3HC2A

Crystal structure of chicken sulfite oxidase mutant tyr 322 phe
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDFKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords sulfite oxidase
publication title Structure function studies in sulfite oxidase with altered active sites
rcsb
source organism Gallus gallus
total genus 98
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2009-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hc2A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hc2A01
4PW3A 2A9DA 2CA4A 3HBQA 2BIHA 3HBPA 2BIIA 2A9AA 2A9CA 2BPBA 3R19A 3HC2A 2A9BA 2C9XA 4PW9A 3R18A 1XDYA 2CA3A 1OGPA 2BLFA 1XDQA 2A99A 1SOXA 2XTSA 3HBGA
chains in the Genus database with same CATH superfamily
4H25B 3P9MB 4R90H 1VACB 4NQUA 2H3NA 4JVUA 5ITBH 1MLCB 1VAHA 5JUEH 1FIGH 2Y3AA 1MCOL 3E38A 3TN0B 3ZW3A 3ABLB 3RL1A 2D9QB 1EFXA 3ISRA 3OKEA 3PWPD 2GK0A 3NJMA 1XZ0A 1JDCA 4Z3TA 2OW6A 1VSCA 2XTLA 4HMDA 5EF1A 4DPBX 4KRNA 1XF1A 2LV4A 1NCHA 1U8HA 2OTUA 4NN6B 5C71A 2ZSVB 4XNXH 1KIPB 2X4NB 5SWZE 3CSFA 1QPXA 1A21A 3HI5H 4KVCL 4QAWA 2Z8RA 3EH1A 1LO2L 4AL8H 3LKNB 1HX0A 2AXFA 2BNRD 4IDJH 1HHJB 3DI2B 3DOIA 3FYEB 3BAKA 3UBXB 2DBLH 5IJKC 3QAZB 2AITA 3OJ2C 4IJ3B 1BXXA 3UTPD 3MLVH 4KUZH 1JRHI 4HWBL 3LY6A 3NEEA 4OCRH 1RIHL 2UXFA 5TQ2H 1RFDL 4JFFA 5B39B 3LS5L 1NCWL 1A6PA 1S7UB 4Y16A 3OWRA 1O9WA 3QFDA 3UEZA 2X3AA 5M95B 2A74B 4G6FB 1RZPA 1PX8A 4ELMF 3QNYA 2RALA 2BFVH 4AEHL 2XWDA 1M53A 3DK0A 4PRAB 3EYFB 4ACPA 1ZT7B 2V5YA 2XIIA 3N6YA 4Q6IB 2E59A 1UM5L 1CLOH 1IRAY 4KFMA 2IPKB 3UGEA 5E2UL 1R1CA 2DQCL 5I0WA 4GYBA 5F7EL 3F00A 1XR9B 4OJDH 3A6CL 1T0NA 1X9RA 3RUGE 1INQA 4MHHG 5I16A 4HS6A 3WSQH 1TENA 3H2QA 1JK9B 5I73C 1Z3GH 1R3IH 1RQ5A 2R1WA 4O4YH 1UURA 3Q1EA 4MA1C 3OF6D 4W9FC 1IGTA 5IIEA 4S1QL 1JHKL 1W2KT 1WFNA 4EUPH 3RIFF 2WUBL 3QDME 5EOQH 2ZCLH 3T1FA 4DAGH 5FEBA 4N2BA 1OY3B 2WQVA 5DRXA 2WLHA 3DPBB 5J6HA 3D33A 4LP8A 2FGZA 4YXHL 2JB5L 2VDRB 2BW4A 4MX7B 35C8L 2N0MA 1DBKL 3CVHA 5HHXL 4PJEF 1MFEL 4O02A 1IEBA 3QWOB 3EGDA 3Q7JA 3SGKA 1JV2B 2K6YA 1FNEA 3BEVB 4AW4A 1NPNA 1ROCA 3G6JF 4UYQA 4DVBA 1D9KC 1NMBL 3DVGB 1Q9KB 2YAPA 1PAMA 2ARJB 4GUPA 1EEUA 3QNZB 1O0VA 1R33A 2PPFA 2Q7YA 1ZLUK 5KG9B 5MENE 1MWAA 3QIBB 2FWOA 5IW3A 5JORA 4MBRA 5I82A 3MV01 2GG1A 3GTTA 1IT9L 4D0BA 1EUUA 3TH2T 3ETBJ 2BHZA 2Z7ZA 1F4YH 2Z65C 3AADB 4ZMWA 4JY4A 1CDYA 1Q72H 4OLVH 4K8RC 4LCCB 5DJ8B 3RL2B 3WAKA 4UTBL 1L7IL 2FH8A 4LCWD 1YAZA 4KXZH 4KO5A 5LXGH 4I85A 1XTMA 2NPLX 4IK7A 5IQLA 1J5IA 5J12B 3C6LA 1MCFA 3RA7H 3EDEA 2AI0H 2G60H 3I75A 4LHQB 3SHSA 5HDQL 3FFOA 4M4PA 4YHPB 2VLJE 1CICB 2KZKA 3S37L 2NTSP 1DANU 3JBG7 3VNZA 4N5EC 3SE6A 4LBEA 1IBFA 4DESA 4ONHA 1LO5B 5D7EA 5JIMA 3OTTA 3D0LB 4JQXA 4KV5E 2QGBA 2YEZA 1UXLA 5IQ7H 1PGRB 1RJLA 3W56A 2R8SH 3T0DA 5FA3B 3Q6FB 4J3OD 5HD8C 1ZJAA 2FNWA 4YDKL 5K1NA 1CFNB 5DDHA 4G42A 3ZZ1A 3L3HA 4H1LH 3CVIL 4ELMB 4LF3B 3S3DB 5ABAA 2AJXH 1X5HA 1AANA 3EDKA 4MAYA 4PS3A 5CD5D 1MZZA 1DN2A 3X2QB 1RZFL 3RJQB 5FB8B 2XWZA 4M7JL 3QG6A 4H0HB 5J1AB 2KPNA 3NZHH 5JXAL 3JV4B 4RBPK 3CZSA 5JNYB 3IDIA 2OL3L 3ZOAA 4YGVB 2YQBA 3AGVA 1A3ZA 4M5ZH 2B3RA 2VM4A 4L4TB 4WKZB 5EUKA 1D7BA 3O4OB 4DP1X 4QHPA 4XC1H 4IRZL 2N01B 5L2KA 4RSYA 2FJUB 1BYPA 4LLUA 4BH8B 3HI6L 4XNBA 5E00A 2J4WH 2X89D 1NUNB 1QBML 4BCXA 4WCYL 4TLUA 4LSVL 3FSAA 3WD5H 3WMPA 4OH2A 5T5NG 1OAQH 3AAZA 2BS9A 4XMVA 3VFUB 3VFWB 3EJCA 1FZKA 4FXKC 5IMLA 2XJKA 3W9EA 2GPZA 2EDJA 2ZYRA 5DCCA 1LE9B 1KXVA 5J0BA 4JDTH 2HT2D 4WFEE 1ZS8A 3DMMC 2FJHB 3MODH 1S3KH 4PJEB 2WNGA 1JWSA 4X99A 1M4KA 4DWHA 4Y5YA 4HXBH 