3HC2A

Crystal structure of chicken sulfite oxidase mutant tyr 322 phe
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDFKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure function studies in sulfite oxidase with altered active sites
rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
molecule keywords sulfite oxidase
total genus 98
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2009-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hc2A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hc2A01
2XTSA 2A9AA 3R19A 1OGPA 3HBQA 2BIIA 3HBGA 3HC2A 4PW9A 2BPBA 4PW3A 1XDYA 3R18A 2CA4A 2A9CA 2A9DA 2C9XA 3HBPA 2A99A 1SOXA 2BLFA 1XDQA 2A9BA 2CA3A 2BIHA
chains in the Genus database with same CATH superfamily
3MRCA 2OMYA 2DLEA 1DVTA 2E0PA 3HE6C 4R26H 1JZHA 3HBZA 1KTKE 5KAQG 2OW6A 3HAEA 1FZKA 5B39A 3JSSA 1N3NB 4NPYB 1QFWH 3DX0A 3MYJA 1SN5A 3CDGA 5KZCB 2JIXD 4CA4A 3ALXA 4BK8A 3V6FB 3P3RA 4M6MH 3AWGA 4YBHA 4IDJH 2ITCB 2XT1B 3IJSA 4EIGB 1H3WM 1HI6A 3MRRA 5ESAB 2P80A 2IGLA 3EJZD 3QDMB 4ZW5A 5IIEA 3BEWB 1JD9A 3TV3L 4I85A 4HGKC 1PBYA 4N2BA 4X7TB 1INEH 1KYDA 4R6UA 2BY1A 1V27A 2IPKA 3ZPDA 3IFLH 1SN0A 2G75B 4IYKA 4Y16A 1INDL 5GGRA 3CPUA 4UV7H 3D87B 5HI4C 2E46A 1NUGA 1H3PH 2JKXA 3ZTNL 1A9VA 2D0HA 3NABL 3DSFH 1U8OA 5DZNA 4ZTPH 1HCVA 5TPWL 5IOKA 1KLGB 3JVFC 4U6YA 3G5VA 1GJIA 4Y2OA 4IOSA 4ODTL 2VKWA 2ZICA 3AJ7A 1U8PB 5DHEA 2D03L 2X4OB 1XIWA 3L4VA 2MEJB 3QPXL 1GGIL 4LLDA 5I1CH 3DPDA 3O2DL 5DK3A 1ZLVK 1NMBL 4UAHA 3IAQA 5I8OL 2E27H 5KS9F 1N70A 3ESNA 3HB3D 2D4FA 3HAEG 1CFSA 1HEHC 3KJ6L 1D9KB 3V52H 4P07A 4YVNA 1F86A 1FORH 5JTWA 2I85A 5F6IB 2OV0A 5LXGH 4L3CA 3PQYA 4IU3B 7PAZA 4HUNB 3QDGD 2WGNB 4M3HA 1JTPA 5BMFH 4XVSL 4HISA 1WUZA 3ZTJG 1KLFA 2FT7A 2CDGA 4ZFOL 3DMMC 2OXGB 3OMAB 1NLBH 2GFBB 1V10A 2WP3O 3H3PH 1P7KA 5E8PA 5T3XH 5TF1L 4A2MA 1JZ6A 2VZOA 3RURA 5ACLA 1FDLH 4HJ1A 3ZRCC 1GGUA 1FL3A 4C83A 5EEUA 3O6LL 1FNSH 4G80B 3UACA 2CJSA 1J5DA 3QT2A 4C4KT 2CALA 5BZXA 4JM2F 3VM5A 4G11A 3EOTH 2IH8A 5DEGA 2JB6B 1T3FB 5B1JC 3ZSTA 4BCYA 5KSBE 3LH2H 4PJFE 4APQC 4HPHA 4XCFH 1DVXA 3ZIMA 2QADC 4S1DC 3WTXA 5JORA 5AG8A 1HEJC 3O11A 4Y2DB 3WKPA 1AC6A 1FPTL 3D50A 1X5MA 3UZQB 4OAWA 3QPXH 3ZE0E 3L48A 1I8KB 2QR0B 4PJEA 3C60D 4PGBB 5SWZE 3WGUB 5SX4H 3DARA 1A64A 2E59A 3UP1A 2OCFD 5DI8A 4X4ME 4FC3E 4M93B 1N10A 3IDGA 2Z7YA 2WBJC 4JGJA 1CDHA 2AJXL 3D33A 1IGYA 1O6SB 3CC5B 4ERSL 4ZMTA 1FG2B 4K8RC 2P49B 1UD4A 5EA0H 2OXHA 2Y3AA 1IBGH 1U92A 4F1ZA 1W0VB 2RH0A 4DKFH 3QZMA 3QDJE 4RAHA 4PN6A 3U6XS 4N24A 5CN2A 2ICEA 1E4WH 2BIHA 2G4GA 3DK2A 4JO5A 4Y1AE 3HZVA 5CEYB 3KYOA 1F4WL 1NDGA 1OAZH 2C9VA 3ULUD 1SM3L 1MY5A 2P7TA 4IEFA 3UAJC 4YK4B 3ARQA 4PHZA 4OZIB 1ACXA 2A6IB 4UT6L 5DUPH 2C9SA 1R0AL 4LCCA 3FHQA 5CJXC 2F2HA 4F1SA 4X8GA 3T4AA 5IGXL 2BXYA 2HFGL 4Z3JA 5L0QB 3CZGA 4L5FE 3SDDD 5A1AA 3VXQA 3V6FA 1DUYB 1XXDC 1TTUA 3X1GA 3RAJH 2NY2D 4UTAL 4OLZL 3SDAA 4HS8H 4FQQB 3H4HA 3NSFA 3PLYA 2HMIC 4GG8A 4NPYA 4MDJB 1E27A 3UZVA 2VLKE 3HAEB 4HOXA 3FCUB 4E68A 2P52A 3QI9C 2ISDA 4Y7MA 3WE6B 4JO4H 4NPKA 3MV7A 1I8IA 1WIOA 4ODWB 3K6NA 4J3OG 4AG4L 4CVXA 1SFDA 3ZT6A 1PTZA 4ZQKA 3SJVB 3CN3A 4PWEA 3WXWH 4OZHF 5TF1H 1XGQB 4HLZG 1W72L 1BQLL 3P2BA 4CUCA 2ZWKA 4R7NA 3UMTA 1DJHA 3QWNA 1DLHA 2WOYA 4QWWC 5E23A 1A4BA 4JJOA 4UQDA 1QR1A 1USZA 2OTPA 1XH1A 4QRUA 1AGCA 1UZ6F 4FQXA 1FGNH 3B7UX 1J48A 4LHUG 3CSPA 3F7YB 4OD3L 5HDOA 2Q6WA 3FT2A 4ZOCA 4YAQA 2BX5A 5AENA 1CICC 4ZW3A 4K7PX 4DN4L 2ZONA 3QO1A 3K6FA 3VFSB 4I3RL 1NCCH 3UYPB 32C2B 1IE5A 4NSKB 1AGDA 2UWEF 3OD3A 3U1PA 4LHJB 4NKMA 3GC3A 3AG1B 5ACZB 1BFOB 2YPLE 4FXGA 3SYPA 4PW4A 2DQJH 3ABGA 3UTSD 3BT2H 4KZCA 4M5TA 4GBXC 1B4RA 2WVVB 4LEEA 5DRZA 2I07A 1WZMA 3G5YA 3FFDB 1BSIA 3LVTA 3Q8CA 4HX1A 3QE5A 3GO1H 3NCYS 3RWHA 3BDYH 3DV6A 2MQ3A 4EI6B 4H26A 2UUDH 4N0YL 3DBXA 2CLZB 5FYKD 4HWZB 2K4AA 1OKEA 5FGCE 1JP5A 2EEFA 2XJKA 1G7QA 3QULA 5I1GH 3DYMA 5B8CA 5DGQA 2CO6B 4R84A 3CH1B 3IDXL 3VXSB 4CNIB 2HVBA 1CMOA 2DL2A 2KZ1B 3QIWD 4P57B 1AOZA 4OFKA 3LKNB 1LDPL 5AVXB 1ADQL 2XX1A 1EGJH 4Y4HB 1SNRA 2J21A 4M4PA 1A4CA 1BVZA 1IEBA 2XHNA 4ATTA 1IQDA 3MNVB 5L6YH 5HHVL 1YECL 3WXVH 1BJ8A 1HHGA 1N12A 1NC4B 4KZ0A 3TTYA 3V52L 1N64L 3MJWA 4PBVC 5B7EA 4LAQH 1EMTH 3K5SA 4GFTB 1YN7B 5AW4B 4B3VA 3K6SB 4OFYD 1KCRH 2NQCA 1LXMA 5E95B 1BW8A 5C0AA 5CD3B 4FQCH 3L3OA 1AXSA 3O0RH 5CP3A 4HEPG 4DFIA 3OL2A 1CICA 3BUTA 3VTMA 1K5WA 2E3VA 2VDML 1GVIA 4DZBB 4PGJA 1C5CH 5JZ7D 3UTTA 3BWSA 2A6JB 4RDQF 3VRIA 1R5IB 3AM8C 4GKZB 4XXDA 3D2UA 1X7TA 1A3RL 2IDFA 1ITCA 4PD4J 5CCHE 5TDOB 1J9TA 3N41F 4ZOBA 4GBXA 1WBXA 5I1LB 1OW0A 1EAQA 2Q3XA 4NHUA 4B9IA 3TVMA 3EOTL 3IGAB 4HWBH 4QF1B 2FO4B 4MQ7B 5KJ4A 1AO7A 4R8WL 4Y9GA 3O8XC 2NY7L 1CE1L 2AQNA 5HHMB 2C1PA 4Z77B 3I6KA 2JKLA 4W9KC 3W11C 2DM4A 3CE1A 1TJIL 3WIHH 5HVHC 5LWYL 5FGCB 1W9XA 3GBNL 2Q3AA 2XC8A 5D1ZC 3FOMA 4BDVA 4MJ5B 1N67A 2F1EA 5A2CA 2A9NL 4JY5L 5GGRB 4Y16B 2P5PA 2K78A 1PD1A 5BS0B 1ECYA 3V9FA 3OC5A 1VFBA 2PW1A 3ZUCA 2Z92A 4MGXA 1NPJA 3M07A 1SXCA 4QTIL 1R5WA 1XGZA 3BEWA 4KFMA 3BXNA 3ETSA 3SYOA 4N8PA 3T0EC 3NCYP 4JFQB 4Y4KB 2ZG1A 4WTZA 4DGYL 4Z8FH 5EFIA 4OJCA 4U6HA 4XMVA 3IJ9A 