NIKB 3MLZH 4P04A 4KK5D 4JGNA 1PFOA 1IBGL 2BNRB 2ZXBA 3JVGA 3DVFA 2J6EH 2YGNA 1A22B 4UANA 1WAAF 4K23L 4RESB 2WUCL 2OYPA 5CINL 5IQ7H 1KLGA 1OSZA 5LGJA 3DETC 5F7BA 3QI9B 3GXIA 2O93L 4DKEH 4NO5B 1GYVA 2TSBA 1FLRL 4WJ5B 1WDAA 4RSYA 2WXHA 4KKLD 3OHXC 2EZ0C 3VSTA 4ZZKA 3MCYA 2DY2A 2K9UA 3QUGA 3S37X 5JHDA 2KZBA 4OKVB 1UENA 4R0LA 4Q2ZA 2YN3A 5F7LB 2HUEA 4AJVA 1ETZB 3FRPG 5CEYB 4ABQA 3FTUA 2AXGB 5TPWH 5K59F 4X98A 1EZVX 3WFCL 2BHFA 1IE5A 3FO2B 2BS9A 2WAHA 3ILPB 4M29A 5I19L 1XZWA 1JZJA 3CCHB 3L5WB 1CUOA 3RU8H 3QZMA 3KYMA 2HTLC 3MJWA 2Y7MA 3BEWB 2CO1A 1EBAA 3AS0A 1M2VA 4Z76A 1NGYB 3FL7A 4PP1C 3NBNA 3HNTL 2I9TA 1Y6KR 3QWNA 4B9GA 2QR0B 1OXYA 2HRPH 4EUPH 1HWWA 3M8OH 2OR8A 4UTCA 1NCWH 2EC8A 5ETUA 5F72S 4F37F 1UT1A 5DJAB 4X99A 1WWBX 2Y5EA 3SY6A 3VTTA 1WYJA 3C6SB 3C8KA 3FF8A 1FVDA 1LO3L 1KYUA 3NCBB 2V2WB 1CLOL 2KQMA 2VDKL 4N25A 4QCIA 4R97C 1BXXA 3HUJB 1JN6B 3MMEA 3SDCD 1F11B 5HSFA 4MJHA 4NNYA 4YFDB 2HTKD 4WFGD 3QUMB 1KXHA 2EO1A 3RLSA 1CICB 4AYEC 3GXUB 5CSZA 2Z7ZA 5C09D 2IANE 4XWGL 4L0ZA 1A6ZA 5KVGL 1E43A 3GSVB 2X9XA 1XTMA 3HNVL 4PB0H 3S0PA 4OCWH 3E80A 4FE9A 3ARPA 4MBOA 2AJZA 4L8DB 5MI0B 1N0LA 3QZNA 1WHOA 2FWSA 2EAEA 1BOYA 3RI5F 4LRNH 3V4VB 3AG2B 3FT0A 3TIDA 3R0NA 1YEFL 4M5YL 2GK0A 2VDML 4NKOA 1BX2B 3W0WE 1OP5K 2YO3A 1CFTB 4OFVA 4KXZH 5EUKA 4WSGA 4F3FA 4S11A 4X4ME 5CHNB 5EPMA 5IY5B 4Y2OB 4N2EA 3CBRA 4LLYA 2UX6A 1JZGA 2EIEA 2IANA 2FBOJ 2WLYA 3DV6B 3WFDH 4TOYH 1MHHA 4N90D 2B20A 1KGIA 3FB8B 4F8NA 1SBSL 2JELH 4PY8I 1JTPA 3LN4A 3PIQB 3QUXC 3RWFA 4PBWD 1TJHH 5DJDA 3SGKC 2MWCA 4WFHD 3PL6A 1IM9B 1SUHA 3L4XA 1RUAL 1T7XA 3QWOA 1CG9B 1BBDH 3E2HC 5D1ZI 3W0WA 4XP6L 5HYSA 5F7NC 3IFOB 4X4MA 4F8PA 4P23C 1BYNA 4AE1A 4N87A 4MS8D 5T3XL 2KZWA 5BV7H 1AOZA 1T03L 4X8JB 1ANUA 1OE3A 3IETA 2V7HB 5D1QC 3QG6B 1MFEL 3DXAE 1INDL 4R90H 3DUUB 5F3BB 3RJQB 5J57B 4MMZC 3ABGA 3Q6GL 1I4FA 1NDMA 4ZPTB 5B1JC 2BRRL 4NFCA 4JK0D 1OCOB 4TSAH 3SDXF 2OMTB 1IT9L 3WY1A 5GISH 2ENSA 4L1HA 1QWNA 3VFNA 5B3JE 5CGMA 1FNSH 5BO1L 2XC8A 3UGUA 5H37A 1ASQA 1PKQA 2CJ3A 1QQDB 3NPSC 2ADJA 5F7DB 5AVSB 3WL9A 1A6AB 2YD2A 1MH5B 2IBGA 3NUKA 3TN0B 1NMBL 4YHNA 1AXTL 5EF3A 3ALXA 5EHFA 4ZUVA 1F18A 1HU8A 4RZCA 2IDCA 2Y6TE 4NJAH 2OPCA 1L0QA 2R0ZL 1J5OL 5KSUA 3PY9A 1Q1JL 2H8PA 1VJSA 3BZ4B 2DH2A 4GG6F 3KBFA 2VABA 3AJ7A 3GI9L 4KTDL 1Q9KB 3ORJA 2G2RB 3HC0B 4F37K 1WC7B 2GCYA 3QS3A 4L8SB 1TQBB 4R2GC 1RIVH 2BWIA 4XNBA 5C0JB 4U6YA 3QQXA 4B50A 4A7GF 4M00A 4WLCA 4I9XA 5E1QA 3DK2A 5KN5B 5D4JA 3BYYA 4PRHB 4NENA 4QHLA 3EYQD 3LHAA 3S3SA 1CDIA 4L3EE 4CMMB 4GRLA 3HG1E 2NCEA 2XWEA 2B0SH 4JRXA 2AK1H 5IMMB 1KJMB 4HFUH 1KEML 3FU6A 4W9KC 3EXLA 2YPKB 4M7JH 2F7QA 3FO1A 4JLRA 3FHQA 4Y5XB 4ADIA 2Z35A 2FX7H 1O75A 3EJSA 3MLUH 3RI5K 2B9AA 4XXWA 1XDQA 3ZKND 1XAKA 2AJUL 2JQMA 1XGRA 1YC7A 2D9QB 4G5ZH 4H2CA 4L3EA 4KGLA 4QOKA 3HG1A 1FIGH 2QTEA 3JSSA 2AQPA 3DTDA 1WFUA 1F4WL 4X7SH 3FN0L 2Q8BH 1E7VA 1IAKA 4RQQB 3O6ML 2ENPA 3Q3GA 4K94C 4PB9H 5JYMA 1NSNL 2HWZH 1PEZA 3ET9F 3ULUC 4RMSA 1JL8A 2ZPKL 3OR6B 5DEJA 2O5NA 3RWIB 2G2PA 1CLZH 2EVIA 1QNIA 2A9NL 2P8LA 1VFOA 1ITCA 3UGEA 2CNZA 5INDB 4JRYE 3ZL2A 2OR9L 4DP2X 4JREB 3BPLB 3D0LA 3CFJA 3VFOA 4AYMC 1I9IL 3ARWA 2DQ6A 5EO1A 1R5IA 2HH0L 3QR1A 3TBYA 1Q94B 5FF6B 3ARXA 4IJ3B 1UA3A 1XIWD 2WTRB 3VX0A 3VD7A 4F58L 2HP4A 4PHZA 5CZVH 3FULA 5IBLC 2CLRA 2D4FA 1CK0L 4Y4KC 3VI3F 3BN9C 5MHSE 1BP3B 1JWUB 3P4NA 1FBIL 3JWOC 2MOVA 3CSYB 4KZDH 2VM9A 2AQTA 1OPGH 4JRYA 2MNUA 2J4WL 2NY6B 2C34A 4Z7UB 4G71B 2EDXA 1SDDB 5JIKA 4QLWA 5ABDE 1PS3A 4PJ5B 3S97C 1BVKB 3EYSH 1AXSA 4QTHA 4G6MH 2L3BA 4JFOA 2BWQA 3HAEG 4ISVA 1PLGH 4FXGA 1CDHA 2FWUA 2R83A 3QUMH 4KWUA 5KBDA 2XDHA 1RIHL 1T0MA 3FT4B 4JFQA 3VCLB 4AV5A 1MCKA 2ZCLH 2UWEB 5LNEA 1QEXA 4GW1A 4JQIH 1KJ2L 1OT2A 5EIIG 3EOAB 2ZNWA 3QHZH 1NBZA 4TN9A 3V4VH 1F58H 5BQ7B 3BVUA 3HZKB 5KJRH 3BSGA 1UATA 1S8DA 3NCYP 1JFQH 2NNAB 3RHWF 2IH9A 4AQAB 2WW8A 1P6WA 3MRJB 4H8VA 2YLHA 1NGPL 4N2IA 2F5BL 5LBGA 2WD0A 5LAPA 1QSEE 2ADFH 3IJEB 4AUJA 1ZE3C 3JTTB 4EUPA 4ODXA 5LDUA 1D6VH 3S4SA 2FR4B 3ZDZF 2I27N 2OXGB 2XG4B 3GRWL 3QZWG 1UOWA 3IT8D 1VGEH 4CKVX 3HJ0A 1DL7H 1G6VK 4YZFF 3I74A 4K3DL 5E4AA 1MVUB 4P2QD 3VI4E 4MD5A 4DCQB 4FFYA 4AZ8B 4LVHC 4YDIL 1ID5I 4Z0BH 2FX9H 3MV8E 3KWXA 1IAII 4GUQA 4NJ9H 3WIFA 4QNPE 4M6NL 1QSEA 1TPXC 3LAFA 3LN5A 4LAQL 1T1XB 2B59B 2BDNL 3IN2A 2QJDA 1UVQA 4N2DA 1GZHC 4EOWH 4EI5A 4B95C 3CFTA 2H5UA 3TESA 4JPIA 3IVKA 4YZWA 3BE1H 4QRFA 2H6PB 2PYFA 2CHWA 2WVVA 4LP4A 5E00B 3EJCA 3VI4A 3X2QB 5B38B 1N6QL 2Z8SA 1ED3A 4BQ8A 4X6CE 5H8DA 4PSPA 4Q4IA 3D09A 4EBQH 1HCZA 1ZK5A 1WZLA 3MV8A 3DOHA 1NCCL 2XY2A 3M45A 4L4TE 1B2WH 4L23A 4Y19D 1U8JB 2XA8H 4DT2A 5EEUA 4NO3B 3PCYA 3W5MA 4KVNL 1QEWB 1D6EA 4FQPA 1U93B 3D0VA 4QRPB 3JVGC 3MGTB 1RHHA 4PW4A 2VKXA 4WVRA 