2OAAA 2P43B 5AL8A 2EP6A 5EU4A 3UH8A 5D7KD 3KYMA 3TN0D 3G6JB 4M3JA 3D3VA 1P7QA 2OR7A 2HJKA 3K2UH 4PWFA 3LKQB 2CMRH 5IHWA 2ATKA 2AF2A 4F1SA 2GKIA 3KJ6H 1B4LA 1G84A 4WZ9A 1HK6A 3T71A 4S0TD 1UKQA 4U3SA 2YJQA 3GO1L 5EBLA 2FE0A 2BOBA 2K6WA 5EOCJ 1A6AB 4F57H 3BVDB 5BRQA 3L2NA 3DX8A 1TMQA 2O5YH 3H7BB 2YO3A 4X0NA 4Y4HA 4GIAA 4JPIB 2WXLA 1G7MA 1G1YA 1ZT4A 3L5XL 1XB8A 2FYYB 4N90D 3GRWA 3BKYH 1DBML 4X0KA 1FE8H 3CFDA 4PV1C 4UTAL 5DXWA 5IV2A 1JZIA 3NIDE 4HF5H 3OKOB 1FAIL 2X0VA 5DLMH 5SWZB 3VFTA 4G6FD 4HISA 4S1RL 5TD4A 4BQCA 1XH3B 2XA8H 2PCXA 3EHBD 1H6FA 3S4SB 2Y5TB 5KBNC 1JBJA 3MRQA 3EADA 2ZCKL 2UX6A 3T2NH 1WAEA 1MCOH 3JWNH 4MVBC 1HL5A 2AW2A 1ESOA 4LK4A 3QJHA 1JGLL 3OMNB 4GINA 5DO8A 1C9SA 2WQ8A 3VM5A 2ODHA 4KV5F 1HOCA 1KIRB 3M07A 4A55A 3EO0A 1UCTA 4MAUH 2E7LC 3UPCA 1EEZA 4OF5A 3WELA 2ZCZA 3Q2LA 3ZQXA 3CQPA 1EWHA 1FZOB 1KJMA 3LZNA 3LQMA 4KVCH 1QPKA 3UG5A 2NW3A 2LFEA 4RAUA 1U6AL 4FQLL 1TZIA 5CN3A 3DROB 2MMXA 3S3BB 2H47C 4G8IB 4RGOL 3BSGA 1YUHA 3SPHA 2OXGB 5TDNA 3OGOE 1OB1B 2XRAL 3BVWA 1G7PA 3GTNA 4PRBB 5JQHC 4P2QA 3ATFA 4KITB 4HWBH 1OSYA 4WWPA 2PTVA 4FMFA 3J27A 4FJYA 2YPLB 3V52L 3LS5H 1NCWH 1XF4A 3GBLA 4QGYA 4NUMA 2BP8A 3S8WA 2O6PA 2FEDD 4AEHH 5IW1B 3BP6B 3FB5A 3RP1A 1M1XA 2YD9A 2C7UB 4DOHE 4U1MB 4XXCC 1YEDB 2DQCH 3E2HB 3MV8E 2GITA 2P5PA 3TPUB 3ZDWA 4D8PB 3ABMB 3OKLB 3QDJE 3QDMB 4X5PA 2X28A 2X4UA 5CWSA 5IQOA 4MCYB 3QIBD 4OUOA 4P07A 5GS0D 2Z7YA 4HDIB 4LQ1A 4FQ2H 4HUWB 2AV1A 1RUKH 4PVLA 5BUAA 3LPPA 2WIMA 4JFDA 3MGTA 3APNA 4NKIL 5LBSH 4F7MA 4G7QB 1XCTA 2IMNA 2RFXA 4WDIA 4YPGA 1SHWA 2JF1A 3QAQA 1EDHA 1ZGLB 4NCC1 3IF1B 4MJ2A 1RK7A 9PCYA 3QUZB 2L04A 2A3TA 2PW2A 1CICD 3K6SA 3KH4A 1E4JA 2ZT9C 1VADA 5MENB 4XHJD 2LR4A 1QKZL 4ZW8A 4PJDE 5KBDA 4RRPG 1P2CB 2QKIA 4NM4H 2JB5H 2C5DC 3ARFA 3LVTA 35C8H 3S97C 4A6YB 4AM0Q 2NW2B 3OKDA 4FE9A 3ECVA 5HHXH 1W8EA 3M1BA 1BZ7B 1MFBH 1SMOA 2VW7A 1OGAE 4XP4L 3IJYB 4MA3B 2X44D 2HLEB 2AJZB 1NGZB 1GPOL 4ZTPL 1FP5A 1HHGA 5GSRB 5JHDE 2VLJB 2H6PB 3MV11 1I1YB 4B60A 1TKWA 4QJ4B 1A1OA 4A7VA 3NIDF 4K9JA 2B2XH 4ODHL 4OCXL 3HI1A 3VFVB 1NH6A 5AAMC 3G5VA 1OALA 3K0WA 4HIQA 4XX1G 1J0JA 1L7IH 5F3BB 4LEOA 1PKQE 4D0CB 1FGNL 1PZ2A 1S5HB 4L4TD 4TTDD 1ZCRA 4CBPA 1BM7A 2YAMA 3F85A 5HDQH 3ZSSA 1XDTT 4KZCA 4P2OB 4DEWA 1TVBB 4JZJB 3GM0A 1Y18B 3PNWA 1UWGH 3EBHA 4M7KL 1XR8B 3DNKA 4U3XA 3QXAB 4JJOA 1YY9C 5DJAB 3L3KB 4QYOB 5HYFA 4GI6A 1FL6B 3QQNA 4ZBJA 2FVNA 2X0UA 2VR3A 2OX5A 5DFTA 2Z31C 4U7SA 5B1CA 5GJTL 3P4OA 2DH2A 3P2TA 3V95A 3SQOL 3D1MC 3SQBA 2IPTL 2V7NA 1MREL 1T0PB 3BQUC 3ARTA 4BUGA 4PGEA 3ATDA 5DUMH 1O6SA 3SDYH 1A9BA 3NCXA 4DZ8A 2DQHL 3LH2L 4JFOA 1RZFH 4AQ1A 3WBDA 3QWRD 2NY4D 2BWDA 5C3IA 4HAGA 1KCSH 3SJVA 3S98A 1GMIA 4X7TB 3CDZB 5C0NC 1D2OA 4Y9FA 2XYCA 2JNZA 2C9XA 4OI9A 1ML0A 2IANE 4EDWL 3LEVL 4NQCA 2ZOOA 1H3WM 1AXIB 5D72L 4F27A 3LRMA 5I24A 1CQYA 2R15A 4HUUA 4IRZH 4DN3L 4EE2A 5JPNC 1MRDH 2XQBL 3HI6H 5C0AE 2R1YA 1QBMH 1XIWB 1IUZA 4OFPA 2QZ5A 1G0XA 1PNCA 3ZY7A 4X7EC 4M5TA 3RWFB 3A21A 2AXGB 4OSUL 5JIIA 2NR6C 4M9OA 3O4LE 2KT6A 2DTMH 3DTUB 4JZOA 1OARL 3LV3B 5I1CH 1CFQA 3O9WB 4H8UA 5E56A 4NC0B 1EAJA 4GIOA 5IQ9A 2X12A 5SWZD 3GK8L 1KCKA 3E6FA 5CSZB 1SLUA 2DQGL 2VDQB 3HVDA 3UCRA 4ODTL 3NK3A 5LWYL 3S36X 5B8CC 4PHXA 3ZMEA 3BH9B 3T0WA 1L9PA 2BVEA 2GHZA 2GJ6A 2CA4A 3VQMA 4V2CB 5FYJU 4ZYKA 2D7QA 1QYGL 3D30A 3VJ6A 4L3FA 3HAEG 1ADQA 3LHAA 4JPKH 3D69B 5IVXE 4LARL 4P3DB 3V0AC 4K5NA 2VQ1B 3O2DA 3T5WA 1J1PH 3NIDB 3QZBA 4L9LB 4GG8A 5F1IA 3GO1H 4DK6A 5C0EB 1HC1A 1D5BB 3DARA 3PE9A 5I75B 3CJJA 2NUPA 4DGVH 3W2DH 4ZMLA 2OK0H 2A0LD 3UIYA 5IF0A 