3U2IA 3FCSA 3MLZL 1BQSA 1C16A 1DQKA 3DX7A 4JX0A 3DWTA 4XVTL 4Y2NA 3EYSL 3M6DA 4RMUA 4Y1AA 4M62H 2X6AA 3I9GL 5IF0A 1IB5A 4Y1TA 5EBLB 5M7QA 1NCWH 1ZSHA 5IQ9A 2W9DL 4W9EC 4QXUH 5SWZA 2ED9A 2E8YA 3SE4C 2WD0A 1ZWIB 3NABH 4GW4A 2D31A 4WNQB 4CVZB 4HT1L 2VT0A 2GBAA 3BAEL 1T2QL 2OZ4H 3MFFB 4M61B 3Q5OA 2I25N 4PV8B 1TJIH 4PJGA 2AV1B 1YQVH 4JGNA 5I82A 5I74C 5LUMA 1N8ZB 4X9BA 1I8UA 1VCBC 2APWA 3IS1X 4QY8A 3O2DH 4MWFB 1KPRA 1KTRL 3QFDB 1JI2A 2OX5B 1BQLH 2XA8H 2B4CH 3VWJB 5HJDA 1RFDL 5EF0A 3DIVA 2E27L 5D1ZA 1XGTB 1NA8A 4NBXB 5IJDC 1HH6B 4OLZH 4J8QA 1T5XB 2H32B 5F7EL 1KG0A 3F64A 2ADYA 2BC4B 3FBKA 2VLLA 3S3CB 1VA9A 4Y1AD 5F0MB 4JQXA 5DZAA 1EGJA 4BSWB 1BM3H 2IOOA 5FECB 5I5IA 2RCSH 4M43L 2R15A 4W9IC 2X4UB 4FNTA 2WYHA 1DVSA 1OARH 2ADJB 5FYKU 4JKLA 4EUPA 5L88L 1E4XI 1NMCB 4LKCB 3HS0B 2HX8A 2EJ1A 5F8RC 4AGMA 3LVEA 3X1EA 5CP3H 4B41A 2MCPL 4M03A 3ES6B 1TEGA 4XCCL 4XC3H 5DYOB 2QBWA 3CZFA 1I1YB 4X6DB 4M7KH 5FO9B 1BIIB 5C0IB 2Y25A 4C56D 2E6JA 5DZLA 5EU4A 1SMAA 3MRMA 4NUGH 4MVBC 1PSKH 4WI4A 3DXAD 4KKAC 1R3JB 4L9LA 3ZDWA 4FQHA 1AD9B 4TKWA 1LDSA 4LHUD 1ORSA 2P5EA 3BYYA 3HNVH 4C56B 3BLBA 2VLRA 4GXFA 4OV5A 4EVNA 3MLWH 1LE5B 4OBRA 3AS3A 1P7QB 3WHE0 2NY4D 3HE6A 1IM9A 3K72A 5JXEC 2EUZA 2ZXAA 5JW4Q 2EZ0C 3CD4A 3L16A 4HWZA 4ZXBC 5DJ8B 2NX5B 1P7HL 2FZ3A 3IJYA 4JFTA 4P3WA 2I9LB 3BP4A 3GSNH 3IDMB 1EFXA 1JTTA 1XZ0B 4Y2DA 4EIUA 2Q76A 1J7VR 3KL5A 2F15A 3VQ1C 3QCUH 1RK0B 4G6FB 3IMVA 2X41A 1FHNA 4YNYA 1G7MA 3GXDA 4D9LH 1B0WA 2R4RL 2B3IA 4FQ1L 3NIGF 4OFYA 4HPOL 5JZ7C 2ZQKA 2ZAIA 4NM4L 1I1AA 3I3BA 3VE0A 2BNQA 1A7OH 4MYWB 1GSMA 3KEDA 2I60L 3TP4A 3QEUB 1T22A 3QXUA 4H20H 2A73A 3D4GA 5I24A 3OF6A 1A3RH 1WFUA 3GSUA 1EH9A 5IB4A 4PP2B 2XYBA 3VI3A 1HHKA 3GHBH 4XXWC 4N6RA 1GA2A 2V8LA 5CINH 3CUPB 4YHLH 1KGUA 4WI2A 1YNKL 3CLEH 5EO1B 1FN4A 4JG5A 2Y36H 4WU7A 5F9JB 4DT2A 4LHQB 2D7MA 4KC3B 4U05A 1F6LL 1SBBA 1PQZA 1ZY9A 5AVSB 3TYFB 4K3GA 1JRHL 4L2YA 1NFKA 1KIRB 1YEEH 4DVBB 5IBUB 5ICYB 5DJZA 3QI9D 3EUDA 4AYDC 1Q0YH 5D7IB 1E50A 3SGJA 5JA8B 2VQUA 1QHOA 3EJYD 2XWTA 3HBGA 1H0DB 4LGRB 4Z3HA 1WDAA 2H1PH 1JF6A 1DSFL 1JVKA 5MEQB 4TQIA 4U1KB 3WE6A 1NBYB 2EDRA 2XV6B 1GC1L 3DROB 4KV5E 1BFVH 2R0LH 4WHTB 4XPBL 4EN3C 2BK8A 2VC2L 4TSAL 4FQQA 3T3MF 4M7JH 1WFIA 3ZY7A 3QJVB 1HHHB 2P43B 2XYCA 3CDFA 4ZFZA 1V5JA 2YUZA 2VC2B 3I75A 4GBXD 4P4KA 3WFEH 1A8JH 2BSSB 3ZE2E 1MW2A 2A83B 2CKBL 3QO0A 4JPVL 1Y0LB 5GRXG 5JHAA 2OQJB 1XD0A 5JO5B 3RTLA 5DO2D 3ZQXA 1T89C 1I3GH 4HK0A 2F61A 4IKJA 1EXUA 5D6CA 4A2GA 5B1JA 1CICD 3ELQA 2DW5A 4MAZA 3CHRA 2WMPA 1M1XB 4RAUB 4YH6A 4GAGH 3ULUF 1MW1A 2DLHA 3EO1B 2BCKA 3IJHA 4DN4H 2CCLA 4XP1L 4W9CC 3ZQWA 2VSDA 1KXVA 3H7BA 1FZOB 3EXJA 3MUUA 3S36L 3OZ9H 4ZUUB 3AS2A 3D4CA 4J6IA 4ZUTB 4XRCB 1M3IA 4KTDH 1BZ9A 3VMPA 3ZTNH 1G7JA 1RIVL 5C1MB 5HHVH 1SLVA 4MA8H 4WW2C 4X4KA 5I8CB 1JFQH 2EEXA 4ERSH 3FF8A 3LEXA 1TG8A 5L8LB 4AT6A 3C6LD 3DMMD 3F8UB 4NRYA 4PGCB 5GHWL 3CU1A 2UY7A 5GZNC 4MRCA 5F8QC 2J88H 4KJWC 5C92A 1AGFA 2KDYA 1I8MB 3CVCA 2APBA 1Z3GL 5C3TA 2QLYA 1IM3A 4U7MA 2CO4A 4A39A 3MA9H 5C0GA 3FFCA 3WMPA 1PIFA 4CN6A 5I6KA 2BZ7A 5MP6H 1XBDA 4ZTOL 1Y6MR 4R26L 5MEPB 4NZRH 1CTOA 1EAOA 1ETZB 1UH3A 3KPLB 4ODVH 4WQOA 5DMKA 5I6LA 1D5IL 1R46A 4UTAH 1RERA 4LLVB 4RQQB 3ARFA 2YRPA 1CU4H 2DF3A 2ZSVA 4KRPB 2BJML 2MOGA 4UDUB 4YS4A 3HMXA 1TZOA 4OZ4B 1DEEB 1F5WA 1D7BA 4YHMH 3THMH 4DHLA 4G5AA 4I4WB 1NCOA 5GGRY 4MZ3A 4JDZA 1RH8A 3F7RA 1WD9A 4WFFE 1CUOA 2WP3T 3DX4A 3FTZA 5IHUL 4U1IB 3F7PC 3NN8A 4NRXB 1GC1C 3U30C 4O5LL 4QCIA 4AJWA 2HVJB 5F7NC 2VDRB 2BSTA 3IKKA 1NCBH 4GQZA 4CSPA 4E9WA 4O2CB 3RIKA 2DMBA 4S1RH 4XO8A 5E6SB 3DSNB 4G8IB 1MJ8L 5JPMB 2UXTA 2K45A 5JHDA 1A02N 4JPSA 5C0JB 2QADD 3EOYG 4NT6A 4P9HL 4S1DD 3MOBH 1MRDL 3LNHA 4RISL 1P6FA 2FUTA 3GSNL 4N0CD 4PB9L 4LPVA 1YLBB 2NY2B 2BVEA 3NYKA 1ESOA 2OI9C 2IWKA 1MFDL 4NZUH 4PJIB 1BV8A 2W07B 3N85L 3SGDI 4LLYB 4G9FE 4F7PB 1ITBB 1TQTA 3MCG1 2ARWA 2ZJSL 3OLIA 4YIQA 2P8MA 3CVDA 2H47C 3OJ2C 4JAMB 3U4AA 1MI5A 1TJHH 2BIIA 1JK8A 3ULVD 3NSCA 4HKBB 4HEME 3K0YA 4PJ9A 3V6ZB 1OO2A 4QJ5B 1S7TB 1QSFE 2FD6L 4X4XA 5F6HJ 5AVUB 4HJEA 2E86A 5C7ZA 4JFFB 3S3PA 2JCCB 1CI3M 4GSQA 5GJTL 1JPFA 1HZHH 5KBNC 2AV7A 4MNQB 3RVTC 2F74B 1WEJL 3B9EA 1UWEL 2ADGB 4IKNA 1X5GA 4AIZB 1BLNB 1ACYH 4JANA 3Q1SH 4PRPA 1LHZA 3IU4L 1N7MH 1E0OB 4Z7WB 4FLRA 3FQRA 3MC0A 1A0QH 1EJFA 1IBGL 1X9UA 2JTDA 2GSIA 2J4WH 3VXTA 4MNQD 1S3RA 3QBTB 4I77L 1E9PA 4JFHE 5JIMA 3W81A 3KPOB 2EIMB 2EO9A 2OR9H 1FH5H 2AQ1A 1QBBA 2HG5B 2VR6A 1EDHA 5AKVA 5DEZA 3U2JA 5KSAA 2JKIS 3OAZH 3UP6A 5SX4I 1KDIA 3O6FA 4MAYD 1HL4A 4R0LB 3WMQA 4WEUD 1FNAA 3VFRA 4UNVA 3CFDA 1IFGA 1IFHL 4OJFH 4JE0A 4EN2A 4YHPA 5AG9A 3VH8A 5D2NA 3B9KD 4U7SA 1HQRA 3HG1A 3LY6A 4IQHA 5HI5C 4RNRA 1KPVB 3ILPB 4N5ED 4KXDA 3V5DA 4AQAA 5C07B 3SPVA 5EO9B 2FEDC 3NAAH 4Z9KB 3GRWL 4AEHH 4XMZA 3BX7C 5E8DL 4Z7VA 4AEIH 4V2BA 5BO0D 3ZDZF 4KTGA 2Z7WA 2YD3A 2YRLA 4XVOA 2VWEC 4FYSA 5D71L 1R33A 2X0UA 1LK2A 3B83A 5ADPL 4H88H 4L3EA 1I7UA 3E8UH 3TIEA 2EIJB 1XCTB 1MCWM 3MRHA 1CB4A 1ETJA 3I9IA 5E6IB 3GMMA 1QVOB 4XC1L 4Y4FB 3DX8B 5IVXF 3QFJE 3VFMB 1KYUA 1MI5D 4F2EA 3Q6FB 2UZXB 4D8OA 5GXBB 1JHKH 3ZKMC 3ZOAA 1ZA6A 4BGLA 