5AL0A 4H20H 4O9HL 2PP9A 1J5IA 4PGEB 4JBSA 2XWRA 1NM4A 3D4ZA 1A6VL 2VIRB 4BZ2H 3GIZL 3QS2A 1VFAB 1AC6A 4P2OB 4BWTA 4EIUA 3K0YA 4ZFGL 2DQFB 4X6CA 2K3TA 3A6CL 2VLJE 4MLIA 2NR6D 1TETH 4L4TA 5DUBA 1CDJA 1GGYA 3A4DA 1R3LB 2VCOA 3BIKA 3UAEA 1T3FA 1HJBC 2EIBA 5BQDA 3SE9L 1UXWB 4R0LC 5KYWA 4FJYA 2R23A 1IL1B 3U36A 3F6IA 2VDNL 4KX9A 2EIMB 2VXVH 4UYQA 1WZ1L 2ZKHH 3MUGA 1JRHH 5L8KB 4UM9D 1A7QH 1IGMH 3CDZA 1MUJB 1VCBC 2X4SA 3T4AA 4KZCA 3FOMA 1DN0B 1G84A 3CZKA 4H4NA 4MFHA 5HXMA 4BK8A 1WIOA 3B37A 4J2XA 4XAKE 4YXKH 1U8LB 4GQQA 4XBGA 1E90A 5C07B 2R39A 3FCSB 3RP1A 5AZEH 3QDMB 5IQ9B 4D3CL 1YC8A 4AIOA 2VLJA 1JYXA 1MRCH 5LN8A 2IIJA 1J0ZA 2RTTA 4A6YB 1KG0A 1BD2A 5IQ7L 4K7FA 3ILQC 5KANI 1DVFD 2MTAA 3EJRA 1I7RB 3IYLW 1OZUA 3TO4A 1Q72H 2YAEA 1KIRB 4HCGA 4JFWA 4L4VD 1KN4H 5IW1B 5AVTB 5DK0A 3P9MA 1CE6B 2JKNA 3D2UD 3RHWK 4EXPX 1NEPA 2XRAL 3TF7C 4JFDE 5DQ9B 1CR9H 4KKQA 4AH2A 1KTKE 2C4FU 2QTVA 1P7QA 4NC1C 3NABH 4KMQA 3ARDD 3RU8L 4R7DA 3SJVA 4DGIH 1EEYB 3TXAA 4G7SB 4W9IC 1P4UA 5E8EB 1OD9A 4NP4H 4OUOA 3MRQA 2DQEH 3FO0L 4P9HH 1EXGA 3NCFB 5AVQB 1NCWL 3WO3B 5ELIA 1ORSA 3QQNA 3AY2A 3RIAK 3CZEA 1EERB 5I1KL 1CB4A 4JFDA 2QADD 1F6AA 1UD6A 3LNHA 5DU7A 4LHUG 5FPIA 3HRZB 1RPQA 4GG8B 2F5AH 1BIIB 2WHVA 5CWSB 3ECWA 5CJ8A 2NT0A 3D7PA 3KPRD 4HT1H 3SDYH 2Z0UA 4I4WB 4OCSH 4FP8H 2JH2A 3EJZD 5KEZA 1YEJH 4DN4H 2EC9U 3LIZH 4JEGB 5D1ZB 1ZHLB 3PL6C 2Y6SC 4OJDH 3ZIYA 3OKLA 4AIZA 1Z9PA 1YEGH 3NZHH 4H0HB 5DVPA 1E4KA 1N0XH 4LRNL 3MRIA 5KYUB 2CMRH 5A2FA 3Q44A 3RY6A 2FJSA 2GEQA 5D55A 5DJ0B 1RIUH 1DANT 2EQDA 3FUHA 3HG4A 2XWJB 1I8MB 4D0DA 2BHUA 2IOMA 4QF1B 4CMHB 4WFFE 2WWMC 4A38A 2CCLA 1CGTA 1DVSA 1TO5A 1ETZA 4TOYL 1MAKA 4HV8A 3PGFH 4KDWA 3WFDL 4G9FD 2AQ3A 4AEFA 4BUGA 4D0CA 1U3YA 1WIPA 4MHHG 5G5DA 4FYQA 4KRMB 1TJHL 4RETB 1I9JH 2GBTA 3ABKB 3ILPA 5GZOA 1NGXB 2B8OT 2CJTA 3CCHA 3C5ZB 3HUJE 3WUWB 4MCYB 1BBDL 3N3EA 3BEWA 4HU8A 5JQ6H 4IEFB 2YZ1A 5I1AA 1T1YA 2GBAA 2ZKXA 1YEHH 4XPGH 3RGVD 2QR0A 5BV7L 3SKUD 5CEXB 3QNFA 2H45A 1T21B 2OFQA 2VDPL 4U7KA 4JPVL 4XMLH 1TQSA 5DJAA 4PLJD 3RWDB 5JA9A 1MLBA 3POCA 4MKMA 4H8PA 2F8XC 2P9RA 3BWUF 4N0UB 5BRZD 5EUOF 3EUUA 5M7QA 2V2WA 2E47A 3HUJA 1JN6A 4TSAL 1F11A 3BPNC 2J12B 5EEZA 5I6XB 1A6TB 5EZOL 4XNMB 3BQUA 4IKIA 1ZV2A 1K4DA 1T22B 2APTA 2NYKA 4G8EB 4RAUA 5FO8A 4P46B 3LHPH 4YPGA 3KGSA 4D0BB 3GS7A 5EF0A 1J0JA 4WO0A 2J73A 2IWFA 2P5WD 2QPFA 4M7KH 2Y7OA 4CBPA 1KWGA 2FYYB 1NDGA 4QO1B 5DUML 1HI6B 2K6YA 4GRLC 3NJXA 4NUQA 1JZ5A 5DZNA 2EYTB 3PDOA 2CE6A 3WNMA 1M9WA 4PWJA 3QIUA 5IJVA 2EXWC 3KZ8A 2BHYA 5F9JB 3CIAA 1BX2A 2VTFA 3QUYD 1F1DA 5A2KH 5IFHH 3MCG1 4AVKA 1OV8A 1YDPB 2VZTA 4KI5D 2FCBA 3OC5A 4LSVH 4UDTB 1RIVL 5H4ZA 2ZXDA 4DZBB 3PIQA 3NJFA 4XT1C 4MAYC 2F8IA 4M6OL 4PJ9C 4PJEF 3VRLF 3UAJD 1VDGA 1JIBA 1ZGLA 4GUCA 1SPDA 4R9HA 2HPOA 1TQCC 2YGPA 2B0SL 3IFOA 4KVCH 3N1GC 1U8QB 2AK1L 2AQ1A 2DAVA 2WZ0A 3JVFC 3PABA 5JIIA 1AXIB 1Z9MA 2D2CC 2C9RA 4X8JA 4M7JL 5EU5B 4MTMA 5DVKA 4Z1PA 3FQRB 1LWRA 1X7QB 3WGUB 1AJ7L 5F3BA 3DUUA 3H2QA 1J5CA 1ZT7A 3HJEA 4PWGA 2QKIB 3CE1A 1YY9C 3GXDA 4ZNEA 3QWRA 4ZPTA 2K4AA 4P5MA 3ZYIA 3OWEA 1HILA 4NN6B 2OYMA 2PPCA 3HMWH 4XNQB 5EC1A 3ULVE 1HL8A 1R34A 1E42A 1T5KA 1IM3B 4BH8B 1J5DA 5GGTA 4ORGB 4P2QB 4A6YH 4G9DA 4H44C 4PB9L 1QP1A 3K7UA 5CR1A 1CLYL 4WUKL 4CGTA 1NC4D 1O6VA 1MH5A 1F4XL 1CQYA 3GHPA 4TSBL 3WKMH 2Q3ZA 3LZRA 3U7YH 2E9WA 4PRHE 1OGAD 2WQRA 3QGVA 3LDBC 3VWKA 4AIXA 3KM1A 4XVSL 5IQOA 2ZQKA 1TCMA 1UD5A 1GTFA 1KELH 1B4RA 1VERA 5E0FA 1U21A 4ZOAA 5D7SH 4QYOB 3BZ4A 3O6FC 4ERSH 2G2RA 3HC0A 5IP4A 3CFBB 1WC7A 2QQQA 3N1PC 4L8SA 5C0JA 5CZVL 4CJ0A 3SY0B 2ETWA 12E8L 4QHNB 3TWCH 5D70H 4MQ7B 4BGDA 5HDQH 3UEQA 3CIQA 1DQLL 1E40A 4CMMA 2QGCA 4N8CH 1OPGL 4R7VA 2F6AA 2GG1A 5F9AC 1HZHL 2RGSA 2R4SH 2JB6B 5IMMA 2WYIA 4NC0B 1I3GH 5KYYB 3EYSL 5K93A 3KGTA 5TF1H 4TPRH 5IESL 1WTLA 5DRZB 5ESVA 5J11B 2X4UB 1KDIA 1OB1A 2VUKA 4KUCD 4EI6A 4N0FB 1MIEL 5DHDA 2VZ1A 3F83A 2ILLA 1ADQA 4YX2H 1BFVH 3F7VA 4RGMC 4UT9L 4M8QA 2VAAA 3OKDA 4U0RB 4H8UA 2KI6A 4LMQE 6CGTA 1B0RB 5ESAB 3S5LB 1FFQA 2IGTA 3V0WL 4JQIL 2ZYSA 1TZGL 1JP5A 2FECL 3GTTA 4IMKC 3MQIA 4QY8A 1Y1UA 4F91B 1TTUA 4PI0A 5HJ3B 3IDJB 3V4VL 4IOIA 1V8HA 4PCSA 4ZRGA 3WXWH 2IAAC 4GIPD 5T1MA 2DD8H 2EILB 1QVOA 1NOAA 5IJCC 4NDMA 3BGFC 5GRJL 2GBUA 2X1QA 4KZ0A 1DBBL 4EI5C 4QT5B 1MI5D 4WW2A 4HLJA 2VERA 5HYJD 2VZOA 4XC3H 2ADFL 4OD1L 3W11C 1RP9A 1MCEA 1D6VL 2IWEA 2XQYK 3HHRB 4LLVB 5D7LE 1S9WA 1QG3A 4D2NA 2BVOB 1NANI 3INUH 3PP4L 4KC3B 4JKNA 3FN9A 4KXCA 4PUBH 4MJ5B 4Z7UE 1HHIB 3X1BA 3ZL4L 5CZRA 1AE6H 2K7PA 2IPUG 5CCHE 1Q94A 2BOCB 1J05B 2CPCA 4Z0BL 3V8CA 4RBPK 1FVCA 3LQAL 3WIIL 5FEBA 1ZEAH 5CBEA 2FX9L 3ZT7A 4LOUC 5ICYB 2F19L 2PKDA 5T3ZH 3ME0A 1WZMA 5KTEH 4YHYC 1RP8A 3MJ9H 4OCRL 1S46A 3UBGA 1JWUA 5D72H 