1FAKT 3L5XH 1T89C 2X6MA 1BCIA 3SPCA 2FJGB 2BNUB 1DEEB 2FWLB 1IQWL 4NQTA 3UTQB 1DBMH 5D4HA 2OMNA 2YPLD 3IAQA 3TFBA 3MUY1 1QLRA 2VWEE 4YE4L 5HGAA 4XC3L 2ZPKH 4X6DE 4CMHC 3ZDZB 4S1RH 1C16B 1A22B 1MCHA 1XEUA 4AM0B 3GJFK 2C4FU 5E6IC 2ZCKH 1LLAA 2WXKA 3CLEL 3MGAA 3CN2A 1AP2A 2Y6TE 3MJWA 4IKIA 2ZKWA 3O3DA 5I76B 1IAOA 1TPXC 4UQEA 4WW1B 1J87A 3JYCA 4PREB 4KO9A 3ZYOA 3QDMD 4C54A 3QIUC 1DSFL 1OK8A 2K8QA 2G30A 2BOLA 1GY1A 4G59C 3DKHA 4XCFL 3RAJL 5E6YA 1A3QA 1OAYH 2P8PA 4N3TA 1ORQB 1CG9A 3C5JB 1BM3H 5AZUA 4EEEA 1BOGA 1EIBA 1JNJA 3CZFB 4B9CA 1HWGB 3TV8A 1MQ8A 5IM7A 3GRBA 4MQ7A 2DQFB 5DEGB 4DOHB 2J55A 4N1EA 3QUZD 2VMDA 2XRAH 4TNVK 2HFGH 3FRPB 5F89A 3MV8B 3OV6A 3SDCC 5KBPA 5A7BA 3C5ZA 5H35A 3LOWA 1FWXA 1KT2B 1RZIA 3EBGA 3QDJB 4U6YB 3V52H 4CILA 5MEND 1WEJH 5BRZB 3NCEB 2OP4L 4CW1B 5EU5B 3QPQD 4HC1H 3C8DA 3FF8A 4LU5H 2G3XA 2I7OA 5CLXA 2HT3C 4BKLA 3QUMH 5GZOA 2JJTC 3MLRL 1QSEE 4Q6YA 4R7LA 5F0PB 2IDQA 1QD0A 3O6KH 4IIQA 4HWUA 4LVOC 3VGAC 2NY2C 3EJYC 3MTXA 4L3AA 4OCSH 4OF3A 4R8WL 5F96H 5C0DA 1ZS2A 4N2AA 2VLJD 3KLSA 1DFBL 4ZUSA 2MHAA 3IJ7A 3KE0A 4RFEB 3D51A 4DZBB 2GIYA 2YARA 2B5IB 4NKIH 2XZAH 3TA3B 4B9ZA 1WITA 1FNFA 2YR3A 3O6ML 2X2JA 1S9XA 2JKXA 5DHVA 4DKFL 2Z1PA 4G6JL 5CJQL 1OGAB 2WUCL 3QH3A 4YSQA 3NFPB 2A83A 4QHKI 1QR1B 3BWAB 5DRWA 4P2OD 5GRJH 2JK5A 1AACA 3GHBH 4EJ1C 3VFNA 5JHDB 2WYIA 3PJSA 5IVXF 4YDLC 1ID2A 1OE3A 5IB1B 1E0OB 3T6ZA 3TEWA 2NY1C 2NDFA 3WJJC 3CHPA 1KTDA 4QWWC 4YFDB 4JPWL 4L5FE 1GVIA 4M29A 1EZLA 3BUDA 3HBQA 3UABA 2YPVH 3RPIA 4HCFA 3RWGA 4Y5VC 1PKQB 2FQGA 2JKJA 3EOBB 4RNRA 2RB8A 4PVMA 1GPOH 2XPYA 5AW3B 4TVPE 3D85A 4C4BA 3DBXB 3NCFB 4B9YA 3U0PA 2PYEA 3GMQB 3WLWC 2D73A 4OQTH 1A14H 4G9DB 2IFFH 4FQJH 5JW4M 5ALCL 4NRXB 4X6DF 2E46A 4OCXH 1E27A 2LABA 5GSVB 3LRLA 2I27N 1RP8A 3HNTH 4E9RA 1KGWA 3B6SA 4FHKA 3NRFA 4EKJA 4GUQA 1NAMA 1BEYL 1HNGA 2XWBB 1C1EH 3RVWD 1AHWB 1FGNH 4BZ1H 3D0VB 4KKZA 3GSNB 5DGQA 1IX2A 3PUUA 2C9PA 4QCIB 3T2PA 4OTXH 4AJVA 2VDNB 4M7KH 4BFNA 1XIWD 5C2UB 1YEGH 4F58L 3TP4A 3QRGH 2GJJA 2SODB 3QT2A 4PJ5B 2MQGA 4UOJA 1DVFC 4YSOA 4KKRA 4QTIH 1BZ9A 3PHOB 3VFGH 2XWTB 1ZIBA 2Y72A 5E8NA 2IGFL 3L4UA 5K39B 3O9WD 3DUUB 5IOPA 1AQ8A 2IPTH 1JZ6A 4M48L 2IANB 1QQDB 1MREH 2WCGA 3PL6C 3QIWB 8FABB 2Z92A 3IDXL 4XPAL 4IBUA 2CKBH 3H3PH 3MRLB 5E1AB 1KNOB 2XZQH 4FLQA 3LH2H 5I6MA 3EXLA 4YFLF 5C0AB 4BQBA 1DUZB 3TVMA 5KJRH 4XCYB 2IJ0C 4RISH 1JXDA 3PAUA 4TNWF 2HFTA 1HEZB 1I9RL 2X1QA 4TOYL 4Y2DB 1ODAA 3MNWA 2R56L 5D1ZD 3F12B 5DMYA 3O4LB 5KAQG 4PGZA 1RIVL 1NAKH 1V7NH 2IDCA 5GRWA 2Q7AA 2Y1YA 5D72H 2K9FB 4F7PA 1KYOK 4DN3H 3RPBA 1YYMH 4UT7H 2XQBH 4GSDL 5CP7B 2HMID 4LLWB 5AW4B 1UT2A 1CD8A 2AK4A 2VUOA 2ZKHL 5IQMA 2JIXB 4J28A 3KPOB 4G8AC 4OSUH 4GW4A 2X9XA 1U8NB 3RVTC 3WUWB 1G6VK 1B2WH 3BGFB 3FTXA 5JIPA 2VZTA 4ENEC 5IVXB 1R6VA 2A7BA 3VXQA 2OJZH 3GK8H 1JRHL 3EDFA 2VDLB 1DR9A 4NQXB 2DQGH 1FSKB 4ODTH 4AC2A 3TS8A 5LWYH 5ICYB 1RIUL 4ABVA 3Q8BA 1JTPA 4HLEA 5D71H 5F9AC 5FO9B 3QYNA 5BXFB 3OQRA 3WKPA 2CM5A 2I26N 2CCVA 4U6VL 4Z6AT 4LARH 5INDA 3NA9H 4TLSA 1DVTA 4N8VA 3M8OH 4X6DB 2AMGA 4X8JB 1BVLA 2QT6A 3RY4A 3CZKA 4OLXL 2EIKB 2VAJA 3GMMA 2I9TA 1TJXA 4JZNB 2DICA 2GIMA 3QRBA 5HJGA 3BCDA 5C07E 4KDTA 1WWWX 3V6ZA 4WO0A 4JFHE 3T8MA 1YEKL 2WZ5A 1IQWH 2UYLB 3MV8D 4FYSA 4TUJB 3HNSL 2EO7A 3DV6A 3QDJD 3U82B 3MBEC 3NEOA 4L37A 4XNAA 5BRZD 1UD2A 1ZHKB 4NYLB 1Y0LB 1S7XB 4UILH 2ZOKB 2GIXA 4QRFA 1T6BX 3DIDA 4WHCA 1FH5L 2YPKB 7FABL 2DIAA 3CLEH 2XNAA 1I8IB 1OK0A 3RX8A 3G6AB 4H0IA 3G5WA 4W9GC 3KPSA 1LEGB 3WMQA 4DHLA 3VE0A 3CN4A 3HZMA 3W39B 2GUOA 4RCAA 1DSFH 4AQ8C 