2ZOOA 4MQXC 1K2DA 4W1TA 3JV6B 2B5IC 3RVUC 1YEWA 3T8MA 5GSRA 4EMZA 2VDMB 3Q8EA 1ROWA 3C5JB 4OCRL 4N0FA 1KPUA 4YDIL 3SOBL 1Q9LB 1QW8A 3SGEH 2Y36L 1VZGA 4GAGL 5E2WH 1NMAL 5GJSH 3F84A 2ZPKH 1E5YA 5BRQA 4CVWA 3CPLB 4PS4L 3BGAA 3JYCA 1R3IL 3O6FC 4Q4EA 3P3UA 3FQUA 5BZDA 3CBRA 3VG0L 2J6WA 4KGLA 1AKPA 2LTQC 5AVTB 2D7PA 4NAMA 3UTPE 2X1QA 4H8HA 2G60L 5G5DB 3EJZC 4ZW6A 3FCTA 3RX7A 5FDWA 2NYYD 1A3QA 3DX6B 3T0WA 2UWEE 5DXWA 2J1YA 5EU6D 3T1WA 1T03H 4DEWA 4YSTA 5LGJA 4DP9X 3VVWA 1TTGA 1W0YT 4RGNB 5CZRA 5IJBC 1JNLL 3CH8A 3DLQR 4WW2F 3VFUA 2ARJA 3IVKA 3QCUL 2H8PA 1KB9K 5J6GA 3BQUA 2O61B 1DQMH 2XLLA 3IFPA 3MLXL 6FABL 5E7FA 4YUEL 1LO3L 5AL0A 3SE8H 3U1SH 4GMSH 3PY9A 4GKSA 5J6HA 2PO6A 3KZ8A 3D39B 1FHGA 4LVHB 4P5TA 3UG4A 5I1IH 1U8KA 1TU2A 1UD5A 4GT0A 1DVQA 3B34A 4BFBD 4E2OA 5MP6L 1S9KC 1I1FA 1TZHB 2ESVE 2XBZA 1MQKH 5KTEH 1DVFD 4NQCD 4OLVH 4J2QA 5DMIL 2R1WB 4LCUB 1C08B 4KOCA 3SPHA 3NJJA 2EIKB 4JKKA 1CLZH 4NO0A 4WSKA 3BZ5A 2EYRB 4KVNL 1RZQA 1MLCB 4UBDD 4H88L 4EKXA 2H9GB 5C08B 2D7TH 2W60B 5DS8B 3V0WH 3GJEA 3L6FA 3FB5B 4M6NL 3H53A 3E6FA 4ZUVA 2PP9A 4CU6A 2V7NA 3TYGH 4X6CF 1U0QA 1Q0XH 4M5YL 2QHRL 1DZBA 2R1WA 3QNYA 4JN2A 5C2BH 4FXGC 4YOKA 3MO1A 4RX4D 4U2YA 3HI5L 2BZDA 4LL9A 3KJ6H 7TAAA 1RSYA 1U8KB 3B7RL 1A21A 2UWEA 2Z8WC 3GEFA 5CN3A 1G7HB 4I18C 1ZLVH 1W72B 1KSRA 2D9QB 1M7IA 1QABA 4OSUH 1AE6L 5T3ZL 2R56H 4DPCX 2VR4A 1WQVT 4KY2A 4DCQB 5JHDE 4ZMVA 4JM4L 4XHJD 2PNDA 1J0ZA 1Z32X 1CYGA 2DL9A 3KXFB 1JGLH 4HCGA 1FFNA 5BQ7B 1NIEA 5DJDA 2CO3A 3BEVA 3D0LB 1JGEA 3WNMA 4DGWC 3WS6C 3C5XA 4FMVA 4I7ZC 2PXYC 5FA3A 4MS8C 1FFPB 3BC9A 4XVJL 5D96B 3LNIA 3RVXC 5CD5C 2Y6TE 4JG1L 4LEBA 1CL7I 3GZKA 4TLTA 4KK9D 3L95B 2WUBH 4Y5YC 1NAKL 2Z0BA 3QXWA 4PJHA 1WFJA 3BAKA 1B0RB 1ZVSB 3N04A 1D7CA 3RZCB 3EFOA 4M5YH 2W65B 2W92A 1BMGA 2KS0A 4Z7VF 1MNUH 4LSTH 3UBXI 3K81A 4WRLA 3PWVA 1IAOA 1KIQA 4QXUL 1OGAD 1YJDH 3RWGA 2F53E 1OAUH 4JB9H 4XHQA 5GS0L 4B50A 4GAFB 4TF4A 3Q2CA 4XXWA 3SKNB 5FCUL 4BQCA 1YPZA 2CGZA 1BAGA 3Q2VA 5EZIL 1AXTH 2KLSA 2KC0A 1YZZA 4PTUB 5EZJB 4Z7AA 3MSPA 2YD6A 3BO8A 2BNUB 2VDOL 3QRLA 3ZR6A 5KSVA 4XN8A 1MUJA 1PY0A 4JCWA 4R4NC 1A7NH 2Y9RT 3NJXA 4PRAB 1CJYA 2IANB 4HCRH 2FJUB 5L7XH 5B1AB 3TN0A 2X88A 2C4FU 4ZO8A 5DC4B 1JOIA 4HV8A 1EZUA 4P2RE 1TZIA 1AD0A 1TMCB 3BFQG 3DDGA 5FV2A 1EHNA 1S7SB 1U8MA 4I0KA 5D7KE 3FT1A 4W81A 2WN2A 4DAGL 1OD7A 4OF8A 1GSKA 1NWOA 1WZAA 3QZWA 4NWTH 1MJ8H 3LNEA 4NN5B 1I85C 4G6KH 5ADOH 3ARBA 1G6RB 4XWOD 3IGLA 3TA3B 5D2NB 2WIIA 4PVNA 4YE0A 1XR9A 1E42A 4GO6B 3P0YH 1RXLA 4ZMQA 5SWQB 1QPPA 3GXNA 4I9XA 4KVPA 4DP4X 4L4VD 4IRJB 5E2VL 1HILB 4L37A 1EFXD 4Y2DD 4EJ1C 3KLAA 1PCSA 4E9TA 3PGFL 1A1OB 1Q72L 5GZOD 4XPFH 1BXUA 4XP9L 1U2YA 2AXGA 2ZWNA 4G83A 4LKXA 5FYKE 1M7DB 3WJMA 2VZ1A 2W0FA 3QUKB 2BM3A 2FE0A 4L4VB 5CBAB 1URIA 1IM9D 4LLAA 3MRQB 4H25B 1YEKL 2C3WA 2X89D 3IE4A 4X5RA 3QC6X 1S7RB 3EYFB 1ZT1B 1FQ9C 1KCKA 3UGUA 2ZX8A 3KGRA 4AIZA 4RISH 3PWPA 4A2EA 1S9XB 4KX9A 2FWLB 1AIFB 3DDFA 2IPTH 4JFOA 4G6JL 3OJMB 2XJLA 4TULH 3EHBB 2IAMB 1VLXA 3FRUA 4D94A 1E9QA 2YMXL 1ML0A 5C0BB 1FVCA 1TETL 2OMVA 2YA1A 1G7PA 4I5BA 5F7DB 1OV8A 4DGVH 4Y19E 3QFJD 1M6OA 5F9JA 3ZZSA 4AZ8B 3FRUB 4K8RL 2IAMA 4AQ1A 2PYEE 3PL6A 5AYQA 3VB9A 3JWOH 1MI5B 2YSSB 3H9HA 3GZQA 3MRFA 5CLWA 2CJ3A 3AU1A 2YFOA 3LPFA 4OCYL 1MFUA 4TUJA 4V11A 4YX2L 1MWOA 1RULH 2QV2A 5DJ2B 1QSFD 4LLYA 3NSYA 2IMNA 3WELA 5IFJA 1CGUA 3M1CA 1F6AB 2Z4QB 3A3YB 5DHYA 2GEQA 3QDME 1O5PA 4X99B 2A9ML 4O2EB 4NKDB 4UI2A 1TVHA 4AMWA 1D2OA 2DJMA 5D7KD 1UM4H 1I7RB 1R1CA 1LO5A 5CO1A 2I32A 1YG9A 3IMTA 4JCLA 3TH4T 3SDAC 2ICCA 4GUOA 4OCXH 4G8FA 2OJZH 3FQTB 3NQKA 4ZZKA 5B22A 5SX5H 3RAJL 3TO4C 1QQDB 4AQ8C 1J5HA 5H35A 1BG9A 1D5BA 4NQXA 1A4KA 1V54B 2VNCA 2P8PA 2KQMA 5E24E 2XN1A 2WAQA 3HS8A 4RSVA 4X8CA 4PIBA 5LBVA 3DV4A 3Q7JA 2IDCA 4R5XA 4CMHC 3VSVA 1WAEA 4G72B 4OB5L 3FTGB 4QAWA 3V4VA 5JHDD 1P4BH 3RDTB 3S0PA 2XXCB 1QA9A 3QEQE 4IGBA 4BZ1H 1A1MB 1K4CA 1Q72H 2BDNH 4JRWA 4MLIA 5EIIA 5HDWA 1DVFA 4NQCA 4OU3A 4NO3A 3QARA 1FL5A 1SOSA 3QUZD 1KWGA 2KT6A 5FIEA 1MSPA 4U6XB 2GITA 1KCLA 4E5XG 2F8OA 3MRKA 1KGCE 5DMKB 5IV2A 1JWUA 1Z5LA 3RWEB 4I1PA 4DKDC 1PW3A 3HFMH 2FYYA 1QEXA 3L9BA 5KSVB 2JKNA 1U3HA 2KH2B 3G6AA 3NCBB 2XWBB 3D06A 4FG0A 5DHVB 2ENQA 2GKIA 3G6JA 1ZTXH 2F58H 1NFDF 2RA1A 1QBML 4U31A 5DJ0B 3TIDA 1MZYA 5IW3A 1I7ZB 1UOLA 4HW6A 3F04A 3PAVA 1AXIB 3E38A 1KJ3L 4NYLB 4HIHA 4U1HA 3HHMA 4G8EA 2VH5L 4ONGL 1XGPA 5KVDE 4PY8I 3HPJA 2QKSA 1X7QB 1XGUB 1U3NA 4NZUL 4X6FB 4O02B 2BVPA 4IIZA 5T3XL 2F54E 5T3ZD 5AVQB 1G7JB 3GXTA 4J3VA 4ZO6A 4UZUA 4MMYB 4WK2B 4CSZA 5HPMB 5IVNA 5FFGA 1BVNT 1UCBH 3M1BA 1MCOL 5D96C 2XWJA 4AM0A 2A9DA 3O4LA 2R0WH 5B8CC 4A04A 1WWWX 3KDPB 5EIIB 4KRNA 1MG3C 1Q90A 4PLJC 1E8XA 1ADWA 4PB0H 4QDGA 1Q1JH 3WNNA 4C58B 3MLYL 4CDGC 1EZVY 1YMME 4HJUA 4RA0C 4OM0H 4UF7C 3O6ML 1Q1JL 1WA0X 3BUQA 3RVVD 5I8OH 4IIQB 1ZHLA 1BJ1H 1MAKA 3TJEH 4J12A 2DM2A 2QKIB 3PP4L 3II2A 4CADB 1MHPL 1P5UC 4JO1H 4MZ2A 4HKZB 1ND0A 4OB5H 5KSAC 2V2WB 1VB9A 3GJFB 4J6RL 4N8CH 1EAPB 5JYLA 2EVFA 2P5WB 1QLEH 1U4FA 3BUYA 3G5WA 1Q9WB 1NH6A 1O6TA 3WTVA 1J9CT 1OIOA 1SFHA 4EOWL 1WHOA 2EO1A 3BH9A 1PLGL 3FKUS 3C9NB 2WWKO 