3CXHK 4YUEL 2UWEE 3LIZA 3DVNB 4M7ZC 2NXZB 5D7LA 3ZMRA 1BM7A 3B9KB 1BJ1H 3MGOB 4JM2B 4Z7UA 4Q97A 1MLCA 2VLME 5ERWA 5KW9H 4C83A 3EDFA 4A66A 4PJIF 4MNQB 5C2BH 1JZHA 1OSPH 3CWGA 5DC4B 5BMFH 1BVKA 2IFFL 3OC8A 1B0IA 1A3QA 3QJUB 3U48A 3D18A 3L3DB 2D3LA 2FJGB 3KWWB 2HG5A 2XWCA 1B2WL 2Y7QB 3T4AC 5JPMC 2UZXA 3GJFA 5DUPH 2X0VA 2YIHA 3GLDA 4KH2A 5ICUA 1AZUA 2UWEA 2QZ5A 3MXVL 3VM7A 1EDHA 4LP8A 3QCVL 3RBSA 1LYQA 1R33A 2RHEA 1F8TH 1CFMA 4BZ2L 3OKOB 2H1XA 1QW8A 2HPTA 5BQ7A 3LPGA 4PSRA 4X6DA 3QA3B 3U4EB 2GTWB 5ALCH 2NNAA 4NZ8A 5DVLA 2IG2H 2FBRA 4X9FA 3TO4C 5E4IA 3A6OA 1TETL 1A7RH 3MRJA 4HUXB 5LBSL 1KDJA 1T4WA 4XGZA 5GS0L 5K69A 4OLUH 3MNZA 4M48L 2FR4A 2XG4A 5EIQA 5EV7A 4AYSA 2VXVL 2ZKHL 3D8MA 1S9XB 3GMPA 1IGML 4JANB 5GIRB 4HC1A 5CP3H 9PCYA 4X8GA 3SO3B 3VXUB 1G9NH 1OAQH 4LVNB 5IBUG 4TULH 5TDNA 4CN4A 4RCAA 2XXMB 3DURB 3UBXI 4TSCH 3PWPD 4G42B 4X80H 5CZKA 1XL4A 2KMWA 2B16A 5D2LF 3S96B 1QSZA 2PO6B 4JDVB 3X11A 1FIEA 2G30A 4X4ZA 3VH8A 2CNYA 4RMBA 1T1XA 3DMMC 3DTXA 3VFMA 4WTXA 3UERA 3IDNA 1WE5A 3ZJAA 2ED8A 2DEWX 4ZW3A 1LHZA 4YWGL 1KN4L 4J3OH 4ELDA 1L0XA 2DYRB 5C09E 2H6PA 2EEBA 2NXYC 1FPTH 4IMLA 5BCAA 1ETB1 3TYFA 3K6NA 4LLQB 1E5ZA 4M56A 4XHJD 4QEGA 3QH3A 3GNMH 4F57L 1EGJA 4F80A 1U8JA 4H0GA 3O4OC 4HMEA 4LK4A 4FLSA 1LO4L 3TZVB 3SDCA 1QEWA 1S7UA 3MGTA 1S7QB 4NP4L 4OI9A 2DQEL 2QKSA 3V2AR 4I0PD 4U0QB 5C09A 2XBTA 2P4AB 2VIRA 1RSYA 2UUDH 4U4BA 3H55A 1VFAA 3KLQA 4XB8A 2DWSA 4P2OA 2V17H 1Q0YH 3N43F 5C07E 3GWJA 1EH9A 1N6VA 2IAMD 3QDME 4MZRA 4Z3GA 3ZT6A 1CE1H 3DX6B 3V0EA 2IQAB 1MCIA 1SLXA 1R3LA 1MQ8A 4WFHE 3OKKB 5JZ7C 1ND0B 2ZF8A 1JTOA 1IL1A 2WBJD 3MROB 2Z31D 4FKEA 4X6FA 1S7VB 3SDYL 1MUJA 4HT1L 5JOPD 1M6OB 4OCSL 2QVTA 1R47A 2VW4A 5LCVL 4OR1A 4URKA 3R19A 3UBHA 4YSTA 1N8ZA 3FCSA 2AV1A 2ATAA 5IQ9A 3KJ6L 1E7UA 4WWNA 3RFZB 3T3MF 1YEGL 1ZHKA 1Z5LB 4LL1A 4B9JA 4I1RA 5A6MA 2CMRL 2WIIB 4A6YA 1O9ZA 1U0QA 1DHKA 4MRCA 3BUDA 3VXNB 2G60H 3FBQA 4YC2B 4HIEA 2HMID 3BX7C 4MA8H 3HG2A 1KXVA 1Z0MA 2ZX6A 3ROOA 2YC1B 2ITDB 1KIRA 3AROA 4RRPG 5IVZB 4CC1A 3RAJH 3ZTNH 4LP5A 8PAZA 4HXAH 6PAZA 1AMXA 2E76C 5IMLB 1I9RL 4J6RH 1CE6A 3SPGA 4ZUUA 3PGFL 5CGBA 3SKJH 3C6LB 1MFDH 3KPLB 4J3WA 4FI6A 5K9JH 3VFPB 4XCYA 1QATA 1BM3L 1IAIH 2EH7H 2J1XA 1Z32X 2VMEA 3BQUC 1M9SA 2VLKD 3S35H 3GT6A 3G5XA 4CADB 2NTFA 1EEYA 1C8PA 1QYGH 2AW2A 2NX5D 3E8UL 3QAZC 5E8EA 4ANVA 3MLXL 5FYKU 3F7QA 1MHEB 3MNVB 1JF6A 4UQEA 1YQVL 3QORD 4BDVA 1NEZA 3CZFA 4MA7L 3HE7B 2FIRT 3QIUC 3X14B 2VLLB 4ZOBA 4MRBA 5DC9B 3OM3B 3X12B 3CFNA 3UIYA 4DO5A 3LKPB 3GLAA 1FO0L 4OD3H 4Q9BA 2DDQH 4HD9A 5IBTH 1A4KB 3HRZA 3Q8EA 5J3HC 5DA4A 4KMLB 1P7KA 1SOSA 4EMZA 3VDAA 4I4WA 3VFGH 1BXVA 5K1NA 3GXFA 5D7IF 4YBQD 3BLBA 3WMSA 2CG9X 1X4ZA 1ZHLA 3M7OA 4FG6D 2V5YA 3ZW3A 2CDEB 3RWHB 2V7NB 4RGND 4HWBL 1A6WH 3GSQA 1NUNB 3PWLB 4HDIA 5KYUA 4XO5A 4PTTB 5BS0D 1U3HD 5DJ0A 4B5ZA 3I6LE 3A24A 4E9LA 4HOXA 3ARBD 3KPQB 1ZKAA 2XWJA 2ZICA 1TUPA 2X4TA 2BINA 3IS1X 1PLAA 2ZWKA 1PZCA 2OK0L 3TP4A 4QF1A 1QOKA 1IGCH 1PPIA 1V55B 4LSVL 3AG1B 4S1RL 5HHMD 2EXSA 1FQ9C 2GT9B 1RUQL 4U2YA 4OT1H 2XBZA 1JD9A 2YLKA 4XWOC 4N0UE 5AL8A 5F1OB 3OLIA 4YSPA 1CFQB 3JYCA 3Q8FA 4AVIA 4WIQA 5BOPA 1M3JA 3QCUL 3MOBL 1R75A 3C5ZA 3WUWA 1YEIH 2LV4A 4WK0B 5EZIH 1I1CA 2DW5A 1HZLA 3D2TA 3ARFB 3C2SA 1LTXA 4U7SA 2BY2A 3ATDA 4A2DA 1CS6A 3VWKC 5DZ9A 2ZOLA 1REIA 1JNLL 2X4NB 3ULVC 5H94B 2WN2A 3RWDA 2P47B 25C8H 3CZJA 5EO0B 5J06A 3JTSB 1U92B 4N0UA 5C7XH 1SEQH 3LRHA 5AW7B 5GS3A 3RVUD 4XZ4A 2B4CC 3S36H 4DQAA 1Z0NA 4V33A 4U1NB 1NOLA 4XNMA 1M71A 5TK2A 4O4YH 3WFHA 1UOKA 1JPFB 1KLUB 2R2BA 1S9YA 3FH7A 3PV6B 2PTTA 1XIWA 5B22A 2IALB 1CC3A 3VE0B 4QO1A 2IV8A 1N8OE 4JDZA 5I1JH 2Q7YB 2WXOA 2MCPL 1QNZH 5CEZD 3GD1C 3DVGA 2EYTA 4F8LA 3WIAA 3U7YL 5SWZB 2JI3A 4ZMLA 4MJ4A 4NQXA 3S8WA 3E7JA 2CBQA 1YSOA 4NYLB 3IBEA 1YDPA 1E27A 3FZUD 5E24E 3CV5A 1QI3A 3ES6B 1HS6A 4HA1A 2C3WA 2M26A 3BP4B 3VSQA 3UP6A 2GJ6B 2DKMA 5F0JB 4ERSL 5BVPH 4HP5A 4UDTA 1V3MA 1OTSC 4LVOB 2FBJH 2VR7A 1G43A 4JFFD 4JHZA 4LL9A 5I8EB 5CP3A 4E68A 3UJIL 3HLAB 2NY3D 5LGKA 4KKBD 1LEKA 1JI1A 5FK9B 2HXAA 5EOCH 3MODL 3WFBH 3CK0L 5GGRA 4E9SA 1L9OA 3WTWA 4N8CL 1FGVH 1E5AA 1YMMD 3T0VA 1I1FB 2HX7A 2R4RH 4HS3A 2WV3A 2R4SL 2ZT9C 3ARUA 1U8QA 3KG5A 4PJBB 3SKNA 4P2QE 1ZPLA 4P9HC 4HAGA 4WW2C 1I3GL 4NKIH 2WKOF 4I87A 3VMOA 1P69B 2XWBB 1X7QA 2COVD 1P5UC 4HF5L 1SBBA 2R0KL 3B1UA 3ESNA 4P3WA 4YX2L 1BFVL 2QKIA 3BPLC 4RA0C 4BINA 5JW3L 1TIUA 4TLKA 3DC0A 5DSCB 4QIRA 4KY2A 4OJYA 2HFEB 2YD1A 3IB4A 4XNQA 5E9NA 3Q7JA 2NW3A 3TJEH 1QBML 4LE8A 4FS0A 5FOBA 4GRWE 4BH8A 4ORGA 3IGAB 3QEQB 4P2QA 4XI5C 1RLWA 1SJHA 3L5IA 4C56B 1H8LA 2HRLA 5FWRA 1AQ8A 4Y19E 2N7AA 5GQBA 2QDVA 4N0RA 3DWTA 4UMSA 4XC3L 3ZKXC 4IBWA 4IK6A 1NAKL 1SYSB 4UV7H 5IVOA 1CXKA 2DL9A 5DLLA 3KD4A 