3MREA 5D2NE 3PRZA 3IPFA 3OLDA 2WXMA 4F15C 3RAJH 4B5ZA 1KYUA 2ENSA 5TFSL 1G1KA 1UQSB 1MCPH 3TA3D 3U1SL 3ULUL 1O9ZA 5AZ2L 1XGPA 2CRYA 3IGUA 2AKRA 1WISA 1OVZA 3FW6A 4AWJC 3H54A 1OGAD 2BSCA 3SBWC 3EYOA 3I9AA 4LSDA 3B1UA 1WFIA 1QSEB 2PPDA 3VFSB 4U1JA 1FHGA 1OF0A 4OGYL 2AABL 5JHDD 5DD3H 4Z3GA 3EFOA 3RX5A 1A2YA 4Y8AA 4LGSB 1TNMA 1KOAA 4R0LC 1N3NB 4RRPA 5EB9A 1PU0A 3DX7A 2ICEA 4TYUA 3JWOH 5DC2A 1C12B 3P77B 4OZFB 4PW4A 4IK6A 5JW4N 5IR1A 2H26A 4X9BA 1W0WB 3O2WL 4CBZA 3EF7A 4YBLC 3JWDL 3TIDA 4RWYL 1DCEA 3LN5A 1N59A 2D8KA 4AQEA 2D03L 5DK3A 3VXUE 4M1CD 1SYSA 4PTUB 1LXMA 4R4FL 4WU7B 3ZTCC 1H9DA 4WTXA 5FUCC 3V0FA 3O3AA 3U36B 1RJYA 3QUXA 3V4PH 3FQRA 2AJYH 1LDPL 2E9JA 3P0YL 3D3VE 4DH2A 1HAUA 2P8LA 5F44A 2JMRA 3IE4A 3K4ZA 4O5LL 5FC9A 3FFDB 5CJQH 2WUCH 2YK1H 1LYQA 3KAAA 1URZA 3MOAL 1CYXA 3Q2VA 2VZ1A 5ANHA 2JJVA 2VLRE 3PFQA 3U0WL 2EIZA 4N2GA 2C3VB 2C9RA 4L18A 2IMMA 3L3IB 4ODVH 2O6CA 3KWXA 5I6XC 1B0RB 4LRIA 1KBWA 1Z9SA 3QJVB 2CRZA 4F9LC 4PJ5D 4DKEL 1RH8A 2OCCB 3BO8B 5BW7A 4JPWH 3RL1B 1HINL 1EFXB 3OKEB 4N1CA 1ZHNB 2GK0B 1XZ0B 4FKHA 3M88A 2CGYA 1P7HL 3A47A 1RPQA 3LD8C 2IAND 1U8HB 3QIWD 2OTUB 3AXIA 1CN4A 4FCHA 1VFBB 2JJWA 2DJ4A 3B2VL 4PJIA 5C0AD 3IB4A 5I1LB 3OZKA 5D1QA 5GISL 2HVBA 3OMZA 2HKAA 1AGCA 4YBQD 4Y2DD 4N20A 4F33A 1DJSA 1IBBA 2VIRA 1NIBA 3BC9A 4HG4K 5D1XE 3H3KA 3ZKXB 5EH1A 1BEYH 5B21A 3O4LD 3NJLA 2GB2A 2VDML 4JRXE 1OP4A 2NLJA 4DP9X 3BCFA 1DQML 3UMTA 1QLEB 1BFOA 1ILUA 3H3BC 5B1AB 4GXUM 2C9UA 2IH1B 4J3UA 3QNYB 4WQOA 1ZANH 2UY6B 2OMUB 3MA7B 4JMXA 4JFUA 3PAZA 4RSVA 4U6HB 3O6FB 3TBSB 4F58H 2JIXD 1ZE3H 2ED6A 4LQFL 4O51A 4YC2C 2HH0L 2IG2L 2AQRA 5KSBA 1CO1A 5JPMA 2OYKA 3F2LA 5FX3A 4JX0A 4ZOCA 3KCWA 1INDH 1SQ2N 4ZS6D 3SE8H 4PLJC 3L7EA 3D52A 1INQB 1UVQB 3O8XC 3B7UX 4HS6B 5IB4A 4A67A 1ETA1 3LRSA 1XGYH 2EYRB 4J3OH 4NCDA 1H3GA 3IDXH 5GGSA 2BSEA 3REVB 1B4RA 4FFYL 3S36L 4MCZB 3BT2L 4N68A 5AVSB 5G4MA 4B27A 3P11L 3SKOB 5FFOA 4LVNB 4YEFA 1IGTB 1I9RH 4TOYH 4KH2A 5IIEB 5KVFE 2R56H 5DWUL 1GJUA 5DUPH 1QPPA 1FNLA 4X4YB 3HAEA 4U49A 4YR6A 5ITFA 3T1FB 4LRNL 3LN4B 3QQXA 1I3UA 2CBOA 1OB0A 2PF6A 1S9KC 1UKTA 5FYLE 3GRGA 4GSDH 1IGFL 4QRTA 4LIQL 3IKCA 3KZ8A 4O02B 4I3SH 4HCRL 3UAFA 2ZKHH 4R5XA 2QGDA 3DVFA 3EGDB 3F84A 3OXRB 4C4KT 3WGUB 3QPXL 4Z95L 4RQQA 4DVBB 4N9OB 1ERNA 1QLFB 4NT6A 4B3VA 1F6AA 5EFIB 2AEPH 3NESA 2O5ZH 4NIKB 2CCLA 4K71B 1MWAB 4M62L 5JORB 4PJBF 1NPJA 1T04B 2MOQA 4N0YL 3ZSTA 1KWGA 2B1AL 3DBSA 3FDWA 2P7TA 3DHPA 1DQJB 2VZ3A 3GBDA 3ZTNL 5IEHA 3SYQA 1EZUA 2P44B 3SN6N 5C07B 3H6JA 3VMOA 4S2SA 4QJ5B 5ADPH 3RVXC 4NJ9L 5EZIH 2QQLL 2ZWZA 5HDRA 3S48A 1JZHA 1QABA 2VH5L 3I75B 1HN1A 4X50A 2FUQA 3MUZ1 1BX2A 3L2LA 4Q74A 4H88H 2CJUL 4OLXH 1WBZA 1OM3L 2YEZB 1RJLB 4ZO8A 5KEZA 4G5AA 3WFBL 3L9RA 4JE0A 4AGMA 1QSED 1MY7A 2VXUL 1ZXKA 1CBJA 2VERN 5DDHB 2W07A 2I9LA 4G42B 5C0IA 5GGTA 3L3HB 4AVIA 4BWUA 4YJZL 2HVKB 3FPXA 4N87A 4N9GA 3B7RL 1ZE3C 2F5AL 3K91A 4TUUA 5D2NB 4MAYB 4OUUB 2ZG1A 3V9CA 1BMWA 3P9WB 4GS7B 1G7HA 2COQA 5ICXA 4KKCC 3QS3A 4NZTL 5D7IB 4A7QA 3ZRFC 3H1ZA 4LKXB 1DQIA 5AAWC 3TCLB 4Z7AA 5A43C 3DUSB 2P1YA 5DYOA 1OP3H 3U6RA 3KGUA 2QVMA 2UXVA 2OMXB 4ISVA 1OD9A 1R3KB 4UYPA 1V05A 5JDJA 4LLVB 4HJEA 4LLUB 5IJKA 5E00B 3C9NA 4P5TA 5TFSH 3B2UC 3DGCR 3SJVE 5AZ2H 3UBFA 4Z76A 1WHOA 1HKFA 5CGBA 2WXRA 4BFIB 4B53A 3MRKA 2W92A 1V3LA 4MMXA 3W9EB 3ML8A 2ITCB 2BY1A 4NQCE 2OR9H 3QXWA 4JFQA 2WVUA 4OF6A 4NS0A 3VXUB 2Y9RT 4TUOB 4CKQA 1SLXA 1JWSB 1SOSA 1U3NA 4X99B 1EEYA 4NRYA 4HIXH 5EU4B 1QEWA 1AGEA 3BPNC 3KYMB 5G5DA 4BK5C 3K1DA 4PRNB 1YEWA 2GI7A 3P40A 1EFXD 3D3VB 2HJKB 1ZTXE 