1TTFA 3TBBA 2RFXA 5BQDA 5IFJB 5BVPL 4YFEA 4CC4C 4LO9A 4LVNB 2LAAA 1UWEH 4E9XA 4FTDA 5GISH 3CDZB 5HXMA 4MB4A 4A6YB 3MBXL 1TOXA 4EZKA 4U1JB 2VL5B 1QNZL 1T89A 4G6KL 1FO0H 2ESVB 2XUWA 3W9EB 5DJYB 1VENA 4TPRL 3VXUD 5DK2A 4R3SB 4BQ9A 2M26A 5BV7H 4Z7UF 1T7XA 5JHBA 3PJNA 3FB6A 3IM1A 4QRFA 1JGDB 4F8OA 3LS4L 1WBZA 1OT2A 3L4YA 5E5MB 4UUJA 2ZSWA 3FBQA 3PWPB 3A6OA 4OCSL 3SO3C 5E08L 3FN3A 2LU5A 5F96L 1S7RA 3EYFA 2VDPH 4HK3N 1HK6A 2VRQA 1SJMA 3OJDA 4BFGA 5I6MA 3T0EA 1GZPA 5EZPA 4ALAL 4ZQTA 1FF5A 2Q86B 1PSKL 3GUFA 4EDXB 2FL5B 2QSVA 4XCYB 5DJAA 3CCHB 3Q8AA 4MQXD 1FH5L 1FFOB 3MROA 1M1SA 1BD2A 5DC0A 3LQAH 5IOPB 2WLHA 3EH5B 2HTLD 4MKMA 2W0PA 1FG9C 4UBDC 3PFUA 1BOGB 5DO8A 1J87A 2FZ3B 2ZOKB 4F37K 4JFYA 4J3OD 3DMMA 1WAAE 1G6RA 3ARBB 1A9EB 2ZCZA 2CCWA 5T1LB 1GS8A 4JQIH 1B4TA 2E56A 3MUJA 3VI4E 1JHLH 1FYTE 2CZNA 4X5WA 4HFWA 2XY2A 1QPXA 1S7SA 1K4DA 1U8MB 2PXYD 3QQ4B 2DICA 3QEQD 5T33H 4PS8A 2HCZX 1DBAL 4FFVD 4POZD 1A6AB 5HGBA 3S96B 1PZDA 3GI8L 4OD1H 3NZSA 1TPXB 5FUZH 4YHOH 2ZX7A 4KZEL 1MJ7L 3O3BB 2MOQA 3HZMB 2P4AB 3LV3A 3TIEB 2W88A 1KFGA 3GSNA 1A66A 2B4CL 5J12C 3X2QB 2XTJB 5FGBA 3HNSH 4Y0GA 5C0CE 3M8OL 3RGHA 2CA3A 4M56A 3TO2A 4GMSL 1A5FH 1YPZB 4ZFGH 3IKCA 2XWRA 4H0GA 1U3JA 3L3GA 4OCLC 4S1QL 3SDDA 5EU6E 1B90A 5KW9L 3ML8A 4OFDA 5DEFB 3ZLQC 4FTVE 1YNKH 2J43A 3CLEL 3CSFA 2C9UA 4YHIB 3S9DB 2WINA 3CXDL 1BX2B 3I50L 4G8AC 4AH2B 2KUTA 5HVFB 4QTFA 4CGUB 1QFUL 3ULVH 5E0FA 5JIDA 5EZOL 5DEFA 2NPLX 4UMGA 4HA1A 1ZT7B 5DEJA 1ZIBA 2WXIA 2WXRA 5E2TL 3DTDA 3TBYB 1HL9A 1M9WA 4NM4H 4AVHA 3OVUB 3L2MA 3S36H 4L3AA 3GBMH 4D0BB 3UYRL 2UXFA 3KW7A 2ESVA 2N01B 3OTTA 2CR0A 4QRSA 4M4RA 4Z7UB 2CXKA 1TCRA 3WHXA 2XA3A 4LQ1A 1DYZA 5GRVK 4B53A 5AVWB 4DEUA 5CIPH 1TDQA 1P0SE 3ERXA 3RU8H 3S98A 1JUFA 1V05A 4LPWA 4HOMA 5I30H 3DYOA 1F0LA 5E99L 2ZP9A 3FONA 3QI9A 1YEHL 2JB5L 4X6EA 5C0RL 4M48L 1IFHH 3QAQA 4OJFL 3ASWA 3QQ4A 3VXRE 2V33A 4WEMB 3WNLA 4F8QA 3MFFA 3NZUA 4PV8A 5BS0E 1F18A 4HFUH 4YMPA 2GJZB 4RFEB 2HRHA 3AU0A 1EAJA 4B96A 4JM4H 4JS7A 1XB3A 1YY8B 3D25B 1MW3A 1KC5H 4Y5XC 5EF2A 1B6UA 2BPBA 4JFFA 4K3DL 1J11A 5FGBC 3MRBB 5HHNA 3UL4A 4B60A 5EBLA 2CA4A 4PBXA 2PYFA 3DHUA 4TOYL 1MFVA 5FK9A 5GS1B 2WUCH 5BXFA 3B5HA 4CC0A 4ELMF 4YL4A 1ZLSL 5C6TL 1OCCB 4WFEE 4TNWF 5E6RB 3WFBL 2Z3FA 2NXZD 5KANI 3CK0L 3QJRB 4IU2B 3GMPB 1R5VA 4H5SA 3P4NB 3X13B 4XCEA 3FL7A 1OP3K 3LRGA 3FULA 4U1GB 5FW8A 3CFEA 3MMEB 3QJUB 3UO8B 4KTDL 1NOAA 1F2XK 3B3IA 2ZD0A 3IPBA 3I6GA 3LNDA 1KN2H 2F54D 3SZ6A 2W9LA 3ZHKA 4F9LC 3O9WD 1UD8A 1AZNA 1IT9H 4GIPD 2KZWA 1NC2A 1AHWB 5F72S 1SOXA 2F5AH 2CDFB 1CDUA 3DUSB 4Q0XH 3UH8A 1CD1B 2VXTL 2O6CA 5JHDB 4AEEA 5ESVB 2RR3A 2V7HB 1XEDA 2EC9T 2R2CA 3IPEA 4JRXD 5JQHC 4AW7A 5BOPA 2Z91B 5K9OB 3AY4C 3LS5L 4G7RB 3SCMA 1IO4C 1FZMB 4FGMA 1I7ZA 3EGDA 1ZTXE 5AW7B 2FYVA 1PAMA 4G6AC 4L3FA 5E6UB 3BKJH 5GGVH 2YIHA 4JRXB 4GRMB 4HUUB 1H5BA 1H9DA 1BVKB 2A99A 1ET7A 2BXZA 3BFOA 4V1DB 4LPXA 1JNLH 1A6ZB 2FEDD 5J9PA 4NUJA 2VR7A 4C47A 3LN5B 4RRPA 3D69B 2QADB 3J7HA 2O93L 4WUKH 4Q9BA 1ACCA 1AP2B 4X9HA 3U1QA 5J1TC 1A6ZA 3QAZC 2VLJB 1BAFL 3JV0A 5KVMC 2HLAB 4IW4C 1UT2A 2BMKA 1JSYA 2JMRA 4AI7A 1NCWL 3H1ZA 3L17A 1XH3A 4TSCH 1F90H 5AW0B 4QLRA 4GFXA 2OYKA 3HZKB 3VXOA 3P9MA 4X6DE 1YNTB 2UZXA 4JFUA 5LCVA 2CLRA 3G6JB 2DQEH 3OBAA 1J1PL 4LIQE 3HR6A 2G30A 2DQUL 4NDMA 4FTVB 5C0FB 4PG9A 3VXUB 1MFEL 4HGMA 5IROD 4J1UA 3TBCA 1NC2B 3MRKB 2OSYA 3BDBA 3C08H 5CZVL 4JFFD 5FYLL 3MV8B 3L3KB 4QGYA 3SKMA 2AVGA 1CTMA 2OMNA 5ICXB 3O41B 1TYJA 5GZOA 2IAMC 4PLJD 5I1EH 2JQMA 3LZQA 2XXMB 3ULVF 5G55A 1YYLL 3DV6B 1IFRA 3D0VA 1AYOA 2WLLA 3FRPB 3SBRA 4S11A 4Q2ZB 1LEIA 1R3HA 1VADB 3KCPB 4MDIB 4A1RA 2IXQA 1JZEA 2WNKA 3AU1B 1IC1A 3RPKA 1P6WA 1U8NA 3QYCA 3HUJF 4O58L 4JRXE 4G71B 3ECWA 4BH8A 1KEGL 1ZDQA 3CQPA 5GGTH 3QUMA 3HC0B 1YYML 2D7QA 2HJLB 3MRIA 5I74B 3MRBA 5HHNB 4IHOB 2IVFC 2LV4A 2AJVH 1QASA 5LO7A 4DP5X 1FVCB 4QOKE 1XF3B 4XBEL 5D5MA 4PR5B 2E76C 4TVUA 2EUXA 1GY2A 1LWJA 1MCCA 1AQKL 2DWEA 3PGDA 3TPUA 1BZDA 1ILUA 3BKCL 4XTRD 4FQXB 4DVRH 2DQEL 5GGSB 5EUOE 3OSVA 3L7FA 3GGWA 3BD4A 1UB5B 1EBAA 4CRPA 2VDOH 2IH3A 4Z7WA 4NOBA 5DSCA 2WXNA 3K71B 1Z0NA 1XB8A 4ZAKD 1BBJB 4LSPL 5TE7L 2IGFH 5J0BA 4LGPB 1NBYA 4KJPC 1KF9B 4LCWE 5IMKB 5I6XC 3UDWC 3OB8A 2GBTA 1B4LA 3LHAA 5B38G 2E7BA 1H8NA 3LS4H 1CFVH 3T6QC 1E4XL 1BCIA 2Y07L 4PP1D 2PF6A 4OLEA 5IHUH 1E30A 4OGAC 4QT5B 4YC2B 2CU9A 1SF3A 3T77B 3FU6A 1FYHB 3EYUL 5F7DA 3IGUA 4G6ML 1M57B 5I15H 3CDYA 3MJGX 2YD1A 4M8RA 5J5EA 1I8LA 3I2CH 5DUBB 4B5ZA 4E9RA 3WKQA 3TCLA 2ICEC 4M1GL 3VXQB 1MJJA 3JWNC 1W8NA 2W07A 2WYTA 3GSUB 5IB4B 3FQ2A 3N2JA 3LXAA 1OE1A 3ROOA 1F6AA 4D7PA 2YLKA 4ZXBD 4PMEA 1FIGL 1SUHA 2P7TB 5DVMA 2F68X 1NCNA 2DN7A 2GHZA 4OD2B 2WVUA 1SDDB 1G7LA 1QI5A 1XL6A 1ZLWK 3QEGH 2Z35B 1ED3B 2VERA 2EXSA 2IADA 2DQJL 3R4DA 2JVUA 3P3YA 2TRHA 4Z7QF 3VFWA 3KWWB 1FCCA 1RU9L 3DETC 5LAXA 1ROCA 4AZ8A 3FRPG 4P2QE 2K6ZA 2PYFB 2BHUA 2ZXEB 5SWQA 3DOSB 5IJVA 5GRUL 4O2CA 4Z23A 3T2LA 3C60B 4P59H 4PRHD 3VQLA 2EIBA 2YRBA 4AEHL 4BIKA 3RFZA 5B3JE 3ALPA 4P9ML 1KBKA 3VXOB 5F0LB 4K5PA 3TN0D 2CJUH 1IIKA 2C9QA 1HNFA 2ID5A 4JJ5A 5HGAA 4FA6A 1U91A 1OOAA 1XDTT 2BMKB 1BBJA 3EYUH 