3BHBB 3T77B 3INUL 4IBYA 2LU4A 3NCJH 4R26H 4F7MB 1SY6H 1J8HB 4FXKA 4LCVA 5TDPA 2P46B 1AE6L 2YA1A 3I9IA 5SWSD 4IW4C 1CD1A 4LASH 5IMKB 4NO0D 3D1MC 1FNHA 4YN3A 4OZHF 3C8DA 4U1MB 1MCBA 2R0LH 1ZEAL 1RLBA 1ZHBB 2LW3A 2B2XL 3CDGB 3CFBA 3QJHB 3SY0A 4Y19A 5T3ZL 1NLBH 3CHSA 5HJBA 1ODAA 3MJ9L 1AQDB 4KK5C 1FSKB 4MQ7A 4V2BA 2GHWB 2L7QA 5D72L 3VD3A 3B3IB 4N2BA 4GQRA 3CZSA 4K94L 4LOFA 2KKQA 5KW9L 4FG4A 2OS7A 4PJ7F 4JG1H 3V6ZB 5FA3B 1OSPL 4LSSH 3ULUL 2Z0BA 5KYYA 5BMFL 5FM8A 5SX5K 4AGNA 4NN5B 3UTSD 1AS8A 5DRZA 4LHUD 2NR6A 3PAZA 2X4UA 2FJHA 4OLZH 3QO0B 4KKLC 2FNWA 4ZMYA 2WZAA 3A47A 4XNYH 4LEOA 1BZOA 3OWRA 5D2NE 3QNYA 5IHWA 4JVWA 4TLUA 4Y89A 3SYPA 3UBXB 4XPFH 2OJ1A 3LPFA 5ESAA 1JPGB 1W0VB 4UM9A 2B39A 3GB7B 1EUTA 4YIQA 3SGJA 2ATKB 3G3LA 2W0PA 4KO6A 5HJ3A 4N2AA 3IDJA 4JRFA 1XB6A 4X7FC 1MCQA 2AEWA 2DOCA 2OV0A 2VAJA 3BD5A 3TBCA 1SEBB 2EDWA 5ALCL 5E4EB 3F04A 3UADA 1SDYA 3DRTB 4M5SA 1GSMA 3W57A 2BOBB 4UB0L 1FRGH 5FKAA 1SF3A 4NOBA 2BJMH 1U8PA 1DVFA 3C6EA 4ODHL 1JAEA 2WKGA 1I1AD 1ZDQA 5D2NA 4LLVA 2VQTA 4J1UB 3QYMA 2F1BA 3RX7A 2BVOA 2X6UA 1IC5L 4MJ5A 4MSWA 1HYSD 4NPKA 1TENA 3DX8A 2ZZUT 3QRFM 5ISZB 4JG0H 2BOCA 4TSCL 1BIHA 2M1KA 3FS9A 3SDCC 1N64H 1E3XA 3OXRA 1WWWX 2OP4H 4YLCA 1E4WL 2HTKC 4Q6IB 1PX4A 3CVHL 1L6PA 3UIZA 2CGRH 2VO5A 3ARDA 1AIFB 2UYLB 2CO7B 3V5KB 3WTSA 1H6EA 4LSTL 4BWUA 3T0DA 4ODTL 3B9KA 3KPRE 3MGOA 4JZOB 4DP9X 2D7NA 5CFHA 2NY0B 4NHCL 3KPNB 4KOBA 2CM6A 3HG3A 2DQHH 1PZ5B 2YPLB 4G7YH 1B6DA 1ZA3B 1U58B 3DSNA 3EFOA 4AV0A 1HK6A 4HCRL 3BW9A 2FLBT 3OAUH 3FU9A 3KPSD 2VR5A 5FHAH 3C09C 4MB5A 3HZYB 3BOVA 4UINH 1TG8A 2Y07L 4LSUL 3U4BH 5TGBB 3RVVD 3F7PC 2VNCA 4GKZA 4P4KD 5DO2D 4OUUB 5I0ZA 5C0AB 2ZXAA 3KPRA 1KBWA 2WLHA 2ZUTA 1F3JB 5FYLH 4X6BB 1JF5A 1L7TH 2X0UA 2D7OA 3N1MC 4YLQT 3OKOA 1IGFL 4OLVL 3AAZB 2AERT 5AWNL 1FG2B 1Q0YL 3NK3A 4G9FE 2GTWA 5EH1A 3IPEA 2CKBL 3M1BB 1KXVC 4LO9A 2XHNA 1HL4A 2RCSH 4NZUH 5IVXE 4HUXA 4XMZA 2ITCB 1JWMB 4FFWD 2G3XA 4FFZA 3TF4A 1TQWA 5MEQA 4MS8C 3T6QC 4WGWB 4R96B 2R2HA 5A43C 1P4IH 1QLEL 1A3LH 4IRJB 3UCQA 4X2UA 4HJSA 1S9XA 2HT3D 4JANA 1WFOA 2IADB 1WGVA 2APWA 3NSXA 3LEVH 3IFNH 4PYGA 4RFNC 3P11H 2WTOA 1MAMH 3EYVB 5JQIB 4WDIB 5I75C 1EXHA 4DGVH 4WTZG 1AZNA 3DURA 1SHMA 4G9FA 3KL0A 3L3GB 4FC3E 1GY2A 3BUBA 3S96A 4A67A 2DQJH 1G7IB 8CGTA 4NQSB 3RKPA 5ITBL 3BPOC 5IVXA 1OF0A 2YMOA 4B60A 4QRRB 1RH8A 2X44D 2A73A 4MA8L 4WENB 5FHBH 1EJOH 3P4OB 3ZQXA 2LU5A 2AQSA 3WTTA 4LPCA 1NANH 4OGXL 1WS7A 1R3HB 2JFCA 2YQBA 3RGVA 2OKMA 1C7TA 2UZYA 3NAAH 4YHZL 1TU2B 2Q8AL 2VJXA 3QPQD 4J6RL 3SKJL 1MFDL 3UPRB 2XZQH 4LLQA 1E8WA 1JHLH 3BZDA 4HH9A 1KNOB 1T20A 4AL8C 1YMHB 3PP3K 3VUAA 4WHTB 1IAIL 3QFDB 3T09A 3HN8A 4NUGH 4JX0A 3S35L 3JWNH 3RL1A 2H1PL 1AGFB 5A2JH 1L5GB 3L2MA 1BQHA 3DYPA 3TZVA 1QYGL 3IJSA 3N41B 1OCZB 3A67H 2OA9A 4PJ8D 4KKPA 3I6GA 5INCB 3RTQD 1G5GA 2IDSA 3R8QA 3V0AC 1CU4H 3ML8A 1W0WA 1QSFB 3PFUA 3OMIB 3DPBB 2A9BA 3EYQC 3NIFF 5I6OA 2NQ3A 3TBBA 4GIAA 3EO0B 3PJSA 1F4AA 2E27H 2PW2A 1J1XL 3CVBA 5I66B 4G6FD 3DX6A 3JWDH 3WYRA 1ZTXH 3IS0X 1LK2B 1KBKA 4OD3L 4RVBA 5E5RB 1L7IL 5GS1B 2DDQL 5IBTL 3QUYA 1CYXA 3GI8L 1M7IA 3O3EA 5AW4B 4NUJB 2ZE0A 4MJ6B 3MFFB 4GI8A 3KLAB 1ZS8B 4Y2DB 3ZKNC 3P2DA 1ZJAA 1J10A 1FJ1A 1QKZH 1THAA 3C2AH 4G3YH 3S48A 4XAWL 2FJUB 3ALWA 2DLGA 3ATEA 3RFZA 2BVQA 4I85A 4N1EA 3DV4B 4AJWA 4P5RA 2CBPA 1A6WL 3P4MB 4PJHF 2WIIA 4ZS7L 3UAJA 3UTZA 4NZTH 1LP9E 3VXNA 3QXWA 1YEEH 3TYGH 4O51A 2EDQA 2YEVB 4CW1B 2ITDA 3MX0A 1GS6X 2EYRB 5DJ8B 4HX1A 3OJ2C 2E9IA 5I6NA 2E6PA 2EE9A 2ZUWA 1FGNH 4I9WE 1IEBA 3TNMA 3V4UH 3AC0A 5E99H 3KPLA 3VXSB 3IDGA 4PRNB 4XVTH 1YA5A 1JK9A 2W60B 3VFPA 3CH1B 3H4HA 4X8XA 3C75A 1SY6A 4OT1L 3BAKA 4ES9A 1E3ZA 2FO4B 2CGYA 3V95A 5IJDC 4J7RA 1F45A 1OGAE 1JGEA 4PHXA 5B8CB 4CADA 1LP9A 1Y6NR 4GKSA 2IH1B 1XIWC 4X0KB 3T2OA 5KS9E 1VEPA 3RX9A 4PCYA 3SKOB 1PFCA 2HKHH 3MREA 5AFAA 4TNWF 2COQA 3X14A 1NC4A 3NT0A 4BQBA 5EZJA 3Q1EA 1Y1DA 3NMEA 3L1EA 4LHJB 4ZQTA 3LKPA 5C7XL 1RJZB 3KCPA 3ILEA 1OGAA 3U2IA 3L2NA 3S36L 3GPSA 3MV9B 4GPVA 4KAQH 3B6SA 4F8TA 1A4KA 2EVJA 4PGCB 1ZIAA 5KS9A 4UTBH 3NH7H 1MEXL 3G08B 4F8OA 5I18H 4FQIH 5BJTB 4FKHA 4IIZA 4BRJA 5SWSB 3FTZA 3K5RA 1UEMA 3K4DA 4G7QB 4M93C 3LOWA 3MUJA 4TNVK 4AUYA 4OZFB 1JUFB 2GVYA 5CU5A 1HAWA 2ADGB 1GPOH 4M62H 1JZ4A 2WXGA 1Q9OB 4Y7OC 4UDUB 1TZOA 4Q6YA 1QNZL 4TTGA 1DVUA 3L3HB 2BP5M 2V7NA 3ESPA 3L3KB 5FAAA 4AMWA 1ZT1B 3GXPA 2E7LC 1E28B 3CXFA 2J25A 3IFLL 4QLRA 4S1QL 2RJMA 3QIBB 4Z3EA 3QQ3A 2KZ1B 4K8RD 5D96B 1UZ8B 3ZHLA 4D7BA 3MRKB 2ZP0T 5BW7A 5BVPL 1OTUC 4EIZC 4AQEA 3LNDA 3G6JF 3M46A 4RWYH 4OZGF 1VZHA 2HN7B 2VDRB 1MI5E 4WEUD 1W91A 1BQUA 1S7SB 3OJVC 1G87A 2VR6A 2Q5BA 1V7ML 3GK8H 4M1CD 5EOCL 5F7EL 5HYJE 1A0QL 4HJTA 1PMYA 1UH4A 3WFBL 1QTSA 4NQVB 3D0AA 2WBKA 2LR4A 