4XHQA 1CGSL 2E4TA 4MJ5A 2ATKB 1DBBH 4GP8B 5E23A 3LTVA 1Z66A 3R4RA 4ZUWB 3WFZA 2G75A 2WANA 1J86A 3UAAA 5KZCB 3BZEA 1KBKA 5LLIC 4GRLC 4PJBB 4E9QA 3JWDH 2GJZA 2LQRA 2XXCB 5IROC 2P45B 3RFZB 2D03H 1NKOA 3HKZA 4FQXC 2VLRB 3ZZLA 2P4AB 3NAAL 4R4FH 4BE5A 4JN1H 5E2TL 5I5MA 1TDQA 3NA4A 2N59A 3DX8B 4HGMA 5JW3L 4Y4HB 2UWEE 4J3TA 1G7MB 4GQPH 5E2JA 2AAAA 1Q90A 2GJ6E 1BVOA 5E4EB 1ZIAA 5D8JL 3RFRA 4FA6A 4K9EL 2BVQA 4WUUA 2NXYC 3II3A 5F6IC 4X0KB 2B4CL 5IV2B 5DTFB 1NCIA 4NO5A 1SDYA 4BSWA 3IDUA 2CH8A 4LAQL 2F68X 3MRCA 4IMKC 1ZT1A 4HSAC 3O6FD 1D9KA 3LS4L 3WEXB 3BSZA 4U1LA 1CWVA 1FZMA 4X80L 3QJHB 1N6QL 5DZ9A 5I30H 4U3CA 5D1XB 5IHLB 5I17A 4X6BA 2DV6A 4WI7A 5T3ZL 1HOCB 4E41A 4JFXA 2XKSA 4JRXB 3RHWK 2ITDA 2FHFA 3OLEA 1Z0MA 2QGCA 3NABL 4UQ3A 4DERA 1TZIB 1HI6B 1QBAA 2ZCHL 4G2AA 4LLQA 4BXSV 1YUHB 4PAZA 1YG9A 2FJFA 1G7PB 3KPMA 3NFSL 4FCAA 1VJSA 5CKAA 3MNVB 4ZW6A 1ASPA 1KTBA 3KPNA 5J06A 3VXPA 3ULUC 1DQMH 4PSPA 1AI1L 3ZBMA 1ZAGA 2ZAHA 1XF2A 3I02A 5BOPA 3BLKA 4UUJA 3TH3T 3V5DB 4MGXA 4DTGL 1HH6A 3DXAE 4K5OA 5E0FA 3DSNB 4RESB 1QUPA 1J88A 4HIPA 1YEJL 3FB5B 1NLBH 4NO2B 3C5SA 1Q0EA 2HH0H 4UOZA 3UC0L 3P0VL 5F3HB 3CZGA 1ECYA 4HS3A 3FU7A 1Z5YD 2J71A 5CWSB 2ZAGA 2C1OA 5ICUA 2AV1B 2FWUA 5EBMB 3U4KA 4CADA 2CDGB 3OKMA 2X40A 3OZ9H 4F7MB 1JYXA 1XCTB 4IMLA 2N7SA 4YPGB 1IB5A 4IQHA 1GYVA 4JG9A 5C07D 4QRRB 1TTBA 4JFHD 4OJYA 1VERA 2IFGA 5LCVL 1RD6A 3N91A 3V0EA 4E5XG 1ZLEA 1MFAL 1H3PL 1BXUA 3K6SB 4JFTA 3DA0A 4L48A 5A3IC 2VXQA 1L9QA 1M3IA 3JUZA 1U33A 4PBWD 1OCOB 3ARFB 4FXKA 4HT1H 1IGFH 4LIQH 1E28A 1WGVA 1Z2KA 2WIIB 3C12A 5F8QC 5INCA 3KHOA 5KVDE 3VFPA 3LJ3A 2UWEF 4UI2A 4WU5B 2BP0B 1UACH 3V6FA 4P4KC 4A7GF 5H2BA 1G9MH 2R0WH 1HHGB 3D34A 3EXJA 3A3YB 4MAYD 1RZKL 1TKWB 1DZBA 1A1OB 1TFPA 1OO2A 3FQUA 4M62H 3AM8A 4YBHA 1FORH 4N0YH 3UBHA 2CBQA 5E7FA 3FSWA 4H4NA 4J3SA 5I6NA 5IESL 2DWYA 3QDGE 4JNXA 2XBZA 3V8OA 4F5CA 4R3SA 4F91B 3V0JA 2FBJH 4CN4A 3NH7L 4NJ9H 4EQ2A 1RZQA 4N2FA 4AJWA 2ZG3A 5F1KC 2JLLA 1G6RA 4TRPH 5SWQA 5C0CE 3AXLA 1X5LA 3NIFE 4TTGA 4FKKA 2Z91B 3B4NA 3RY6C 2JKSA 5IGXL 2CJUH 3T4AA 1ZEAL 3TTYA 7PCYA 5C6WH 4I1PA 1TVHA 4GQZA 1KN2L 3WDIA 3GINA 4Z3IA 5A2IH 4OD1L 1JZ5A 1EXUA 1JI1A 1R24A 3E8VA 3WFBH 4X9FA 5FPIA 3ZHDA 1WFUA 4ONFL 4N24A 1GA2A 5D6DC 2V7NB 1L0PA 1FO0L 4ZS7L 4ZFFA 3QQ4A 5D93B 4M8RA 3B9KA 3VXUD 2HN7A 1QFHA 3PPEA 4PGEB 3PWNA 2EVIA 2JKRM 3ELAT 1FBIL 5JHAA 2TRYA 1DVUA 4HGKC 4JFPB 4TLKA 2H0EA 2PWFA 1KPUA 3D3VD 3Q5YA 3R1GL 2EXTA 1JK8A 3FB8A 3SJVB 4PJGE 1SHSA 3WJMA 2E7LA 5KZCD 4YEEA 3FT9A 3V5HA 2A38A 4EPSA 4BWTA 2F54A 5HHOA 1CTOA 5FWRA 2CIIA 4NQCB 5HJ3A 3WIAA 2VLRD 3AC0A 3BKCL 3GPEA 1YEFL 2X2UA 3RILA 3BWSA 3KJ4C 4M93B 2W94A 2BJML 3NSXA 4POYA 3EJSA 4S1DD 2N7AA 1S5IL 4LCUB 5G4OA 4GLRH 3VX0A 4HVBA 4LVHB 3GB7A 1A0QL 3HFML 5I8KL 3FUMA 4GRMA 4AZUA 4QOKA 5EU6A 1CFQB 3CN0A 2X6CA 3Q0HA 4ILDA 1F56A 4PJAA 4QF1B 3FF7A 3ROOA 1WTLA 3QJXA 5LAXA 3E6FB 2P80A 1VGKA 4DP4X 2FTAA 2QPSA 4XXCA 1ZGLP 2H8PB 3CFUA 2AK4E 2Z3FA 3N0PB 2UWEB 2VLKA 5EWIL 3REWA 1JN6A 1AQKH 2VTFA 1A6ZA 1KB3A 2GJ6B 1GZQB 3PWJA 5D1XD 1CGSH 3HN3A 3W0WA 4ZYKB 4FFZA 4JRWA 2JV6A 1R5WB 3ZR5A 4JRXD 4WJKB 3MROA 4NERA 1A6TA 4DEUA 1N18A 1SJEB 2VW4A 4GG8B 5CP3A 5F1IB 5HDWA 1T66D 2J21A 3NAAH 3U4AA 2DW5A 2CBMA 4NKMA 5E2TH 2N0KA 1GYCA 2NUPB 2DS4A 4NSKA 2UZPA 4HXAL 4BDVB 4NZFA 4X5XA 2OMTA 4AYFA 1V3JA 4PWGA 4ANUA 4JUTA 4ZMVA 2LLNA 3D06A 5KTEL 3OSVA 2B4CH 4J8RA 3PHQB 2XUWA 1QLRB 5HGAB 1VCAA 1FC2D 2YMOA 1CXKA 1P7KB 3EAKA 4F92B 2F8VA 4LAQH 4QRPA 5DC0A 3IWUA 3C60C 3BRFA 1IEHA 1P5VA 4OIBA 2DH3A 2IV9A 4AMWA 2CO3A 3NIFF 