1II4E 1JWSA 2VSMB 4PRIB 4HUWA 1WEJH 2YK1H 4FLHA 1DEEA 2BNRD 2F0CA 2O4EA 4O4YH 1PKOA 2XRAL 5ANHA 4Y4FD 3C5SB 3LQZA 5I66A 3BZEB 3HOGA 4LLVA 4RQQA 3ULVE 1JPTH 2FVNA 3V6OE 2WQRA 3WN5B 1G7IA 4LGSB 2VMEA 1X5AA 1L9TA 1U4EA 4FNQA 3AUWB 5IHZA 5T5NF 1VGKB 2OR9L 2BOCA 1JPEA 5IG7A 4LAQL 2CBOA 4EDXA 1B4JL 4L8DB 4YBQC 3VSTA 5DJDB 3RYMA 2JH2A 1DFXA 4F8PA 1ZE3H 2BVQB 1AC0A 4XMLH 5A7BA 1MJ7H 4YQXL 3HC3L 3C6EA 1QBMH 2LU4A 2BSRB 3UC0L 4HHWA 2V7HA 3S5LG 4Q2ZA 5TE6H 1BFTA 3KHOA 4HP5A 3FRPA 1R19A 4X6DF 4UTBA 2R39A 5CBEA 1K5NB 2R9HD 2FHFA 3N1MC 4YDKL 5E6ZA 4OKDA 1KJVB 1WBZB 1B0RA 4ZPVA 3QS3A 2Q8AH 3FF7A 1MCEA 4XWOC 3T2OA 1PFCA 2FAUA 2FGWH 1V7ML 5EU6B 2ZF9A 3V7AG 4LRIC 4EQ3A 3NAAL 3GBLA 4FXKB 4XOCA 1VGEH 4LQFH 3GZOA 4FL4B 1MIEH 3FQXB 5AL8A 5EEVA 2PWHA 4R83A 5FA3B 1WTLA 4NN7B 3HCVA 3W38A 1KZQA 3OC8A 4HJ0D 3OHXC 3FH5A 4GUPA 1OP5K 3RVWD 2VAAB 2WTRA 4GJTB 2QFRA 2ERJB 3MA7A 4LASL 3LPOA 3GJEB 5D70H 1DQTA 2W60A 1HIML 5FDYA 5C08A 5CJ5A 2X1WL 2R29H 1O9VA 1PZSA 4JHBA 2XWZA 4M00A 4XNBA 1B3JA 4X6BB 1FVEA 4N8VB 1PAZA 2MMXA 3QIWA 3Q43A 3PL6C 5CLXA 3MJ9A 4MJ4A 2JK5A 4U0RC 3SDXA 4OCRH 4UMSA 4RBPK 2QZQA 2UWEB 3AVEA 2Y24A 2ZOKA 5F3BB 4XO9A 3S7GA 2AK1H 4HIJA 3SOTA 4KRMB 5AW6B 4TLSA 4A55A 4Y7OC 1KB5H 1DQVA 2JJTA 3WEXA 4PV9B 3V0EA 3DX1A 3RGVB 2O61A 1H3XA 5A7EA 3H54A 1G94A 1X7SA 1KUMA 2KBGA 3QI9B 4HUKB 4Q9QH 1MDAA 2CHZA 3M7OA 4XP6H 4H0LC 4NC0B 1K3ZA 5DUJA 1BOYA 3T0EB 4JL2A 4F7TB 3O6KL 1JFQL 3FU3A 5L2KA 5FDWB 1SJHB 5G5DA 5F9OL 4S10A 2FBRA 4LVOC 3VW3L 4LCUA 4OTXH 4R96A 5D1QE 3H9SD 3ZTEA 1JVOA 4ELME 2ILLA 1Q4NX 5I1KH 1B0IA 3GRBA 4JEGB 1TU2B 3NESA 1ZT7A 5JW5B 4FQJH 4UTBL 4PGZA 3CIQA 4UTCA 3GNMH 4GLRH 3MNZA 5JIIA 3FUNA 4PJCE 4IGBC 5LCVH 1A9BB 2YMTA 4NNXA 3F62A 4GP8B 5HDBB 2FX9H 1BX2A 1OP9A 4RIRA 3NSXA 4HIEB 3L9RA 1T1XB 3C5JA 4KKAD 4WY7L 1KBBA 3O6FD 4H40A 1WIPA 4MAYA 5D6DA 1DE4B 1DQJA 2V7NB 1WO2A 4NKIH 1IGJA 3QIUD 4QTIH 3KGSA 4TUOA 3L1FA 4G8GE 2F9BT 3QUYD 3A24A 3P1VA 4QF1A 4WK0B 1IQWH 3Q6FA 1T2QH 2OZ4L 5C0EA 2GT9B 4MJ2A 3RDTD 3D2UB 1T1ZB 4OM0L 2V4LA 4Q6KA 4TLUA 2O5ZH 3U46A 3QUYB 4O5LH 3ZKMD 3GXMA 3MLUL 4RDBA 4UT9A 5E8NB 1NGZB 1CFTA 3C5SA 4X9IA 3QDGA 3AW5A 4XMPH 1RIHL 5ES4B 4NO3B 1WF5A 1SY6H 4F9PC 3BUYB 3Q6GH 1QNZH 1J10A 3QUMH 4N2AA 5J6HB 1WWCA 3L08A 4EDWH 1CL7L 4NO2B 2CBPA 4HWEL 4MA7L 2VDKL 3BRFA 1BLIA 1FZJA 2EVHA 1N0LA 1ZA3A 4I9WE 4ZT1A 3DMMB 4Y19D 4K9EH 2GJJA 3RA7L 3ZL2A 3EF4A 2XQ0A 4Y4HC 4X5XA 1F42A 1I82A 4XMKL 2UZPA 2Y06L 4GMTH 5DK0A 3EYVB 4LOFA 1D5BB 4NQXB 2UYLA 5LAXB 4FCHA 4KWUA 4XXCA 4G1EA 5I0XA 2HT4D 2R2EA 2AQ3A 2Y3NA 4AM0B 3ES6A 5E5RB 2WN3A 2E4FA 1WIUA 1LDPH 4HIIA 4XNQB 3WNPA 1UEYA 3BDXA 3E1ZA 1E7VA 3QWOA 1D6EA 3OG6B 4NJ9H 3CPLA 2DMHA 1WTGT 5I1HL 4KVCL 2VCOA 5EO9A 5EUOF 1GYVA 3M45A 4A7QA 4AH2A 3AGWA 5K5YA 4ZK8A 3DPBB 3MLUH 4PJXB 4OIAA 1YCSA 4YE4L 4UQ3B 1X5JA 2L7EA 1S3KH 2X44D 5PCYA 4NI3A 2YQBA 4HH8A 2F7IA 5FR3A 3F58L 3MGTA 1L7IL 1SHMA 3M86A 1RUQH 2BDNL 4HPYH 3VRLE 4Q9RH 2AJYH 4CGTA 1EO8L 4J3TA 4Z76B 4K7FA 3RL1B 3AAZA 3G04A 4XWGH 5KBMA 2Y0SA 2VQ4A 2FJHA 2HFFB 2J1KA 4P05A 4BXVA 2VZSA 5JIKA 4A6YA 4KROC 4U3SA 3HUJE 3G9AB 4HLEA 5FWRA 5IV2B 4JRYD 4HMCA 4AEFA 4D0CB 4MXVE 2DJSA 3VI4B 3OB0H 4NGHL 3RTQD 3FU7A 2Y06H 4GLRI 4RZCA 1E3FA 2P9RA 4GW5B 5F9DC 5IB3A 5DFVD 2RJMA 2IO5A 3RL2B 2DJ4A 3S34L 1UM4L 2WLZA 1F3RB 2L3BA 3HEIB 1XMEB 3EGSA 4I3RH 5EULV 2MFNA 2XZQL 1DR9A 3GEWB 5CSZA 3UJJH 4YEFA 4TLKA 1OCRB 3F2LA 3KH4A 3CK0H 1EEQA 3ILDA 5I71C 1KPVA 3QJFA 3L3JA 3EH2A 4LSVH 4ZXBA 5T8IA 2EE3A 3DETD 3DO4A 4O00A 4JFYB 5CCKH 4HG4K 3B6SB 2L7JA 5LNEA 3BUBA 1EXHA 3QCTL 2PPEA 3NA4A 2X3BA 1T7ZA 2P8PB 4ZUWB 4BWWA 4I48B 1G6RL 4IOSD 3VO0A 1Q94A 3BPCB 1ET8A 4KY1H 4PJFF 1G9HA 3GWJA 1E5UI 2EDHA 5DVNA 1SDDA 4LPUA 1TETH 3B9DA 5IT2L 5CLZA 3MV7E 3ORJA 3N40P 1FA4A 2UY6B 2EH8L 1ZEAL 4KXZH 1BIHA 2ICWJ 5J11B 2ZKMX 2B59A 1QFWI 4HXAL 5EHFA 5DLMH 1CK0L 1LE9B 5ANMA 3K6IA 1TLMA 4R2GC 4B7IA 5LN8A 4OFQA 2PPAA 3QUHA 5HGDB 5KYWB 3GHBL 1M4KA 1Z9MA 4XNMB 5CJBA 5F71A 5K93A 3X14A 3VWJD 4YDLC 2FJHB 2HFFA 4LL4A 2TAAA 2NRDA 3FOLB 3K5RA 3MAWA 1GZHC 1KCRL 3MLXH 3DSNA 4IHOA 3IFNL 2H26B 3C8KB 1JXFA 2DDQH 1GGTA 1PG7L 1VACB 2EYTB 4XE5B 5CJQH 2IBZY 2YGPA 3N43F 4K23L 3U9PH 1CR9H 3UPAA 4FFYL 4MQ7A 1LGVA 3SQRA 2OK0H 2AEPL 1JGVH 3IGAA 5FC9A 2QDVA 2R69H 1UKQA 2ICWA 3C8DA 1TUPA 1E3ZA 1AHMA 2Y5TA 4OLYH 2DWSA 3D0VB 5CJ8A 4LVEA 4F33A 3IGFA 3LZPA 5DS1A 5HYIA 2FLMA 1ZVSA 3L1OH 3SGEI 3VG9C 4P2AA 1JZGA 1YEFL 1VCAA 3WLBA 3H6JA 2YRZA 3WE1A 2X4TA 3F5WA 3KS0H 3SDDC 1PMYA 4JW3A 2HX9A 4XNZB 4PJHE 2XZQH 3MBEB 3UJJL 4N1HB 1AXSB 2WXPA 4BINA 4HBCL 4Z0XB 3P73B 3FSWA 1U6AH 5EOQH 3TO4A 2WB1A 3VA6A 1JZ8A 4IGBB 5DC9B 4HHAB 3NIDE 4B97A 4OIIL 4GP4B 4FFZL 4KKCD 1H3VA 3MBED 3GSQA 1F4XL 3GS7A 3Q6GL 3MI6A 1JZDC 2QQKL 4NRXA 2EDBA 3BLKA 3JT0A 4NRYB 5LG6A 1D2PA 3MUZ1 1SHXA 1KZYA 2FIKA 5IB2A 2MCPH 3IMWA 3QUGA 3VSUA 1P5VB 3CXHK 4EUPG 3U0PB 1BF5A 1Q0EA 4P48A 4QWWD 3DSFL 3KLHC 1AD0B 3QZOA 1EUTA 3IJ8A 1O7VA 5T3XD 1FYTA 4AM0Q 5MEND 2M8XA 4I1RA 3MV8A 5A2JH 3O3EA 4ZYKB 3DJTA 5DWPA 2W9EH 1CGTA 1XCQA 3TA3C 5E9DB 5C0FA 1XF2B 2AAAA 2V9QA 2FO8A 4M7LL 4O02L 3SE6A 2A1WL 1VFAA 2GSGB 2XSKA 4Q58C 