1BREA 1XMEB 5ANHA 3IPBA 1UCTA 1H3WM 2QSQA 4KFZC 3SPVB 4NAMA 4G80B 1XVSA 3ARFA 4LPUA 4Q6KA 5CAYB 3IWVA 4MDRA 4N3UA 4CJ1A 5K9QG 4XR8C 3WTUA 4KHXL 2F9BT 3S3PA 3WIHL 5LXGH 1JTTA 4KX8A 1D5RA 1MI5A 4NC2B 1R9FA 3PQYB 5HYJA 5EO0A 1PY9A 1FFOB 2Y06H 4XXDB 4FXKC 3CQQA 4HIHA 1WZAA 4YHOH 1CGSH 4U33A 3N85L 4U3XA 3IDMA 3M7FB 2CHXA 3N9GL 5TQ2L 3TJEL 4U1NA 4DFIA 1MXGA 1C9SA 2W92A 3B9DA 3FTYA 2OI9C 1MQKH 1P5VB 2YD5A 3T2QA 3MRCB 1EEUA 3PHOA 3PV6A 3IRPX 2WPGA 4E9RA 2GJ6E 2WO2B 1P6AB 3CN1A 3IMTA 1ZT4A 3V0VA 2Q7YA 4BRVA 1DVQA 3N44F 1SJEA 3F64A 4KRPD 4R7LA 3O4LB 1DUYA 4HD5A 3NZ8B 4GYBA 3GBML 3GYRA 3ABZA 4UV7L 5D71H 1NGZB 4W9JC 2H0FA 4K71C 5BUGA 4NCDA 4S2SB 3OSVA 2UZIH 3OSKA 3QISA 4NYLA 2NR6C 4R26L 5MP6H 5GSRB 4Z7NF 4ZD3H 1G4MA 3GSOA 2WQAA 4ZX3A 5C0EA 2UZPA 3BP4A 5AALA 4NLAA 4DPAX 2GJ6A 2H41A 3SQBB 3A5VA 3E6FA 3OTTA 3L4YA 3BDYH 5C6WH 2DLFL 5PAZA 3SGJC 3BJ91 1NLBL 3HBPA 3HLAA 4JM0A 5I74B 1P6FA 1W16A 1WWAX 1A2YB 4MDJB 1H9DA 1G1CA 4HJJL 3HPJA 1A3RL 1IGTB 4JJ5B 4PBDA 4L05A 1ZSHA 4PJDE 2WLMA 3DROA 1D5XA 1FYTB 1I1FA 3EO1B 4JG1L 1FNGA 1YNTA 2DQTL 1PX3A 2KC0A 4LSSL 3BIAX 3LPPA 1RZIB 1DVFC 4JRLA 1MFAH 4N9GA 4PV1C 5D2NC 2FEDD 4C56E 2XWBA 3MN8A 5EBLA 1X7SA 3E6HA 4OLZL 1I8IB 3G5VB 2HFFB 4W4NA 1BZ7B 5BRPA 5HYSG 1I7TB 4XNYL 4PREB 1C16A 1ML0A 1KYAA 4UQCA 1RZFL 3D52A 2F58H 2LFEA 3WHXB 1KSRA 1AI1H 1JGLL 4F9LA 2HFEA 1A7NH 3BFWA 3BAWA 1MY5A 4PJDA 1PBYA 2X9WA 5AVXB 4YXHL 2H2SD 2R8SH 2YK1L 1ZTXE 5K1JA 1ZV5A 2P5PA 2FLMA 3FCTA 1BWMA 2FQEA 4P4RA 3ARDC 1WEJH 3OZ9L 3R7RA 1T89C 4MZIA 2V9QA 3MJ7B 4J3VA 1RD6A 4I77H 4XX1E 4HLZG 1FRGL 1MWAA 3VGAB 1GY1A 1V3JA 4WWPA 1FNFA 4WI0B 3L5HA 3WN5B 3IEAA 2GAZB 3MA9L 3SDXB 4CBZA 5H37G 4FLQA 2VXSH 4YDVA 5FYJH 5IB5B 3ZTCC 2QADC 3IMRA 4K2UH 2YN5A 4Z78A 1PG7L 2XWDA 1H5BB 5IMKA 4JG0L 3HG5A 3TT1L 3STLB 1WA0X 5AEAA 3VW3L 5JUEL 1L9TA 5I26A 1ZHBA 3CDGA 1ZA6B 1OAXH 3B9AA 2BSRB 1GRWA 3P9LB 2X09A 2JVUA 1JV2B 3BUYA 3EJZC 2BZDA 3CLFL 1NCBH 3MI6A 2W59A 3U6RA 4FG2A 3WNJA 4X7TB 4ZS6D 3RTQB 4PJ8B 3BESR 3RURA 5HDLA 1MCSA 2X1WL 3IDIA 4BSJA 3CFDB 4PJXB 5HHQB 2DI9A 4FABL 1AP2B 4GG6B 5FA3A 1BGXH 3EG9A 4JKWA 1RJLA 4YHKH 1DQKA 4G7YL 5IUCA 1ZRUA 2OZ4A 1I7ZB 1K85A 3CQFA 3KPMB 5AW0B 5E8NB 4ZNCD 3QO0A 5BVJA 1RVFH 1AGBB 3TV8A 2YXWA 5KVEL 3MOQA 4JHUA 4L3CB 5FHAL 2BIOA 4LVNC 4Y4FD 1Q4NX 3IBOA 1NLDH 2BY1A 3NYKA 2MNJB 4OZFH 3MYJA 4NZRH 5F1KC 5FUCE 2Z31A 5ID0B 1JPGA 2QSCH 1DBJH 1IBDA 1E9PB 3DSFL 3PWJA 2HVKB 4LQFL 4PRAA 2Q6WB 4BKLB 1ZXQA 5FYLL 2NCMA 3I3BA 1L7TL 2DWDB 1RURH 1R5VA 3DJTA 4JPKL 4NP9A 4HUWA 1SJMA 3WNLA 3GGWB 4JL2A 1SEBA 2GIYA 5HHPB 3TTSA 3DRTA 2WZ6A 3NSYA 1NAMH 4IBZA 2BOBA 3VFVB 2XWXA 4NZUL 4IBVA 4HKBA 1BW8A 5CO1A 5C0CB 1UZ6E 3VGFA 3RGVC 1SGKA 3DPDA 1XGTB 2J8HA 2NX5E 4L1TA 1W0YT 4J1UA 1A3LL 4RRPM 4FQXD 4W9FC 3VFTB 1RUMH 8FABA 2YGQA 3EDDA 5BO0D 4G6AD 4OM0H 4PLJC 2A3TA 2VDRH 4ODVH 1MFBH 5I1DA 3IFNL 4TYUA 3P11L 4QJ3B 1MAML 5DD3H 3M17B 2PPDA 4PRID 1UUSA 3OR7A 15C8L 4DGVL 4UUJB 5IM7B 2JK5B 1ZDSA 3MBEB 3TH3T 1HSAB 3S2AA 5TE7L 1ZWIA 2OMBA 4QRTB 5L9DH 4PJAE 4D8PA 4N2GA 4AY0A 2ICEC 1CVRA 2WQUA 5E9DD 2B7DT 1FFNB 4NO2B 4YSSA 4JO2L 3V5KA 5C0FA 2Y1AA 1DDHA 2MFNA 2NX5A 43CAB 5JW4R 3ZKSD 4RISL 5DHVB 5L0QB 4C55A 4BSWB 5I0WA 3I6SA 2VXTH 5GSVB 3WS3B 1L9QA 1N59B 3FHEA 3KPNA 3NAAL 3QORA 4PV8B 1GOGA 1TJIH 3NZSA 2M2DA 5T5FH 5CS7A 2D0FA 2XZQL 5EB9A 1JHLL 3QUYC 1TLMA 1MKFA 1XGYH 2DWEA 4PJAA 3II1A 4DHLA 3VI3B 4R4BB 1BXUA 1C1EL 1EO5A 1HNFA 3KLHD 3TU6A 5HDBF 3KPTA 3HZYA 1LM8V 4GQPH 3MLSL 5KOMC 1ZVSA 2WYTA 3L3JB 2CA4A 2H9GA 4KI5C 1MREH 4RX4D 5AVUB 3TA3D 2P3YA 4WEEA 5TGBA 5G55A 2YSSB 2WZPD 5JPNA 3I02A 1F00I 4HIXL 1F3JA 3ZE2F 5CKAA 4OCNC 4X6BA 5DMJB 4ZW8A 5DEZA 3WJMB 1B6UA 3X3GL 4ZUTB 1FG2A 3BFQG 3TNNB 3HPLB 1RZKC 3NFNB 4PVNA 5HHME 3M1BA 2N1TE 1SOXA 3NP3A 4ZFFB 1GOHA 1URZA 1EFXB 1KPUB 3FU7B 4IQHA 4JY4B 3D6GA 1JWMA 5FO7A 4G7RB 4B9CA 1U3HA 1NUGA 1VHPA 3H1ZA 2G0KA 3ARBA 4J8QA 2J5WA 1RULL 2E7DA 1JDDA 1HT6A 1JPTH 3B4NA 2KDGA 4TVSa 4X4KA 5FM4A 4WO4D 1B3IA 1SXBA 5E6IB 3U30B 4K3JH 1ES0B 1PVHA 1QKZL 3L4VA 2FHCA 4XC1H 4DVBB 3VRIB 4EUPG 4TVPD 3FXIC 3S4SG 2AHIA 4OZIF 1KTRL 4I0CC 2VMFA 3VGBA 1J1OL 4HBCL 4XPHL 2P80D 4NZTL 1CIDA 2LT9A 3ZDZB 3MCKA 5ES4B 1YEEL 2E3VA 2ITFA 4DFHA 2GITB 3Q1SH 2UY6A 4YPJA 3P0VL 5J89A 4QHMB 3LKQA 3X1FA 4N86A 4E41B 4G8GD 1TSHA 1TU2A 4CC0A 3NK4A 4BCZA 4AJ0A 4O2EA 5CLZA 5E99L 1KJ3L 1XH2A 4GQ9H 5SX4I 1KNOA 1CT8A 1IC0A 4WHTA 3QFDA 3PREA 4HSAC 5DFAA 4XMKL 1J5HA 4KROD 4Z95H 5AOJA 3AU1B 2R1WB 5INCA 3CN2A 4R8WH 2NY7H 2PTVA 2RQ8A 4LHQB 4IOFD 5IFAH 2AS5M 1CF8L 2TAAA 1NPNA 3V4PA 4NZFA 2X1XR 3ESUF 2HFGH 1ZMYA 3O6KL 4KI1A 3EO0A 4JFFE 2J2ZA 5HGAB 4IRSD 5ITFB 4F7TB 1CGYA 3VXOB 4HZ1A 1LK2A 3VVWA 5GRZA 1UXMA 3TIEB 3BP7A 4UWQB 1XCXA 2EKSA 1YMME 