4I2XA 4G6KL 2Z1KA 3IJHA 1FNGA 1IAOB 1N6QH 5JQ6L 2BWQA 3LPFA 3G08B 4MMYB 2OXHB 5T3ZH 4HPYL 4L8BA 1T03H 1KEGH 2XZCH 4QY8A 3IU3B 4AG4H 4ZZKA 1P6WA 2IV8A 3F7YB 3N55A 4PGCA 5AAMA 5C0GA 2P8PB 5M94B 1CG9B 2WVVB 3NABH 1JVKA 4YHNA 5B7MA 3K8MA 3EH5B 2WXJA 2DL2A 3DXAB 3PY9A 4TV3A 1UUNA 2NSQA 5F1OB 2CSPA 3KPSE 4QRRD 5CHNA 5IM7B 4GRWE 4MS8C 3N1GC 4YDIL 5HJBA 1JS4A 3NFSH 5DU7A 5F89B 3SGEH 4PJGF 1RZIB 2FK9A 2D7PA 3GXDA 3L17A 1AI1H 1XCQA 1LK3L 2MCMA 3IE9A 3EJZD 3AU1B 3ARFD 2M2DA 4AYSA 4DTGH 1TQSA 2DAVA 2YN3A 2OZ4H 2YXFA 3TNMA 2R39A 5EO1A 1YEJH 3R19A 1MAJA 4JUSA 5AVQB 4BA8A 4BKLB 2K45A 1WIPA 1RJZA 3T08A 2HKFL 3P0VH 4AW7A 3BAXA 3FTVA 3K6FA 5C0DB 2HP4A 1IQDA 4ZUSB 2VR5A 3LYRA 2V8LA 3P73A 1ITBB 4X6EA 1WC7A 4GBXC 3FCUB 4J4PC 3KGSA 3WDJA 1V7ML 2X10A 1TQBB 1XVSA 4KTEH 3RWCA 4FD0A 2VDQH 3TYFA 2F1BA 5EU7C 4EIGB 2BVOA 1TG8A 1JNNL 4G5ZL 5BZWB 5LCVH 2A83B 2BNQA 4UM8B 4WI0A 3EO9H 2CJTA 3U1PA 5FA4A 1NGWA 5TF0A 3TCTA 4YAQB 1DJXA 1HHKA 5D70L 4KAQL 4K9EC 1H0DA 2W80C 3TT1L 4U0RB 3MFGB 1NUFA 2B4CC 2FR4A 5E99H 1KTDB 1MN4A 3MRJB 3MRBA 3PUCA 4XX1E 2Y1AA 3WN5C 2WLKA 5EORH 1MNNA 1KCVL 3QDGB 4NN7B 3QORC 4NUPA 2V3EA 1D5XA 4LLYA 3RPIB 3RWGB 3D39B 4OKDA 2B14A 1GIGH 1NBYA 4RNRB 1BQLH 1IAIM 3CLWA 4X5QA 1PFOA 3UG3A 4ALAH 5B8CA 1AQDB 4IEFB 3CWGA 3ECBB 5KVGH 3WNIA 5C0CB 3NIFB 1YEIL 2DEYX 5ESAB 4F24A 3ES6A 2OMYB 3VWJC 4JGNA 4MMZC 4QT5B 3SJVD 5IESH 3GSWA 3IFLH 5DHXB 4AKQA 1NAMB 1P5UB 1N6UA 3BYTA 2YQGA 1UZGA 2QQKL 4EBQL 4Z3JA 4UTBA 5D4QA 1RV6X 2MIZA 2JVUA 4LCYA 3E7JA 3S96A 4KH9A 4NQCD 1FG2B 3F6JA 4Z78A 1TQCB 3OL2A 2IOOA 1KLGA 2AJ3A 3BUYB 3TO4B 5DVMA 1MCLA 2R59A 5DD5L 2CLRA 5D1QE 4L1LA 3CU7A 3LNGA 4UIKH 1E5ZA 4LLMA 4RGNC 4Z0XA 5MEPA 3F64A 2GBTA 4Y9EA 3JUYA 2Z4QA 3BIKB 1NCOA 1WZMA 3ABGA 3KCPA 4PJGB 5DFVD 1MCSA 2B9BA 1P4LB 4KTDH 1SNRA 2DD8H 3BESR 3NDZE 4NRZA 5IOPB 3ARDA 3HEIB 5C7ZA 1FO0H 4GRWF 4ZS7H 4Z3HA 3KGRA 5E6IA 3GSQA 4MB1A 15C8L 2AANA 4R7XA 25C8L 3E0GA 3V0VB 5FGSA 3L81A 4LPWA 1MPAL 5HHPA 2AFNA 3QJTB 1JYWA 3PV6B 1E9PA 4N28A 1PS3A 1KXQE 2XWJB 5KBMA 3TVMB 2KMWA 3QIUA 3M17A 2GJ6D 2A9MH 2HJFA 4I0PA 2R2HB 3R1GH 4ZUUB 4FQIH 4YZWA 1UXWA 3DURA 3MLZL 1R4XA 1SN5A 2OL3A 4YHZL 3HMXH 3SDDC 1NC2B 1E7VA 3QPKA 1NBQA 2PCPA 4ODSH 5F0LB 1DVYA 1SN0A 3B2XA 1I3GL 4U3HA 1CT8B 3VQ2C 4LZKA 2BJMH 3LVEA 3IFNH 1EJ8A 3WHE0 3SDCA 3O3UN 1UEYA 4JM2C 1UJ3B 2I60L 2JQZA 1LWRA 1O7VA 4NO0A 5AKRA 4M7ZB 4HJ0D 4M7LL 3NCJL 4JO2L 3RVWC 3TH4T 5JIHA 1Y07A 4M61A 4ATWA 5T3XL 1XDQA 3CMOL 2DQIL 3D2TA 4MJIA 4E2OA 2NNXA 4YL4A 2MPAH 1MJ8L 3LB6C 3ZUCA 1MJ7L 1ZLWK 2JJTA 3INUL 1NCCL 5C1MB 4UB0L 3ZHNA 3N42F 4KKLD 4XAKE 4GKNA 3JV6A 4FFVD 3GUTB 1JGVL 1RZKC 1Y6NR 2PO6B 3DDFA 3X3FH 3QWQB 4RETB 3D05A 5SX4I 3PP3K 1HH9A 2XETA 1I1CA 2FT7A 4CA4A 1N0XL 2XKNB 2QVIA 2GK2A 3NTCH 3BFQG 1NBZB 1BVLB 1BD2A 1T4KB 1UM4H 4DEPC 2EEXA 3DXAD 2R29L 3L2MA 3GMMB 2I9TB 3CSYA 4JDEB 2AERT 4F3FB 1Q94B 3VRLE 4K3JL 3RE0A 1H3XA 4HIEB 2N1KA 2KPWA 1T1YA 1YMMA 2YBRB 5IJVA 3L4ZA 3L7FB 3B3BA 3DV6B 4L37B 4IJTA 1KELL 5GGVY 3D6GA 4UTAA 3IFPB 3WJJA 3WTUA 4PUBL 3CFCL 3RDTC 4X7DC 3QXVA 3PABA 4YVUA 1O5DT 1FF5A 4XXDA 3ZJAA 1U58A 1BMGA 2RBLA 4RFOH 3GSNH 5F7DB 5GPRA 4Y5VA 2BINA 4DP5X 2XNAB 1T83C 3RTLA 3AJ7A 1GAFH 4G6KH 3KPSB 3GKZA 4GRWB 2UXTA 3VE0B 3RTQB 4J2XA 2Y5QA 2GUOB 5KSUB 4K94H 4HPYH 1OAXH 1SYVA 2KH2B 3MREB 4HYTB 5KSAC 4P46C 1ZVSA 4L8SC 4POUB 1KC5L 3B1TA 3AG2B 1HSAA 1MRCL 3ULAB 4HX1A 4DSYA 4HJUA 5I5RA 1B4TA 3TU6A 1SUHA 3KLLA 1XGPB 2WBJA 3MUGB 1TQTA 2BERA 4DW2L 3WHXA 1XL6A 2HT4D 4U1JB 4E5XA 2R7EA 4P9HH 1R0AH 4LVEA 4HLZG 4QLRA 1A2YB 4ZOAA 5AW2B 