1GGCL 4UINL 5HD8D 4BUQA 4J3OF 2W81C 1FZMA 4JO2H 1NKRA 1CLVA 1JF5A 1JMZA 1NEZA 3AREB 1RIUL 3NJNA 4LMQE 2LVCA 3MACH 4OJEH 3ZE1F 5EC1B 3VDCA 2OW7A 3U4BL 3T0XA 3VXMD 4XOEA 4AZUA 4N8UA 1CS6A 1OWWA 4WTZG 4U1NB 3CHQA 4LIQL 4N2IA 4P5TB 4KJWD 1D5XB 4PJHB 3CSYA 4OLYL 4FHKA 1HWHB 2GJZA 1F97A 2ITCA 3IJSB 4RFEA 4IBTA 4N0UE 3D69A 4B5EA 6PAZA 5ALBH 3UC2A 3UEZA 2H0EA 4LMQI 5DQ9A 4AYSA 4AE0A 1DLHB 1YJDC 5L2KB 1X44A 4WHTA 3WNJA 1F1GA 1AZBA 4ALAC 3W39B 3EYQC 1R5VB 4Y1SA 2C3XA 1EQWA 1NPUA 4I18A 3TJPA 2R4SH 3HG1E 2WBJD 1XF5B 4MBOA 3MLPA 4BZ1A 5D2LF 3BIBX 1U8LA 1A6TB 4Z7IA 2Q87A 3S34H 3HNTH 2YEQA 4AVIA 1UWGH 4QKTA 2EKJA 2EYSB 2LOEA 35C8L 3MDJA 1JPGA 2AMUA 4NQDD 4FTVD 2KPNA 3SCMC 3GTNA 2BFGA 3EOAA 4LP5A 1CD1A 5JR1H 2AI0H 3TA3A 3RWIB 2WZPD 4QXVA 1JV5B 5DT1L 1NANI 1JPTL 1S5IL 1UXSA 1XV8A 2V2TA 1LP9B 4YZFE 1TVHB 4OTXL 4FNRA 3FB7A 3T4AB 4RWHA 2GIMA 1CBJA 2P44B 4MMZC 4FQLL 2XV0A 1KB5B 2VW7A 4ZSOE 5I1DB 1RPUA 4HZ1A 5IFHL 5GSVA 3W2DH 3PUUA 3HKZA 1IC7L 4XOBA 3VI4A 1ONQB 1T66D 3AFLA 5HY9A 3VFMA 1JZFA 3A6BH 1BWWA 1SY6L 4GUPB 5BXFB 1AZVA 2FX7L 4N22A 3HZYB 4WKXA 3NPZB 2Q76B 1PPIA 3FH7A 4FHBD 5ADOL 3DVFA 1GJWA 2RQ8A 2XTJC 1WZ1L 3C09C 2DLFH 4N2CA 4PJBF 3PNRB 3RWGB 4URTB 3W2DL 1AVAA 4YHZL 1HOEA 3NIFE 2W80C 3OKOB 3VXNA 1U8HB 1KCSH 4X0NA 2H5UA 5TFSL 4ANXA 3ZL1A 4QRRA 5E51A 2WNXA 3R1GH 4WWKD 1HQRB 2VLRB 3HG1B 3CFCL 1JZ7A 2ZWZA 1RJYA 4MD0B 3AG4B 4L29B 2EH8H 2YWYA 4OZGA 1A5FL 1P4IL 2BNQB 4XNQA 3VE0B 4AYMC 3KVPA 3H0TB 4X0KA 3S8WA 2J4WL 5DCCA 4BQ8A 4HWEH 3ZJAA 1MPAL 3ZDZE 5ESQB 1RZJL 3QQ3A 4UILH 1X5LA 2R4SL 1J05A 4LP8A 4K9EL 5CINL 2HG5A 5IQOA 1FGNL 5KSAB 1KMGA 4Y4KD 2R23B 2OXGA 4DPRA 3GI8H 1A6VL 2J44A 1NGXB 3WS3B 2G4EA 1E28A 1BJ1J 3S96A 4RMRA 4P2OA 3MCYA 4MNQE 2NUTB 4YC2C 5DTFB 4J3WA 4JKPH 2L7UA 3LB6D 3WSQH 3ILQD 4YLCA 3QG7H 4LSVL 2HTKD 1JL8A 3QZWB 2VABB 3CFBB 2ATPA 3B7SA 3WDHA 2D2OA 3WLWD 4EVNB 4I3SH 4XPHH 1Z5YD 3FTWA 3JV6A 1FAIL 3FC8A 3FB6B 4ZFOA 5A2LH 1IIIA 2QFPA 1FO0A 3GO1L 2JWYA 1GHFH 5IFHH 3DX8A 3QZWG 4Y1AB 2WWMC 4FKEA 1YEHH 2JB5H 5J8OA 2VL5A 2GBVA 5AFAA 4WVRA 4BZ2L 4GP5B 4PS4H 5A6IA 2XPZA 2W59A 1J0IA 4F2FA 5KG9A 4E5XA 5EFIB 2VDOB 1KLGA 2ITDA 2QPEB 4Y4KC 5D6DC 4XWGL 3V5HB 4GQRA 1EBPA 3CSTA 2GB2A 4OGQC 1OM3H 4N2NA 3L4CA 1RZKH 1P1ZB 1RURL 1Z5HA 4MAYB 4PJGB 5B39G 1P1VA 2JCWA 1AQHA 5F7AA 3BKYL 1WFOA 4BV1A 3EFOB 2BNRB 1PX8A 3BSHA 3EUUA 4FI6A 4XP6L 4BELD 1MN4A 5T5FL 4BH7A 4ZDHB 3VGBA 4EZMA 1YECH 5CKGA 3S5ZA 4GIOA 4R2GB 4WWKC 1HI6B 1MF2L 2WKLA 1SHWA 1O7DC 4OFVA 3T65A 1ND0B 2YK1L 1IAII 3KGUA 2DPKA 4EO5A 1CD8A 4W9GC 1S9WA 1MJUH 2A9AA 2PW2A 4IRSD 1GW6A 3VCLA 3NEXA 2IPUG 2YKLH 2GAZA 1OGSA 4U1JA 1E3XA 5K69A 2BIQA 2L4OA 4ADIA 4PJEF 1KBWA 3MRCB 3VWJA 4Z3FA 1OGAA 4GRLD 1H8OA 1UD2A 4JO8A 1AGBB 4LSUH 1QZ1A 1OTTD 3JVGC 4LLMB 4IMLB 3WY4A 1KBPA 1T20A 2CO7B 2PP7A 3LAFA 5C3LD 2E5EA 2XVBA 1NUFA 4AQZA 5LGKA 1NM4A 2VDNH 3BH9B 3QP3A 3WY1A 3N41B 3QRGL 4WU5B 5FHBH 2B2XH 4PMFA 4NCDA 5F9OH 4APQB 3JUYA 1MCWW 2IPUK 3CSYB 4NQEA 1OK0A 3W0WE 5JUEH 2OL3B 3W0WA 3BT2L 4K15A 5C9JB 1SOQA 4L4TE 1M6UA 1TFPA 3DK0A 4X6FA 2FR4B 3WFHB 3PWPE 1XF3A 3Q9PA 5GGTA 2G0KA 4P5RA 3B8YA 3QNYB 1IBFA 4JN2B 2J20A 1KPUB 3GBNH 4JE4B 2A9CA 3JWDC 2YPVH 3L2LA 5E8OA 4X6BA 5H8DA 4P99A 4RMQA 2X4SA 3TZVA 5JW4M 4Q6IC 4IBYA 5D8JH 3A6CH 4HCRA 5EUOB 1ANUA 1RUPH 4XN4A 4U6HB 1GXEA 3NZHH 4A67A 3OG4B 3DVGB 3DO7A 4CW1A 2AQPA 3L3OC 1FLTX 1WUNT 1YEIL 3DX2A 3WEBA 3MGAA 5CZVH 3X3FL 3FYIB 4L3EB 1NPNA 3IRPX 3OJVC 1ZXQA 4GG6B 4HMDA 1SYVA 1T21A 3FB8B 3UCRA 4PWHA 3LOWA 1UTDA 4WY7H 2H6UA 3EYSH 3L3KA 4YSCA 3ATDA 4G43A 1FYTB 4YDLB 4MMYA 4KQ3L 4YSUA 5JHLL 1J9SA 3C5ZD 2CLZA 4ABVA 1MCSA 4OZFB 3KJ4B 1UJ3A 2BINA 5CHNB 1QFOA 1TZGL 1ZVHA 3GBDA 4NC2B 5TQ0H 1B2YA 3BESR 2I07B 5DRZB 1BEYH 1VF5C 2H32H 1ZDSA 3L45A 4P2RA 5KBDA 4GSDL 2A6KB 5DMJB 1CC3A 4QRPB 1RKRA 2YD0A 1UZGA 5D4QA 2OI9B 4XBEH 5D1QC 2A3TA 3L5IA 3EH1A 3FN0L 4HHAA 1C5BH 2YBGA 2AKRA 1R6VA 3GSRA 3OHXA 1QQDA 2WY3B 2I69A 2HLAA 2DQHL 3FXIC 1GIGL 4JHVA 3LNFA 3H42L 4XNZC 3FTSA 4WUUE 3GRGA 4WGKA 2ZWLT 3PNWB 4PTTB 2X38A 1JZIA 3HPLA 4L1TA 3UTSA 4W6XB 4JQVC 5EA0L 4DGIH 5J13B 2YXWA 4KKQA 3ARED 1TXKA 5TGBB 1Q9LA 4P2QA 2CK0H 3ZYIA 4F58L 2AANA 3F7VA 3MRLB 2Y5EA 1HHGB 3F00A 3ZKND 4NNPL 1BM3L 3LIZH 1RZFH 4HULB 3B2DC 1MFDH 3TEZA 5DD5L 1KYFA 4AQ1B 2O5YL 4L1HA 2Y7MA 3T9WA 3TIDB 2OCJA 2MHAA 2YEZB 2G2NA 1OANA 3FOLA 2AJYL 4MMXC 4I77H 5DHVA 2XWBA 2DS4A 2QV4A 4YDMA 1E6OL 2GPZA 1TQBC 3L81A 3SYCA 3FTUA 2BNRE 3POHA 2G9HB 1GZHA 4KJYB 4TNFA 4IBVA 3EZ8A 4OZGE 4U6XA 2DWTA 2IOIA 4M29A 4FADA 2DQ6A 2P26A 3IJ7A 1SHSA 4XAKD 3TN0C 4QXGH 1S7VA 3QVAA 2VIRB 3ZK0A 4PJDA 4PUBL 1MCRA 5FM5O 5FS5A 1HZKA 2N0MA 2DIJA 3G5ZB 5HDQH 4MXWL 5C07A 5AALA 2ZP8A 4MSWA 3SY0B 5MI0C 2ITFA 3PAYA 4GO9A 3QUXB 3WSQL 3FFDA 4QRQA 1I85A 3JWOL 1XF4B 1OP4A 1GY1A 2OK0L 3IFOB 3SDAD 4UYPA 4OCNC 4OQTA 5HYFA 3T0BA 2EINB 1LWHA 4HK0B 1X5XA 4LFHG 1BF2A 1IGMH 5D6CB 1UEMA 4OH2A 4PWGA 2E7HA 2F5AL 2VZ3A 3QQNA 4YHNA 1MFCL 1UT1A 4DWHA 1OSZA 2N4IA 1G0DA 2VMJA 4X8JA 5CLYA 3BPLB 3RNQA 3VU1A 5DURB 5GS3A 1UWGL 5AAWC 4DF9A 3FT0A 2CIIB 3MHZA 5JORB 1QR1B 4AC2A 4WWID 2ALAA 4FDWA 1ZS8B 3SY6A 4XZUB 