1I53A 4YL9A 5BW7C 4B97A 2K3HA 4BZYA 2FIKA 3K3QA 3L3IB 4UTBL 5I18L 3PU7A 4OFPA 4NUJA 4FNLH 3L8QA 3MFFA 3ARYA 5T1LD 2G75B 3UL4A 3KLAA 3MRFB 3HR5B 2CR0A 1U6AH 1CBVH 1GPOL 4JFFA 4XNZB 5FW6A 3VFRA 3VXSE 3GPEA 4Z18A 2J1KA 3DV4A 4IKLA 2HX9A 1DQIA 3P02A 4DTGH 3N1FC 4YSEA 3UROR 2NY1D 4X4XA 1MJ8H 4FLHA 3GF8A 3P30H 4MB3A 1I85A 1YMMA 2MH4A 1CDYA 4PGZA 2HVBA 1DSFH 5FFLA 2R0WH 4GAGH 3BMWA 2LTQB 4CC4A 1HE7A 3IJ8A 3REWB 4QMEA 2QL1A 1G6RL 1A47A 2Z3FA 2VMCA 3VXSA 4RWYL 4TUKL 2W60A 2APBA 3CH1A 4F1SA 2PR4H 5FUZH 4HJEA 3ABLB 5D1XD 3EJUA 2IH1A 3F7YA 2YD4A 5FW8A 2VT0A 2VDOB 1NMAL 3T6VA 3K71B 1BQSA 3M07A 1RERA 4A2GA 3A22A 2WUBL 5EIVA 3VXTA 4JNXA 5SWSE 3SKOA 5I2IA 3Q8CA 4LDCA 3ZR5A 1T1WB 2OLDA 4ALAC 1HN1A 5LXGL 1GHFH 1QRND 2FX8L 5LGYA 2WP3T 3K2UH 4YHIA 5GS2H 1IKOP 2Y06L 1GS8A 3CDFA 3I2CL 1RJZA 4EVNA 1L9SA 5C71A 1CGSL 1SDAB 2HJLB 4TM9A 5CGTA 1TTAA 2A6DB 4PGCA 2X4PB 1ID2A 2O6DA 3N42F 5GJTH 1W8NA 4OF3A 5BJTA 4XCCH 1HOCB 4ZX6A 5SWSA 4NO0A 1R0AH 4YSRA 1LDSA 3LH9A 3W5NA 3FQTB 3UTSE 3MOAH 3Q06A 1WAAE 1ACCA 3GBNH 2CD0A 5DHVH 3T1FB 3I9GH 3FB5B 3MLPA 1CTMA 3DHPA 5DQDH 1ZT1A 5BZXA 5B39B 2XTJD 4L3AA 1XH0A 5TQ0H 3L4UA 5IV2A 2APFA 2QQLH 5D71L 2JKWA 2JJVA 2P8PB 9CGTA 5IW6A 3ZTDC 5A2CA 5DJYB 2YFOA 3H53A 4ZD3L 2JJTC 5DK2B 1GGCH 3UTTD 1UZ8A 2RMNA 1YN7B 3ZT5A 3K80A 4XCNB 4PVMA 1W15A 5KVMC 3ULVL 3MRKA 4LFHD 3UTSA 5A1AA 4F9LC 1WAAA 4ZOEA 1ZLDA 3APCA 1T2JA 2AVGA 2B4CL 2A6KB 1VA9A 3LZFH 4DKDC 1OALA 1HFUA 4Y4FB 4MMYB 4JW3A 4UIKL 5JOFB 3PFQA 1FNEB 2XKNB 3QEHB 2BIQA 4NQVA 5F3HA 3O2DH 1FL6A 1BA9A 5DWPA 1ZLVH 4Q14A 4Z7WA 2BX5A 4WY7L 1DVZA 3N04A 4HXBH 4I1PA 4U1HB 2CIKA 4HVBA 3AXHA 2DQMA 2NDGA 4RNRB 5DEFB 2YA0A 1PW3A 1SM3L 1NFDF 3SEPA 2N1KA 2VITA 5D7JB 4MCNA 4XXDA 4JDTH 4Y9CA 4GT0A 3O4LE 1I1AA 2DTSA 5HGDB 3BN3B 2F58L 4H1LA 3TWYA 3SBWA 2LLLA 4L1SA 3VQ2C 1A7NL 3IJHA 4XHJC 4AQ8A 3AG3B 4L1BA 2KLRA 3PWNB 4NS0A 5EU4A 2X2HA 2ESVD 3TVMD 1UT2A 3MRCA 3ZYJA 3LPOA 1PSKL 4MLSA 3D9AL 4I77L 4H8WC 2E0PA 1V7NH 4YSCA 3TEWA 4L9LC 3KPSE 5EUOB 4I0PC 3NIGF 1BMGA 1F90H 1WS8A 4D9RD 3NZ8A 2WQ8A 5FO2A 4CN6A 1NGZA 5TK4A 4IBQA 2VRKA 4TKWA 5D4HA 2IAMC 2XPGB 4S2SA 1HSBB 4APQB 3BAXA 3H8NA 1PGRB 5FYJL 4NGHH 3UAFA 1XGQB 3MR9B 3G5YA 4RLDA 4WV1B 5GSRA 3ULUF 4K2UL 1F4HA 1CXHA 1CN4A 2P5EB 1MG3C 4UTAA 1XCQB 2XVBA 1NA8A 4MYWB 2OMVA 2R59A 1X6NA 3SQBA 2WBJC 4K15A 2Z31C 1JZ3A 3HS9A 3KPSA 3EBHA 3AB0B 4HWUA 5F70A 1A2YA 2BCMA 4I89A 4MDJA 4TL4A 5LQBH 4GXFA 4NFDA 4HPHA 3P3TA 1MF2H 4IGBB 5IB2B 3O2WL 4JJ5A 1KLFA 1T5WA 1AQHA 4C4UA 1JBJA 4YHLL 5HYEA 4DKFH 5IROD 4W9EC 2HKFH 2NDFA 3U4AA 3OZLA 4YHKL 3OMNB 1DBMH 4BFOA 3MYZA 2HMIC 5JXAL 1E2ZA 1UXSB 4CAGA 3VGEA 2K45A 3HNSL 2B1HL 1NCDH 2MPVA 4ONHB 5FUCC 3SGDH 1J0YA 3W9EB 4Y8AA 4YHMH 2XNAB 5E51A 4Z7QF 4GB9A 1GJIA 4PJEB 4PREA 2O4EA 1FZMB 1K4CA 4FQCH 4L2YA 1PJ9A 3WHXA 4GI6A 3SDXE 4Z77B 2AI0H 5CJXC 2JKLA 2BS8A 2QSCL 1R3JA 5A16B 1DJHA 2UXGA 3HE6D 4BKSC 4Z3IA 3W2DH 1RURL 5HY9A 1E2VA 3WDJA 5DWUH 2HB0A 3BXNA 4M03A 3X13B 4ABWA 1BLIA 3LRMA 1YPZF 2V4LA 2BP8B 2G0LA 2J5LC 1NAML 1BYOA 4U1LB 6FABL 3NPZB 2IWKA 5FCSH 3S6CA 4MQSB 3WTYA 2BO0A 1JSYA 4XB7A 1HHGA 3QORC 1PNDA 2DJ4A 2VYRE 4WI0A 1OAYH 4JCLA 3STZB 5DJCA 3HBZA 1JXFA 1RUML 4OBSA 1GJUA 2BZ7A 2VDRL 2DQIL 4PJXE 5F8RC 5DD3L 1BVOA 4PCKA 1W72B 1KYDA 3ZL1A 3LQZA 1H5BA 1KTDB 5L6YL 4HC1L 2OTUB 1UM4H 1UYWH 2HRGA 3HC2A 4BZ1A 2VDOH 1EZUA 3ISWA 2BIHA 1ZA6A 3U79A 1LGVA 5JPNC 2BSRA 4OFIA 2AEQH 4ZW7A 2ZOWA 4TQEH 3RZCD 3F7KA 4KXDA 3L81A 4YBQC 1FHGA 3RTQA 4PJ8A 4FG6C 3CC5A 3BVNB 2WK2A 1YEKH 4RGNC 4PJXA 5HHQA 5MEOB 3JV0A 1AP2A 1DCLA 2G5RA 2Z4QB 4P5TB 3V0IA 5T5FL 1X5MA 1OAKH 1U3HC 2J8UF 3BVXA 3O8XB 4P49A 3ARBC 1AMYA 1LEIA 1XGYL 4L1DA 3NJIA 1G7PB 2V8MA 3U0WL 3Q01A 1QFUH 1SJXA 5C0CE 5I15L 4MKTA 1MREL 1C5DB 1PAZA 3GSWA 3NCEB 4H0IA 1RAMA 1E9PA 4OJCA 2HVKA 2ERJC 2PCPA 5T3XD 5E2VL 4BKLA 5AVYB 1D3CA 1R6VA 3QFJD 4P9MH 1D7FA 4P2RD 2R69A 1PZSA 3IJYB 1TZ8A 3R18A 3G7TA 3FKUS 5HHPA 2BFVH 5KJ7E 1AR2A 1LDPL 2DKSA 2O5ZH 2DBLH 4UQ9A 4HAKA 2VR8A 1YUHA 3TJPA 4PWKA 4YFEA 2VB5A 5CUSL 5DTFB 1MCWW 3L2LA 1L3NA 3VFTA 5DHMC 3L95A 4XBPB 1JPTL 4WEBL 3KDMB 1U4FA 3E0GA 3VSVA 3M17A 3LEYH 4JB9L 3RVUC 4UUJA 3GKWH 2UXFA 2JIXB 4XC1L 1HSAA 3N91A 4WGVB 2OL3B 4KTEH 1A4JA 2GBVA 2E4TA 4HS8H 4CU8A 2XWTB 4G8FB 1NBYB 1IB5A 2YD9A 3FRPB 4FTVB 4XNUH 2L4OA 3LXBA 4K3EH 2D8KA 2Y5QA 3VG9B 3L1FA 3QEUB 2XQ0A 3TOPA 43CAA 4MMXA 4ENZA 2I9LB 5AUMA 1EJFA 3D39B 3WS3A 3HLKA 3K2MC 4PV8A 4G83A 1A3ZA 1SXZA 1H3TA 2JTDA 2FE0A 3KR3H 4LDOB 3H0TB 2D73A 4R4BA 2ODHA 2PWDA 2A0LD 2H0PA 2CZNA 3FZUC 4XNDA 1UCBH 4K7PH 5JIHA 5F6IC 4CNIA 3L3JA 2AC0A 4YNYB 1J48A 4XO4A 2P49B 5ADPH 1UACH 4PJIB 3FT2B 2NY3C 1MCPH 4KKBC 2GABA 3WJMA 3L48A 3DOSA 5I1CH 2KZKA 3KYNA 2YRPA 1VACB 3A4EA 1SLWA 2HFGL 