2BZ7A 2NYYC 5AWNH 1G7LA 1KGJA 4LCIL 1BIIB 3N9GL 5LVEA 3A4DA 2Q8BL 4C8XA 5L0QC 3QQ3B 1DLHA 3QDGD 5HGGS 3BDYL 5HI5C 4O58H 1QASA 1I7ZB 3US1A 4NUJA 3PL6A 4OGXL 4HHWA 1Z5LA 5EO0A 1CLYL 3D39D 5ILTH 4GQQA 3CVHL 2KDYA 2H26B 4ABWA 4XOEA 4W81A 5AB1A 2IXQA 3PP3H 3QULA 5D1ZI 3NPSB 4AQEB 1NDTA 3D18A 1TO5A 1DDHB 3L54A 4N25A 3W3BA 1BYNA 3L48A 3SODB 3DVIA 5F7LB 1P69B 4GAFB 5C0CD 3N42B 1T5WA 3F01A 2QV2A 5AOIA 4XVJH 1V7MH 4Q9RL 4XN2A 5B38G 1ZV2A 1UG9A 2JI3A 3MA9H 3RWHB 2ICWJ 4XP1H 3OHXA 4UOW0 3MNDA 1HJBC 4G7YL 1JNNH 4G5ZH 4RFNB 4PJHE 4KPHL 2XN9A 2VN6A 4PJ7A 3TO4D 3R06A 5B3JE 4N2LA 1JXFA 4M8UA 3IAGC 1IFGA 4KAQH 2VDOB 5GGQH 1P84J 1Z9SB 5EC1A 2ADIA 5E5LA 2P3YA 2BSDA 5FWQA 5GRUL 1DBJL 3GJFA 3OB0K 1LMIA 4LFHD 2WC7A 1UWXH 3C87A 4JB9H 1JPSL 2VMEA 5AYTA 1KCVH 4WUUE 1CZ8L 1MDAA 4Y0GA 4TNGA 3SKNA 5HYIA 2KDGA 4X6FA 2Z0BA 3V4VL 1GJIA 3DVNA 3IXAB 3VRLF 4HIHA 2WMPB 2DWDB 2DWTA 4UV4L 4B97A 2IH9A 1SXCA 3UAJD 3NSJA 4ZNCD 1IAIH 3QDHA 3BN9C 4D0DA 1JXKA 1XAUA 5J4MA 5LKNA 4DO5A 3HS0C 2GY5A 1YEIH 3U0TA 3EG9A 4F7TB 3TVMD 2XQYK 4OF7A 5FK9A 4PBXA 2V6HA 4QDGA 2IDUA 1D5RA 3DHJA 1JPST 4HJJL 4F33B 5KVGL 1NOAA 3GBML 2C3WA 1B4JL 1EAOA 2QQKH 4EBQH 4E41E 3FQTA 1OTTD 1NC2D 1JZEA 4BZYA 5B7EA 3KS0J 1BFOB 3OAYK 4OI7A 2VM3A 1USQA 3IJEA 5FO7B 1ZLDA 1Q8MA 2DJMA 3V8CA 1U2CA 3MRIA 2ZOWA 2YLHA 4NP4H 4O51B 2XPGB 3MBEA 4Z7OE 4EDXB 3HN8A 1TNNA 3MZTA 5JPMB 4JREB 4PJ9A 1DUYA 1HT6A 2TRHA 3F7PC 5J89A 2J88L 4FG4A 4H8WL 3SOBH 1FIEA 3STLA 3G5XA 3HZ3A 3ZMNA 3LRSB 3MXVL 3NMEA 4RZKA 5DEFB 2ALWA 1CFBA 1XD0A 4HD9A 3JTSA 5E5MB 2LU7A 4DGYL 2XFXB 1ZK9A 3HG1A 5CD3A 4AQ8A 4FLOA 4I0CC 1AFVH 1E42A 1KFAH 2PO6D 3IBOA 5HSFA 3BPCA 1BG9A 1DVSA 3K3QA 4FP8L 5ITFB 4I18C 5TPWL 3IGAA 4R2GC 4YHZH 3SE9H 5EF0A 2ZXEB 3Q05A 3BN3B 2Y06L 4N6RA 3IJ8A 1LO3H 4UT9H 3SBWA 4NXKA 3QUYC 4HWZA 2DDQL 1N12A 3OWEA 4WI8A 1GMEA 2N1TE 3HG3A 1FPTL 5JO5A 5GJSL 4G1EB 2I60H 3CFKB 3MRRB 4RX4A 4NT6B 4M7LH 4R0LA 3NCJH 4CGTA 2FUTA 2TSBA 3U6XA 1YQ2A 4L5FH 1IAKB 2W0FB 4XB3A 3CMOH 3GHPA 2PR9A 2DY2A 4PJHF 4YO0A 1GZHA 3IU4L 3OSKA 1MJ7H 2BHYA 1HOEA 1A9VA 3INUH 2P7TB 3VWKC 4Y4KB 1PCSA 1VKXA 3IETB 4TVPH 5B3JF 5HHNA 1M7IA 3KPSD 4Z8FL 4ETQA 1X5JA 1EO8L 3H4FA 4TNFA 3RTQD 2OMZA 4S2SB 1G5GA 1MI5B 2XIBA 1QHQA 1GYWA 5CIPA 1F4WL 4DKDC 2OQJA 4JKKA 4MDRA 4Y4FC 1JTTA 3OAYH 2BP5M 1BX2B 2CPCA 2ZXDA 1L9NA 3TV3H 4JGUA 3VNYA 1NMCB 3SDAC 2ZKXA 5AW7B 4IBZA 1MKFA 4F5CE 5FYKL 2WZ6A 3FHAA 4XP9L 3BMVA 2ED9A 4EI0A 2ODIA 5AD0A 2WV3A 3N85L 3APDA 4F9LA 4N9GB 1KELH 3JTTA 5JR1L 2VKWA 1XH0A 1JV5B 4G9FA 4NM8L 3ZPDA 3U2SB 4HUMB 4X8XA 3MRFA 3TBBA 3B9AA 4JANA 4FQCL 3STZA 1G7HB 3H2WA 4WJ5A 5HGHA 3JXAA 5ICXB 2EC8A 4TNEA 2OSLA 4UCFA 5LGKA 1F1GA 4LL9A 1ZV9A 3GI9H 2Q86A 3LQZB 5I8EA 4HOWA 1AKJA 4UINL 1QFWH 3ME0A 2X88A 5DRZA 3BFOA 4YHML 4XZUB 5DYOB 1J0KA 1KDJA 1CL7H 2OYLA 4Z7OF 4APQC 4ISVB 4PGJA 2EEBA 5KAQF 1FYTE 1KC5H 3EYUL 1MRCH 2F8OA 3KPPB 3LNHA 3CQQA 1VRSA 1WFJA 4PG9A 4Z76B 4M1GL 5FYLL 4Y89A 5I8OH 3BFWA 3MRPB 5DHYB 4BV1A 1MQKL 1SOKA 2F54E 4OT1L 1EJOL 1RCYA 1SXZA 2ESVA 3MO1A 4IGBC 1XV8A 2FO8A 1AGBB 3MLUL 1EDYA 1J11A 4LOUC 2PP8A 5B1KA 3FTGB 1THAA 5BOJA 3QEGH 3ALWA 1EEYB 2ZWKA 4LCIH 2HRPL 4NRYB 3N9GH 2P5EA 3SE4C 3L95A 1QEWB 3KPRE 1VZIA 2F58L 3KYKL 1KCUL 3QARA 2JCCA 3O8XA 2V3DA 3WIFA 3CBRA 1CPUA 2CUIA 1CLYH 3HE7C 1TZGL 5I73B 4W70A 3BZEB 3CVHH 4XWGL 2DMBA 4U1SB 1BQSA 5ACLA 1UTDA 4O02H 2BH0A 4PJHB 2GJZB 4PJAE 5K9OA 3O0RL 3LKPB 4F8QA 1ED3B 2G9KA 3L16A 3FU0A 5E24E 1CS6A 2FB4L 2WBWB 1JGDA 2D7MA 2LU4A 1EGJL 4EOWL 5AW8B 1T7ZA 2F0CA 2VLKE 2YKKA 1MWAH 1BPVA 5I66A 5ID1A 