3ZE1E 4KTEH 4Q7DA 4HAGA 3BH8B 1I9RL 3NGBC 3V55A 4JG0H 1Q9OB 1KBGL 2ZOLA 4QKXB 1LEGA 5IW6A 4KKBD 3RI5F 3QEHA 1YEJH 2PCPB 1QTSA 4R4FH 2WXJA 3N3EA 4G1MA 2ZUXA 4WDIB 5T5FH 3SDYH 1S3KL 3BYTA 4H7VA 4KXBA 4QRSB 5C0GB 4KK8D 1FG2A 1G4RA 5DYOA 3UIYA 4M7ZB 3BZFB 4MD4A 1PL3A 1TFHA 1DBJH 3HHSA 2XIBA 4QOKB 2DRUA 4MNGA 5DI8B 1FN4B 3HIZA 3ZIYA 1IAOB 1U8NB 2ORBH 1GJUA 4QHLA 4YDKH 1EJ6A 2X4UA 1XFPA 4R9HA 2F19H 4XXCC 4Y9BA 4KMTL 4AYEC 3ZMEA 1ZT1A 4OCMC 2A73B 3TCXA 1MFCH 1ZAGA 2P8LA 4M1CC 3L95A 1DJSA 3GSOA 5HBBA 3KYOB 5HHPB 3OKDA 1QSEA 3HE7D 2R2EB 4OZHE 2NZIA 2WZPA 1KG0B 2WO3B 5H4YA 3OZKA 4W6WB 3CJJA 3GSNB 3KLAB 4JFDA 3TLRA 3U79A 1RVFL 3NIDF 3PCYA 2VLKA 3SHSA 3UTZA 2JI1A 1IEAB 5GGQH 1QSFA 5DK0B 4HXBL 3T04D 4Y2OB 2CLRB 5F2FA 1HYSC 3FQ1A 3GIVA 1MHCB 1M1XA 2YAPA 3ZDYE 5EU7E 5FB8B 2HVJA 1LL1A 3F65A 3MUHL 3T3PF 2IAMD 4YGAB 4QLWA 3ARXA 2VDRL 2Y4SA 1FZJB 1Z9LA 3MXWH 4L8CA 4N1EA 1BZ8A 1OCZB 2D7TL 3V0WL 5HYJA 3GPSA 3FT4B 3O11B 1WS8A 2CJUL 1NCDL 2Z7ZA 2P24B 5KOMC 1F4AA 2WQAA 3GJFH 1AP2A 1J1XH 2GI7A 2KHAA 2FNWA 4IJ3C 3SKJL 2MKWA 4LLDB 3EO9H 3QUYA 3WMSA 4E41D 1MUJB 4EZLA 4EXKA 4J3BA 1KIPA 3IT8D 3PPEA 1AQKH 2OSLA 3SBWC 3NCWA 4X6DA 4XAWL 3FTVA 4WFGE 4A7GF 4Y5XA 4EN3A 1CU4L 1PY4A 1U8OB 1LO0L 2XWCA 5CUSL 1H0DA 3TWCH 2XZCL 3CVHA 2ERJC 3ULUE 4DESA 1WAAA 5C97A 4J28A 2G75A 1QX1A 4O58H 1J1XL 1N5AB 4GSXA 1VKXB 3S4SA 4P4KC 3FUKA 1BWMA 1ZT4A 3A21A 2EIZA 2ENPA 4U49A 3PHAA 2R7EA 15C8L 4F3FB 4BSWA 2PCYA 5KSBF 1OB0A 4UIMB 1YC7A 3FQNB 4BFNA 3ARBD 1PYWA 4JM2C 4XODA 4AYBA 4D3CL 3WJJC 5HVHB 2WZ0A 4LRIA 1OTSC 2W38A 4K7PH 5F1NB 1TEYA 1B88A 2FEEI 4G6AD 3I6SA 4ZMAT 5EUKB 3ILQC 1ID5I 2PXYB 1WBYB 3H2QA 3MMEA 5INDA 1J1OH 4F9LA 3ZDYB 1WWAX 4MNHB 3EADA 2IH9A 4MJ6B 1EEZB 3FB5A 4X9GA 3TNMB 2F8IA 1XT5A 1BGXL 4RX4A 1OTTC 4PGEB 2WCSA 4JHUA 2YXMA 1AI1L 4WUUA 4CMHB 4YXLL 1HXKA 4JFXB 4H2CA 4P23A 2OMBA 1CT8A 3IXAB 2X9YA 4PQXA 5AB0A 2BY2A 3BZDA 4KXZI 4MA3B 4HKXB 3DGCR 1R5IA 3VRIB 1M3JA 5CIPA 3H56A 1S2EA 1BQHG 4TSCL 5T5FA 4ZMPA 4ACTA 3ROLA 1A6UH 1OAUL 3PP4H 4GW4B 5F3BA 2E47A 3ARPA 1JYWA 1A2YA 2Y2WA 4MXVF 2WXMA 1BQRA 1XD1A 2O30A 2JSFA 3BJ91 2MPVA 3R0NA 2NXZC 4TPRH 1P7QA 4ZFZB 1QG3A 1Z9PA 4LRNL 3P9WB 3ARTA 4NM8H 5FYLE 4BZYA 5DD3L 4B9GA 4PRDB 3MYJB 3O2WL 5DMGD 1PGRB 3VFUB 4ANUA 3IVKB 3K6DA 2CHDA 4PUBH 3NIFF 4F7MA 1WT5C 2OMYB 3UTSE 3RIFF 5TH2B 4BYHA 4JFQA 4WFHD 1TVBB 1DP0A 3VFTB 1J0JA 1JTOA 4KI5C 3HCVB 5BS0D 3CH1A 1P69B 4BGDA 1OT1A 4ABWA 1T66C 5KYXB 4H8QA 1KYAA 4P4KD 5BS0A 5BZDB 1AY1L 5F44A 1UASA 2BVOA 3LIZL 1CO1A 5BZWB 4QRBA 3RB7A 4KZEH 5EBWB 3T71A 2B15A 3MUY1 3E2HB 3K74B 5FECA 3HBQA 2A6DB 4MAYC 5F7UA 4JFEA 3FFCE 4ZX3A 3TT3H 5LBSH 3K2UH 2V5MA 3CU7A 2F18A 4PYGA 1YEKH 4ZPTA 4OIBA 5KVEL 2CO2A 3CFDB 3R1GL 3MNWA 4K3HA 4E9YA 1ACYL 3SCMD 1OQOA 4L8DA 4NHUB 2HT2D 4S1SL 1NQBA 3UABA 3ATEA 1NC4D 3FCTB 5H37H 3MV7D 3PHOA 3O2DA 1RK0A 3EGXA 2FJFB 4GXVL 1CFVL 2A6JA 3CG8A 2IG2H 1CLCA 1USQA 1E9PB 3IMSA 4ABQA 4BK4A 5IK3B 3EYOB 3OKLB 4RDQG 3LQAL 5FUCC 4ZW7A 3TT3L 1OAKH 3O9WA 2QVKA 5EEYA 4NQUA 2JKJA 5SWSA 4JPWL 3RWFA 4FQPA 2AV1A 3G6DL 3KBFA 3LKSB 4M61A 5JIHA 2OL3L 2QGEA 2OP4H 4TS6A 4H4NA 4OV6F 3HRZA 5D7SL 1JDAA 3LMJH 4OV5B 5AW2B 1KGIA 5JOEA 3BDYL 3PXJA 1ZA6B 5EWIH 4ZX5A 4WEBH 1QSED 3HE7A 3LMJL 4L9DA 4Y4HA 2P3YA 2XNAA 3ZMNA 3VD3A 1QW9A 5MEOA 2PLTA 4JN1L 1NCAL 3WD5L 3WFCH 2IWFA 1FFOA 1DJIA 3FAWA 2G2RA 1JK8B 3KWVA 3MROB 4TVPH 1U2CA 2KYIA 4NNPH 5AUMB 2PMZA 5I18L 3QIUB 2OMXB 3OAZK 5KVFE 2LR4A 4YBQD 3BVDB 5J13C 1KY6A 4N0CC 4XR8C 5EIVA 3SDCB 1SUJA 4B9JA 3L54A 1NANH 1VRSA 2WLIA 1D5ZA 3KLQA 4PJ8B 1MWAH 4KKLC 5EO0B 3HJEA 3WN6A 3BUPA 4QHKI 4D0DA 1BLNA 2G3MA 2VSCA 4JANB 4PRPB 1DVUA 4LEXH 1TKWA 3WDIA 4OKVA 5IWLA 3P77B 4GS7B 4JDVA 5KWYC 1ZK5A 2WVVA 2ZNWA 1LO4H 3NCJL 4G3YL 4W9ZA 5DUBA 3KLHD 5JPMA 4S2SB 2DWYA 3KNBA 2ZPKL 4ODSL 5T1LD 3SOBH 4JZJC 4EI5B 5CAYB 1G0XA 1AGDB 4PRPD 3QHFH 2OA9A 2H7WA 4MMZA 2WLYA 1RZ8A 2B2XL 2ED6A 2AJUL 4EOWH 1WAAF 2APTA 4KQ0A 3GMOA 4UTBH 5CJOL 4GB9A 1UJ3C 4RMVA 1EJOL 4G42A 5I0VA 4XO5A 1OGAE 1W91A 3CDZA 3BI9X 3OPZL 2ZF8A 5GS1C 3QFDA 4XP5L 5E7BA 2I27N 5DZJA 1TQVA 1V3MA 4F7PA 5TTRA 2QTVA 3NJMA 4IBQA 4DQOL 5PAZA 2MWCA 1CF1A 3WKML 1YMMB 3JYBA 3HE7C 2VB5A 1EK3A 1RUAH 1IUZA 3QAZB 4LSSH 1QMUA 1DQML 1CLYL 1M7DA 1U3YA 2Q9OA 4CILA 4BKLA 4WHCA 4FFYH 4FN0A 4KBPA 4OZFG 2EDMA 1DVYA 1HILA 3AQZA 4L37B 3CQQA 3BKJL 4X2UA 4HIPA 4FNPA 4O51B 3MRIB 1I8IB 1ZJAA 2GI0A 3O3AB 4ZRGA 1DN0A 3ZZQA 4KHTH 4HKBA 4ONFH 2F1AA 4P9HC 3TEXA 4WHYG 1C16B 1M9SA 3DX7B 5ETUA 3ZE0F 3VXRD 2NT0A 1E27B 1XCWA 2PTVA 3DI3B 2GYSA 2QQNL 4PJIF 4Z7UE 4CU7A 2LFGA 5HP5A 3B9KB 1RZGA 2J5LB 1UGNA 4YHML 3BT0A 1SF5A 2HKHL 4O2FA 1MVYA 5CJOH 5MERB 1H3TA 5C0BD 5FF6B 1OAQH 4QHMA 4P3DB 4OIIH 1LJMA 2DQDH 3CX5K 1SY6A 3W5MA 1NTDA 1R34A 4ZSOA 4AGNA 1BZ7B 1EHLL 3WXVL 3TFKC 1BJMA 1QLRB 1ETB1 1ULVA 4PI0A 3HG5A 4KV5F 1NFIA 5HHXH 5L2KD 3CVBA 4P46D 5C0DA 5ILTH 3NTCH 2J2ZA 3HLAA 1F13A 2C1PB 2FSEA 4ABUA 3NCCB 3H8NA 2A2QT 4HC1L 3L5WA 2X6MA 1HVXA 2A9BA 5E1GA 3Q5YA 5AYUL 3BQVA 5KS9E 2JNZA 3CZEA 3GSOB 3UOAB 3WAKA 5JO5A 2FB4L 1H5BC 4H0HB 4PJ9D 1MKFA 3QQ9D 3Q13A 2VLJA 4UOZA 3DYPA 4GKZA 3QDMA 3QNZA 