3O45B 3EHBD 4PP2B 1I85C 3CXHJ 4NRYB 4ZPVB 4I5BA 1KPUA 1FAKT 3FU7A 3ULAB 2OMXB 4DK5A 5I5IA 1AC0A 4CC4C 2DM3A 1TJMA 1LD9A 2UUDK 4PI2A 4FNLL 4R3SB 3SCMB 1CFNB 2OBGA 2DI7A 1GW0A 5E1GA 1U6AL 5E6IA 3T6WA 1MWOA 1XF3B 5K9KA 1EDQA 1CF1A 2UVFA 3O0RL 3A4FA 5HGHA 2NUTA 3SE8H 2KS0A 5DT1H 3TASA 3FFDB 5IJKA 1IJNA 3BGAA 3WG7B 4D94A 4DTGL 4KKZA 2WLIB 2JKSA 3IGKA 1U8MA 5LLIC 1IAIM 2W0FB 4JVUA 1WITA 3GSNL 3FOLB 1JMXA 4WWKC 3UG4A 1JPSH 3RJDA 2YPVL 3K8LA 4JQVA 2DYPD 3WEMA 3TTYA 4QHMA 3L17A 3UO1H 1DSFL 1O7DE 3CH8A 4HBQA 2X05A 3GBLA 4JHAL 2OQJA 2DRUA 5D2LB 5E2UH 3VH8G 4P57B 4AXWB 3KBEA 1KCSH 1R46A 2NY4B 3DOIA 2X4OB 3U9WA 2IDTA 2IDQA 2W80C 3VGGA 4LU5H 4XCEA 1FZOB 1JNHA 1U42A 5L7XH 2HRHA 4FULA 3VD1A 1T4KA 2BHZA 3AY4A 1QASA 1A02N 2R1WA 1ZLSL 5L8JB 4IKKA 4JKMA 4KJYB 3Q2NA 2FDBP 2IQ9L 4PRDB 1AKJB 3V5HB 2ZUQB 4QI3A 2CO3A 3M6DA 5H2BA 1V05A 1VGKB 2OCJA 4XHQA 3ZLQC 3FRUB 2Y2WA 1AD9B 1HIMH 3PWUA 1D5IL 1U3NA 4ZO7A 1JI2A 1GHFL 2AXJA 3C9NB 3T2NH 2BS71 2ZAIA 1JXJA 4FMVA 5JW5A 3H9SB 5EZPA 3HCVB 4AGMA 3EDKA 5C86A 5J6GA 3JZYA 5D96C 2O1AA 1BSIA 1W72H 3DXAD 4LCUB 1Q9LA 3TIEA 1EJ8A 5IG7B 4KHTH 3V0HA 1HDMB 5DHYB 1OLZA 2VL5B 1S9VB 1YO4A 5EBMB 4AYID 4OQTL 1MJ7H 1RPKA 4H13C 1HEZB 1GKEA 4V11A 1R0AL 2GTZA 4Y5VA 4BFNA 5B3JF 4A7SA 2XFGB 3T3PB 1DVXA 3MOAL 1NICA 3B5TA 3NCXA 4TF4A 5DFTA 2JCCB 3I9AA 3TEYA 1IMHC 2JKJA 1ZHNB 4P59H 3HHSB 3OV6A 1FE8H 1W8OA 1PL3A 4Y5YB 3SPHA 4FZ8H 3ETBF 5TQ0L 4GRMB 1IUZA 3T04D 2QQLL 1NKOA 1FYHB 2O5XL 3MAWA 1CYWA 4QRQB 3ALPA 4R83A 4OAWB 3ZDXE 4XPBH 2FWLB 1GGCL 5B7MA 2C8NA 1JD7A 2YD0A 4POUB 3REWA 2Q1EA 1I1AC 4DZ8A 4EN3B 2WWKO 1RZ8B 3SBWC 4JY5L 3T3MB 3MRRB 2H32B 3DX1A 2EUWA 3EBAA 3LZFL 4WU7B 1HYSC 1KCRH 3L1GA 5C6TH 4BFJA 4KNUA 2HYMA 1VZIA 4NKMB 4Y9GA 1HHKB 3HZMB 1XXFC 4FERA 3FO9A 1FAIH 3O2DL 4WKZA 5EFIB 5I0DA 2BC4B 3B1TA 1RU9L 4W9DC 2ARJA 1F2XK 1AY1H 1JVLA 4L3ED 3UXFA 1J86A 5IHUH 3ZRSA 2WB1A 4W68A 3RY4A 4EAEA 4P99A 3OB0H 1HINH 2WQSA 5SX4H 5TJWK 2VDKB 3KLLA 4O58H 4N2NA 2XYBA 3UTOA 2N4IA 1TNMA 2MPAL 5FA4A 3LS4H 5JORB 1BCIA 1SXAA 5CIPB 5DR5L 2JQZA 2HJLA 2WXLA 2XN1A 1NEZG 1N7MH 2OL3H 5DD0H 3LD8B 4UT6H 3N50A 5KSAC 4RMUA 3AXIA 1NIEA 3FT3B 3QC5X 2P8MA 3LH2H 1T04A 1WPCA 3FQTA 2DJUA 5I17B 3D4CA 3RVVC 4GEJA 5ECJE 5DO2C 4GAJH 4P4KC 3RWEA 3T1FA 1RCYA 1UJ3A 3FB5A 2VDMB 4O5LH 3TJHD 4HPOH 2OTWA 3QQ4B 2PXYD 2AQRA 4GS7B 5JHLH 3RZWA 4AYFB 2OJEA 3Q05A 1LE9B 4LIQH 3UZEC 2BMKB 3FB7A 3BKCH 5GHWL 4UNUA 3BD3A 1SHWA 2P8PA 2ZOKB 1SF5A 5ACZB 2B3RA 5DVMA 3MV11 1OT1A 3KLKA 4NGHL 5KAQG 5BUPA 1XF2A 5DK2A 4FFWC 1ODUA 1ZPUA 5D7IB 1YN7A 4KO5A 3CSGA 1YEDB 2X2IA 1P2CB 2DYSB 4AENB 2CXKA 1W8EA 2A6KA 3U1SH 5ID1A 4NRZA 4LLMB 3DIFB 4WFED 4Y4FA 3FSOA 1BVLB 4MMYA 5AAMA 4BFRA 1FNEA 5LQBL 1SRDA 1WF5A 3QEHA 3HAEB 4QJ4B 4X7EC 7FABH 4NWUL 1WBYA 2BP0B 5MHSD 1BEXA 1KCVH 4PRIE 4TTDD 4HAFA 3RNQB 1EO8H 4OM1H 3E38A 1NGWB 2XFXB 3HVDA 5JTWA 1DBML 4KK6D 4TUJB 5EIIB 2IV9A 3WUWG 1NCNA 1TEFA 1UWEL 4B3VA 4PJGE 5D93B 5CBAA 2ICWA 5ICYA 2Y25A 1J11A 4O2CA 4FQCL 4M3JA 3TS8A 3QPQC 2XN9B 1Z9OA 2XA3A 4FQXA 3T5WA 4AKQA 4DGWC 1TVHB 2AKRB 2MQCA 4P3CH 2CRZA 2R2CA 2Z34A 4PRIA 2P5EE 4PS7A 5DWUL 2Z92B 3FQWB 1IBHA 2A6IB 3B5HA 2MOQA 3QZWB 1OGTB 3U2SB 3LRGA 2FEEI 1ZLEA 2AFNA 3BUTA 2PNDA 1HH9B 4IBLT 2LFGA 4M61A 4OLXH 4PJGA 2I85A 5E9DA 3SB3A 3CHOA 3K0WA 1VEOA 2RALA 3ZQ9A 1OAYL 2ADIB 3REVA 1LK3H 4OLEA 4FHJA 3T0BA 4QJ5B 3ZYZA 3F01A 5ACLA 3SE4A 5EEYA 2NY5C 5C0BD 1ET7A 4HQQH 1IRAY 5IHHA 3J27A 4KDVA 1XCQA 4IIQC 3EFFA 3D51A 1X5XA 1YNLH 3TV3H 1UYWL 4EDWL 4X5XB 4FOMA 1MVYA 2AEQL 3MUY1 3P73B 3BMVA 4TQEL 1QZNA 4Y4HD 2BSBA 4F2MA 3UGXA 4J8RB 2ICES 2X40A 4QNPF 3MLYH 4K7PY 2ZXWB 3ECQA 1L4IA 3B2DC 1NFAA 1G7LA 1A8JH 3GUTA 4IGBA 2FHFA 1O5PA 4B9PA 4UV4L 2QLYA 3SOTA 2WXQA 3H7BB 5JNYB 1KIUB 1MIMH 4KMTL 3EHBB 3LS5L 4PWIA 4TVPE 1UXSA 2CUAA 2D03L 4ONHA 4R7NB 2XNAA 4JQXA 1IBGH 3LIUA 4HHWA 2DI8A 4ADJA 4OF8A 1FZMA 4LDEB 2XQYA 5C0GA 2VXQH 3MC0A 5K9OB 4K23H 4L4TD 2A7BA 3D25B 3DYMA 1KGCE 2AZAA 3MRMA 4WCYL 4X5LA 1LEGA 5A16A 1D5MB 2Y5TA 4WO4A 5I1IL 3FONB 4P9ML 2R2EA 1FLRH 1DFBL 1A65A 2JQAA 3NCCB 4PG9B 3SKMB 5FR3A 4F15C 1A1MA 1YYLL 2BP8A 4FYRA 5I1GH 2XQBL 4WJG3 3IRZA 1PIFA 2J88H 4MMXC 5D7EA 4ZFOA 2XETA 1I31A 2AXWA 4HK3J 1D9KB 3BC9A 4OD2B 3UOAB 3H54A 4IKJA 5HVHB 3KAAA 2LVCA 1AHWB 2VISB 1EQWA 2VLJD 1Z3GH 4A7VA 2EDTA 2XPYA 1Q9WA 4FFZL 1K72A 2H2PD 2H32H 2A99A 2M8XA 5F6HI 3A3YB 3GKWL 4LKXB 4ZTEA 2LLNA 1KT2B 5I71C 3HNTH 2OTUA 2BSCA 3QPXL 4KTEL 1TQVA 1QWHA 3EAKA 3RYMA 5FECB 1GJWA 3BZ5A 4NHUB 4TQPA 4QAMB 4XAKD 5E2WH 4ZSOE 4DSYA 5MEPA 1K8DA 3LNIA 5SV3A 4N9OB 4XNUL 3CFEB 4LNRB 2VW6A 3AVEA 4JL1A 1S5HB 1NCUA 1TVBA 1U8HA 2BVPB 3C60B 3HI1A 4XXCA 1P84J 5KZCD 2Q7NA 5IHZB 2FL5B 2I60L 3LKOA 5DI8B 3SBPA 5KYXB 2Q76B 3AM8A 3P69A 