3QQ9C 4UDUA 5I6OA 1YQ2A 1EV2E 1SRDA 1UCTA 5E1IA 3LD8C 1V3JA 3ZKXC 1AGCB 4A2DA 3DVNA 4NQTA 5DQJA 3NDZE 4AGQA 5MEPA 3RNKB 3BPOB 5F7EH 1QKZL 1UM5L 1RIUH 5LJYH 4NWUL 5GZND 4YUEH 1S7UA 5CR8A 5LKNA 4NXKA 2CIKA 4F80A 4ZUSB 5TFSH 2NNCA 3NIGE 2AGJL 2YQGA 3MNVA 2GW5A 2Y1YA 4YPJA 2E75C 3V5KA 4JPWH 3ZHNA 1L7IH 4K7PL 4NFBA 2K6WA 5ESVA 1HTYA 1RUPL 3QNXB 3ZL4L 2VKXA 1WC7B 2BSDA 4NKOB 4MS6A 1HOCB 3N91A 4ONOA 3SYAA 4JY4A 5F3HA 4V1DE 2B1HH 3LCYA 3MO1B 1X4XA 4OGYH 1G7QB 1NIDA 1KFAL 5ECJE 3T6VA 1X6LA 4FI8A 4P2QD 1KULA 5AWNH 1CG9B 5GZOC 4FZEH 1J0KA 1UGKA 2J6EL 5M94B 2DQHH 5DHYB 2VM3A 3ZO0A 1DLFH 3MU3A 1UZ6E 4IEFB 4AV4A 4U6VL 1OAYH 3DROA 1FRGL 2XTLA 3LEYL 2W8CA 2NW2A 4ODHL 4P3CH 4DP8X 3GMLB 2EIEA 3DGDA 2EDLA 1QLFA 1EUUA 5EC2A 5AD0B 3K8KA 2NY3B 4ZMOA 3GHEL 1HDMB 1M2VA 3MLWL 2EYRA 1L6ZA 1TTAA 2YO3A 1EHKB 4ZMLA 2XXFA 2BS8A 1QLFB 1X9RA 1AY1H 2IDSA 3F7LA 3QUXA 2N3JA 3ZHFA 2XTSA 1MIML 2A7BA 4TSBH 1I1FB 1SZNA 5HJ3B 3VXUE 2WGXA 4XN5A 4U6VH 4UOW0 1UOWA 3VH8G 2OKMA 2V2XA 4YSRA 4DUXA 1HNGA 4K55A 1YN6B 3SDCA 4OAWB 1H3UA 1F45A 1BEXA 2IANE 5FYJL 2CRZA 2XN9A 1PKQB 4M93C 5FFLA 1UWFA 3DI2B 3ZL4H 5IHWA 1P7BA 1T2XA 4G6FD 1AD9A 2EH7L 4LSRL 2K8QA 5EORH 1FAKT 4FG6D 4NPJA 4DW2H 2C7FA 2XWTB 4K5MA 3B2PA 5EU4B 3ULVL 4HUXA 2OCCB 4LFHD 1ZLWH 1N0XL 2AGJH 5GIRA 4H44C 3DTUB 1IC7H 2ZKWA 2N0KA 1CLYH 2ZXWB 3TYFA 5KN5A 5CN1A 1IGCL 4FABH 1E4KC 5EEXA 1CGWA 1LMIA 5GRJH 4H2AA 4K0OA 4TQEH 5HGHB 1RK7A 2BOBA 5JOFB 1PDKB 3OPZH 5DZOA 4IGBD 2CE6A 2EDYA 2IV9A 2VR9A 4Y2DC 2AK4A 4KY1L 1KXTA 3U2SA 3MV11 2NY0C 3QB7C 2XN2A 3TBSA 2ADIB 3WNOA 3VB8A 4FQHB 1DTUA 2Z8RA 2EDEA 4LOVA 1BYPA 4AIEA 1UENA 3LRLA 1YUHB 3WY3A 2IBGA 3LHPH 4Z78B 3P69A 3QQDA 3IMUA 4M8QA 2IWEA 4JM2A 4O4YL 5FW7A 4AV0A 2NR6D 5DHXB 2X87A 3N44F 1I9RH 2B5IB 4I88A 4I2XA 3UADA 3LDBB 5BZWA 2CO1A 5EORL 2L0DA 5I75C 1ZRUA 1LD9B 3Q3GB 4UYQA 5I76B 3QWRA 1E90A 3O45A 4WTQA 3VWKC 5KBPA 3PWVB 1RUML 1F4XH 4HFWB 3FHEA 3MOAL 2W5PA 3MNMA 1B4JH 4NBYB 5HYJE 4PWIA 4RRPM 2CDEB 3VTTA 4JNXA 3FB8A 4KVNH 3WUWA 5IIEB 2F1BA 2NTFB 4HS6A 4MMXB 5BVJB 4F2MA 1MY7A 5I18H 3ABZA 1PLCA 3CC1A 2DV6A 2MQ0A 4YXLH 4JFDE 1RZGB 4R7XA 3EBIA 1QATA 3NFSL 1E4KA 1UATA 3CN0A 5A2FA 3U0WL 3O6FB 3RVUD 9CGTA 5B39B 5B1KA 1TF4A 3D09A 1CBVH 4DTGL 2QSTA 1TITA 4Q14A 4EBQH 2OMUA 3U4EA 4PLKC 5E94B 3E9TA 1KPRB 1MIEL 5FO8B 5D4IA 5IHLB 1QSZA 1X5FA 1J86A 4MA1B 1CE1H 5D1ZD 5D4HA 1QFPA 5CJQL 4KNSA 5I16B 2F8XC 2VYRE 4NN5C 4ECNA 2PW1B 1T7VA 5J1AA 1MJUL 3DIDA 4HYTB 4WU5A 3CFNA 2YPLB 4C55A 3FN0H 2D8KA 3VFPB 1YEDA 4C8XA 3EIFA 4XN2A 3RPBA 4I89A 4X6CB 1KELL 3ZN6A 1H6FA 2W94A 1KXQA 3V0AC 1WV7T 2SODB 5DDHB 2AERT 3VXRA 2NY1C 3O4OC 4LHUB 2NNXA 3D34A 3WCYA 4PJAA 2A4CA 1MFMA 1T5KA 4MNHA 3V4UL 1KTJA 1OWRM 2FO4A 1JERA 3ULUH 4LHUA 2WYZA 2LAGB 2OSXA 3MLTA 5EOQL 1HKLH 4Y4KA 2J71A 4HBCH 2AXFA 3NUKA 1NLDH 4PBWD 2MCMA 4GT7A 3PYCA 4G8GA 43C9B 3UPRB 2R7EB 3ARWA 1X5ZA 3WUWB 1AKJD 4JKNA 4ODHH 4XMUA 1UH2A 4KUZL 1ASQA 4ODBD 3LEVH 1ZLDA 2FUQA 4WKZB 5IJCC 3MOAH 2LLLA 1AR2A 1ZLUK 4YGVA 4Z7NB 1SBSL 3V0VA 3PG2A 3KH3A 4TNWK 2EEAA 2AEQL 2R0KH 4OJAA 1QAWA 4GAJH 1GMEA 1JRHI 1MCPH 2G3ZA 4RGOL 3EO0B 4HZAA 3IDIA 3FDWA 4GW1A 1AHKA 3RZWA 5AKSA 3TV3H 5EIQA 4NM8L 3PF2A 3NA9H 1T6BX 4MB3A 4KQ4L 2IALA 3TVMB 4WI3A 3LEVL 3KPRB 1C7SA 2ADIA 3QS2A 4IRJC 2AABH 1WH0A 4QNPE 5C86A 3LKNA 4HWNA 5FGSA 2BS9A 5T1MB 3MX0B 1CN4A 2EABA 2TSBA 4P57A 3D6GA 2AK4B 1G9MH 1BXVA 2AABL 1YEDB 1E40A 5B8CB 2A1WH 3V4PA 4GIAA 2VABA 3REVB 1GGCH 3US9A 2X10A 3ARFB 3N06B 4ELKB 2E9IA 1NGWA 3T08A 5HVGB 2VDKB 3E3QE 4HUCA 4MDRA 1BBDL 3ABLB 3UFIA 4KDVA 3AGVA 1IL1B 2VR8A 2QVMA 1HHJA 3GMQA 2NNAB 2P5WE 3GIZH 4LDLB 1DQQA 4N2MA 3WENA 2DZEA 1A6WH 3DUHA 4CJ1A 4I2XB 5ISZE 1AS8A 2FLRT 5ABAA 1KCSL 1AZZC 2XQYK 1RI8A 3IPFA 5IMMA 2VLKB 2VUOA 2NCEA 3IU4H 5E1AB 5ESQA 5FYJH 4MA8L 1AO7B 4UM9B 4RRPG 5EOTA 1HH9A 2APXA 3B5TA 3ARYA 2X1XR 1SMDA 3D18B 3L4TA 4DSYA 3AG2B 2PN5A 1WG3A 3LKOB 3PHQA 1CFQA 1NDTA 4HS3B 5E4AA 4F2MB 3CMOH 3AS1A 1H15B 1JCVA 4FYTA 1JWUB 1Z5LB 3RWEA 4JZJA 2FATL 2WKOA 2WQWA 3GSWA 3UTTB 3DXAB 5AZUA 2GJRA 5BRZD 2BOBB 1U8CB 1OB1B 2VLME 3LTVA 1SLUA 4NHCH 1WITA 4ZAKC 4N2FA 3L4ZA 4TVPL 4WJ5A 3H7BB 2RAMA 1N6UA 1DUZA 2HT3C 4FG2A 1SOKA 3E1F1 1R4XA 1EXGA 1U95A 4UOW1 1MVFA 3I6LE 4RMTA 1CL7H 3NJIA 5KSUB 2OS7A 4Z78A 4N9OB 2ZCKH 3L7EA 3SDXE 1IEBB 1A0QL 4F5CE 3MV01 2CHWA 5KSBA 4DO6A 3VD1A 4CKVX 5E8DH 5HHMD 4NO0D 2Q20A 4JJHA 4LQFL 4BFIA 3WDJA 4J5VA 1TYRA 2AQQA 3QDJB 5I73C 5IB5B 4I1NB 3U2SB 3JZ7A 4LCYA 3U6RA 2O1AA 1AJ7H 3JWNG 4X80L 3I75B 4Z7NF 4S1RL 4P5TD 1CGSL 2QELA 3EKCA 3S3SA 2V2XB 4HLZH 1CDJA 3L3IA 3HFFA 3U6RB 3DBXB 1U3ZA 4IKIA 2XETA 4NQSA 5BUPA 4NKOA 3O2VL 4HKJA 2F54A 4N2LA 4R7NB 3OAUH 1NDGB 4KOBA 3GXFA 5FKPA 4E36A 4N85A 3P2TA 5GIRB 1OSEA 1FYTD 1A6WL 2YSSA 1P4BL 3SB3A 1M7UA 4FXGB 1FNLA 5F70A 1S8DB 1DSWA 2WZ6A 2Z7UA 3KE0A 1IGIH 4G82A 3OMNB 4ZUSA 4TXVB 3VI3E 1JZ4A 4PJGF 3EBAA 3VSQA 2Z1KA 2JELL 2AJ3B 2ZJSH 1WCBB 3JV4A 2WLJA 3ZKSD 2Y7OA 3ALWA 2X9XA 4YAQB 1XWVA 3KJ4C 1G84A 2M1KA 2B3RA 4JZNA 3WIFB 4A7VA 1BQ5A 2AJUH 2BY3A 2X4RA 4KMTH 4QHUA 4BQBA 1YMMD 3IRZA 5DC2A 3UXFA 4FOMA 3QCTH 3T0EE 3PWJB 2WXOA 5B38A 1GHFL 4G7YH