4OZHB 3FC8A 5CIPH 2K8MA 2APSA 1N3NB 3EDEA 4AEEA 5C08B 1KFAL 1LILA 4MZ3A 1G7PA 5KVGH 2J3SA 4ZSOA 4A1RA 4JVPA 4K8RC 5D6DC 3HNVH 5I1EH 3EGSB 4Z8FL 1UCBL 1EA9C 1MZYA 5B4MD 2VE6B 4L4JA 43C9A 5AB0A 4OF0A 1QMUA 3I9PA 1YEFH 1KFGA 4M5YH 3HI5L 4PJ7B 5T1LA 2VDMH 1MCPL 1OW0A 1URLA 4M1CC 2I7SA 1QPKA 5IQNA 2BLFA 3D3VD 4KKCD 4ZK8A 4LCCC 3QUZB 5I1CL 5E8PB 3C87A 4J6IA 3MSPA 2F54D 2I07B 3FK3A 2CBOA 1E6JL 4NQTA 5TE4H 5ICXB 1XDYA 4DH2A 2X4RB 3CZGA 2AXHA 2BNRD 3KM2A 1G9MC 4NQCB 2QPSA 1CGUA 1SBSH 4FTVE 2E7MA 4NT6B 3RNKA 2D7PA 3O6LL 4JZNB 3FPYA 1R24B 3K8KA 4ZXBB 4P05A 1A14L 5EU7C 1PIGA 4B96A 3D39E 3QI9D 3GBDA 3DTUB 1JZ2A 1O9VA 2XIDA 3VMNA 2WO4A 2PETA 4JY6A 1QRNE 3HAEH 3HBGA 3AY4C 4IJTA 1IC4H 4J5VA 1A64A 4KJPD 1EIBA 2VLRB 3U9UB 2OXHA 2Y1VA 5D1XA 1NBYA 2FZ3B 2KPNA 3FRPA 1INDH 4FTVA 4TQHA 3FW6A 3AS3A 1EAJA 3U7WL 4LCIL 3Q6GH 5LAXB 1W6WA 1BLNB 3QDJB 2I9LA 5GZOD 1KPVB 3UO1L 5EMYA 3D39A 2Z8RA 5JHLA 1P4BL 2A74A 4KRPC 5IEKB 3WLWD 3EOBA 3MTRA 1IT9H 1NUFA 2YEZB 5F7YC 5HPOA 5E2UL 1I7UB 4ES8A 3T1WA 3WXVL 4N85A 1QBLL 1QRNA 4ZX5A 3QRLA 1TCRB 1COBA 3HKZA 1JHTA 2LAGB 5BO1H 2EDHA 4GOSA 3FUDA 2XTJE 3QNXA 3OQ3B 2BCKB 4LLWB 1PD0A 4LU5L 4YGVB 3GMRB 1NMBH 4Y5VC 1JF1B 4OZ4B 2BH0A 1YJDH 5F1NB 1Z2KA 1MN4A 4JR9L 2A6JB 3RRQA 3U83A 3UTTE 1JPST 2OAAA 3CVDA 3LJ3A 4HOZA 2ZUXA 5C0IA 3VWJB 2FQFA 1WBZB 4GMTL 3ZUNC 5IKCA 4KU1A 1S7RA 3T2NL 1Q1JH 2LE9A 1CICD 3SE6A 3BD4A 4WQOA 3F84A 4NFBA 1MZZA 3QPKA 2OMXA 4JFPB 1EHKB 2Y69B 4KTDH 2VDNB 3AQDA 3ZO0A 4N4YB 1CL7I 3VD9A 4NQDB 1W72L 2WSDA 2HA1A 4Z7OE 4KOCA 3SE3A 5IIEA 4K9EC 4P3DB 4ZUSA 4ZAKB 4BE6A 1SN2A 2DQGH 3L9EA 3UTTA 1IV8A 1CFNA 5DJXB 2L7UA 2YAPA 5LUMA 2CA3A 4X6EA 5FDWB 5D2LE 3P3UA 2WXIA 1LO2L 4JAMB 4P59L 4Y1TA 1M1XB 1FE8L 3RIFF 4CU7A 1YN6A 2H2SC 3GKZA 4PGBB 1L0YA 2R29L 3IGUA 4G43B 2CO2A 3UO8B 4HUKB 2WANA 4KDTA 3SDDB 1G1KA 3FOLA 1EUUA 2FWOA 3D69A 1ZSDB 3QHFL 2A5UA 4YQXH 2CPUA 1IM9D 1GGBL 4YOKA 3QEGL 3TBSB 2FSEB 5D2LA 4QXGL 1F4WH 1RK1B 1CGXA 1TZHA 1XR8B 2R7EA 3FN0H 4QRSA 2G2NA 2ZP8A 1KYOK 3O6MH 2L7JA 5I16B 3QXDB 1XBRA 3MRLB 3ZZSA 1NSNH 1KCRL 2Q7AA 3WMQA 1YEWA 5IB3A 4X9HA 4D9RE 3W9DA 4XMXA 4K3HA 2DN7A 3RG1C 1F56A 4FQ1L 4I18B 4HH8A 4ZFZB 3F85A 5KUKA 1TYJA 4KJYA 1UJ3C 4PRDA 3ESOA 3TVMA 1B0GB 4J3TA 1VGKA 2ALWA 2OR9H 1IC1A 3FRUA 1UZGA 3T3PE 4ZS6C 2JCCE 5DRXB 1I9IH 1BQHG 4L37A 2SEBB 4U1IB 4XTRD 2HH0H 5IB1B 5J1AB 3SD5A 2G3MA 3HCVA 4JFEB 4YR6A 4NCC1 4F58H 3LS4L 1NL0L 3GZOA 4LCUA 2CLZB 1QI5A 2K7QA 3TN0D 1EWHA 3P9WB 5H35B 5TDOA 3KWTA 1CK0H 2OL3L 3HW7A 2XG5A 5EBMA 1S9VA 2HLAA 4F9PA 3LCYA 4Y88A 3QQ9D 5DD0L 3SIKA 1NMCB 3ULVF 1DJWA 4AKPA 1FBIH 4AG4L 2K1MA 1Z7JA 2GQHA 3NIFB 4R4ND 4Y4FC 2ED7A 2KBGA 2RD0A 5GRVL 3ARRA 2JCCA 5MENB 1ZHNA 2O6FA 3UJTL 4NBZB 4C54A 1H3UA 1JVOA 1B2YA 4UOJA 1SMAA 4LIQL 3AITA 3ZHNA 5I28A 3BKCL 3BFOA 1HCFX 1QO3A 3DJSA 4I1NB 3T0EB 4WI3A 3JV5A 4QRQA 4I3SL 3FUIA 4Y1AB 1RIHH 4QRAA 4ALAL 4OAWA 4PRHD 5IROA 5DURB 4Z5RA 2EIZB 2D7TH 1U95B 2ZXQA 1LNUB 4F33B 2O61B 1BZ9A 5D4IA 4FQXC 2Z93B 3CXDH 4G6AC 5C92A 4PJHB 4WU7A 2HVJA 2WCPA 1TTFA 5C3LD 1IGIH 4E0RB 1NCJA 1HHKA 3HZMA 4Q52A 3E8VA 2F5BH 2EXTA 7FABL 3NJHA 3P2TA 5F1IB 3NN8A 3SYQA 3V5DB 1LVEA 4PLNC 1KXTB 3L3OB 4F93B 3KWUA 5JA8B 3GMQA 1EO8L 3GRWH 2VDPB 4XOAA 2VUYA 4X50A 2UY7B 4AQ1A 2XVLA 2I32A 4IKNA 4UAHA 4DEPB 3H2PA 4QPEA 3TCTA 1UTDA 4K3DH 3RIFK 5DFVD 3GS0A 1GTNA 3SE4C 2DIBA 2DICA 4YDIH 5F97E 4C8XA 5JORA 4WW2F 4JFYA 1SQMA 4KK9D 3BVWA 1KPRA 4JJHA 4Y1SA 1UM6L 3QG7H 3PP3H 5AKRA 1ZLWH 4XN7A 4LAQH 4IRZH 4WI6A 5CCGE 1G9EA 1KEGH 4HSQA 3KH3A 3ZGHA 3WE1A 2NQCA 4TNEA 1WGOA 3AB0C 5E08H 3KLHC 3FT3A 3H6JA 5E2JA 3TA3C 1ITBB 5EC2B 2K0RA 4B9IA 5I17A 4OVVA 4XODA 5D8JL 3QCTL 1HL5A 4OLXL 3RZCA 4OY9A 4QHKJ 5I5MA 3QQ4A 3V6BR 1LE9A 4UU9A 2MMXA 2CIIB 4HGKC 1NCCH 1U8IB 5KZCB 2V5SA 1MWAL 4QGTA 2ZSWB 1FL3A 3C5JA 5T3XE 4RDQG 5EORL 1E3FA 1PZBA 4HGWA 3QFJE 4OV5B 4KVNH 1L9PA 3OKNB 4HKJA 4Z7UF 4KFMA 1UGNA 4YBHA 1JWSB 1OWWA 1QZ1A 2D3NA 1BJMA 3P0YH 3HB3B 1Z3RA 3TCLA 2NY6D 1S2EA 1DEEB 4L29A 4O9HH 5F21B 3RVXD 3TV3L 1A9EB 5HJDA 4AENA 4G8IA 2YZ8A 4PJ5D 2VRQA 2AK4D 1S3RA 2PWGA 4ZFGH 1YRKA 2J20A 4WO4C 3A6CH 3KPPB 4XP1H 3MLYL 4O02B 2CUMA 3ZDWA 3T08A 3LH8A 1WUNT 3NJVA 4LSQL 1T0NB 1RJYB 4HS6B 4HPYL 4K5LA 5DRWA 4YDZA 2UWEF 3GUFA 3ZKMD 4HEPG 3QW9A 1L3WA 1R4XA 3QFJA 5IVNA 4H8WL 2VDNH 1MIML 3K6SB 4P2RA 1WZ1H 2XFXA 3U0TB 1W2KT 4PTUB 2Q3XA 2AJSL 1XF1A 2G9KA 5K39B 3G6JB 4OZGB 4X6DF 1CDUA 3A6BL 5J12C 4HFWB 3MV7B 1DQMH 1FC1A 2OZ4L 2NZ9D 4UQ2B 3RWGB 4D3CH 5DS8A 4BXSV 2VXQL 1TMCB 2YWYA 2AJ3A 1V10A 4WNSA 3U7AA 1DQJA 3O9WB 4C59B 1KCLA 4H0LC 1KBVA 1WFJA 2O5YH 3W37A 2VRAA 1DBKL 5E23A 3EGDB 3FQWA 2BP3A 2OMYA 1L9MA 4KROC 5CNHA 1WT5A 2IFGA 4QKTA 4YVNA 2EDLA 4J3BA 3UX9B 1I82A 3T8MA 5I1GL 3L5JA 2J88L