2EE2A 1I8MB 4YHOL 4YXKL 2VRKA 3W0WE 2B8OT 5FW8A 2VQTA 5C0JB 2CUAA 1X9UA 3VACA 2FBOJ 4PRPE 1M6OB 2XWEA 4APXB 4NO5B 4W6XB 5DEJA 1U0QA 2CGRH 2LGNA 3MRCB 4GAYA 5LAPA 1ZT1B 3ATAA 3RURA 5H94A 2IALA 2J1WA 3T04D 1A4JA 3UTZA 1D9KB 1GGBH 2NY6C 4HKBA 2CRIA 4V1DA 1FZMB 3N1MC 43C9B 2LT9A 4WO4C 2RAMA 1CZ8H 2ITEA 1FVDA 4W9KC 4UBDD 4Q0XH 1MW1A 1NIAA 4X6BB 2CDFB 1I3RA 4E41B 4JFXB 4DGUA 4Y16C 4XP6L 2CK0H 1NEUA 2XY2A 2D31A 2ICWA 1WWCA 2CIKB 3MCG1 4D3CL 5C8JB 3IVKA 2ITDB 4QRPE 4L9DA 1L7TH 4XMZA 4UQ3B 4QXUH 3ZKND 5CEZE 4QHMA 1OT2A 5DO2C 4PTTB 3RJOA 1MVUB 4YPJA 4I2XE 5DD1L 2YA1A 3Q13A 4U7MA 5HYSB 3JWNE 1E90A 5ANMA 1SJHA 5FUOL 4Z7OB 1C8QA 4RAVA 3GBMH 3F6LA 2PNDA 4KJQD 5IUSA 5MI0C 4LNVA 1L4IA 4FNUA 1DQKA 3KPNB 4HJ1A 5JXEA 1GKEA 4JCWA 4JY6A 4MXQC 3TZVB 1R34A 1V54B 1KYFA 4NI3A 4J39A 2X6BA 4X7FC 4KMTH 1MZYA 1HH6B 1T7VA 2P28B 1Z9NA 3A4EA 1NM4A 5AG8A 5BUGA 5C70A 1WCBA 2H45A 3SEPA 4HIIB 3BZDA 2RGSA 4QRUA 2YD7A 1E4XI 2KBGA 2CD0A 4OVUA 3C5SB 1S9VA 3IDGA 5E94A 4NGHL 3TCXA 3BP4A 2BIQA 4PS4H 1AC0A 5E4IA 3WL9A 1JSYA 2FNBA 2J88H 3AITA 3QO0A 2VQUA 3OB8A 3IWVA 5CS7A 3VI4A 1ZHLB 2GYSA 1RUAH 3HZKB 3CCHA 5T33H 3HUJA 5DJ6B 4XT1C 5AAWA 1E3XA 1UENA 2JELH 4CADB 1K4DB 3GMRB 4MZ2A 4Y4KD 1BPLB 3OKMB 4FG6D 2ZWLT 3FUKA 5E6SB 3VG9C 4IMLB 4DGYH 1XF5A 3SGKC 1KN4L 5IHZB 4Z0BL 2FBRA 3BAWA 5FF6B 3U7YH 1MI5D 4PJCE 1RLBA 1JPTH 4KFZC 3ESVF 5EBWA 4KROB 4NO3A 4FP8H 1J10A 1F58L 3RZWA 4EUPB 4W9DC 4XNUL 2AQPA 2ZUVA 3LEYL 2PETA 1WQVT 4M6OH 4W4OA 4DFHA 4Q52A 1OQXA 2PWGA 3COOA 3O2DL 4MJ6A 4YXLL 4PJAF 4XNDA 4MD4A 1E28B 3WKMH 1DP0A 5AAPA 5INCB 1CK0L 5E1HB 1FPTH 1KBVA 1BDYA 4NCC2 1U3YA 1XMEB 4WWID 3R8BB 3VFPB 3C6LC 1GGTA 1GR7A 5BQ7B 3G5YB 5C6TL 3DMMB 4MZ3A 3GDCA 3V6FB 1MXGA 2GABA 2WSPA 3BW9B 1KUMA 4JG1L 4YQXH 5KYXA 4GW1A 3GRWH 4BK5A 4JG0H 3FQUB 4NWTH 2ZICA 2IQAA 4JQXC 3I6GA 1AOZA 5F71A 2H2SD 1E4WL 4P04A 2WO4A 4GRLA 4BINA 5CJXA 3H9ZA 3HB3C 4Z8FH 5IROA 2BRRH 4CUCA 4R3SB 4FQXA 2ZYSA 4C57C 2L7JA 5H37G 4UQAA 4ZQKA 1F4WH 2CHDA 4KRPD 4P5MA 4F7CA 4HULB 1HQ4A 1YRKA 1P4IL 4H13C 3FU8A 3SDXA 4PJ6A 5EUOA 3SGDI 3FO9A 2QMKA 1NJ9A 4BZ2A 5L88H 3OQ3B 4S1SL 1TVHB 4BQ8A 1A4CA 1I1FA 4IOSA 1EXUB 1R24B 1XWVA 5FYKH 2AEQL 4B7IA 1PTZA 3B9DA 3EFDL 1PZ3A 1U8LA 1EJFA 3VB9A 4AUUA 1J0HA 3TM6A 3HC4L 3Q5TA 5MEOA 2DMGA 3GHEH 3LAFA 2WTPA 3QQ4B 4G8FA 1HQRA 1SZNA 1ZRUA 2YFOA 3H56A 2HN7B 3DJTA 4UDUA 2HLAA 4H1LB 1PQZA 2G4EA 1OP5H 1FYTB 3VMPA 2CXKA 1PSKH 4PM1A 5D2LA 2B0SL 2DLGA 3NZ8A 2XU9A 4H8WC 4IIZA 1CVSC 4CJ1A 3FT3A 5B3SB 5E9DA 4G3YH 5ADOL 4MB4A 3WJMB 4YSCA 1WPCA 3V5HB 4LDEB 3QEQA 5AKSA 4FQ1L 4F2EA 2F54B 4YHMH 2V2XB 3OM3B 3DX1A 1TOXA 2OR8A 3BH8A 3MV7D 3QZWG 1RY7B 2EECA 4NI6A 1L6PA 3AS2A 2PPCA 5KVFH 2ZSWA 5C0BE 4PR5B 4Y5YC 5TH2A 1A1NA 2XN0A 3ARRA 4PWKA 1F3DJ 4IM8A 2J8UA 4CSSA 2IPUK 1UH2A 2WAQA 4D9LH 4LSRH 5B38A 1CGWA 5BV7L 3KPRB 1CLZL 1ET8A 4J3XA 3FO0H 2EO1A 1ADWA 2W9EH 1T20A 4M1GH 1X5GA 2FO4B 4QTFA 5FYLH 3GB7B 3UJTL 2ZKYA 3BIBX 4XODA 2DMKA 4ZNEA 3CNKA 1UD5A 1EHLL 2EIMB 4OCYL 5C9JA 4A2DA 1QRNE 4PJAB 4QMEA 3ROOB 4PJCF 5LAXB 5LNEA 3KPQA 3SO3C 4BFRA 2AV7A 4N3UA 3BZFA 1GHFL 2J1XA 3A67L 2F7PA 2FGWH 1D9KD 2FQFA 4G7VH 3MMEA 4DQOL 1N19A 1Z5HA 1B3IA 3IN0A 2F58H 2AEWA 1A6ZB 3KNBA 3S2CA 1QSZA 1WSST 3N1FC 4M03A 2BSTA 2QVFB 4PCYA 1ZLSH 3TFKC 4ZZFA 3D4CA 1J0IA 1HXYA 3DLQR 3X1BA 4E41D 1FDLL 2OMBA 5F6HI 4AT6A 2DQEH 4O2FB 4PRPB 5I1JH 4FG0A 4K8RD 1JE6A 4CAGA 3CC5A 4HJSA 3WO4C 3TYGL 1J48A 1BIHA 1AHKA 4NKMB 5E51A 4XNMB 2XX0A 3FRUA 4EOWH 2ED8A 4NSKB 3J8F7 4HGWA 5LGJA 4HJGB 4OFDA 3OR7B 2JKTM 2BSSB 2C9QA 3VQ1C 2XBDA 3P4MA 1UA6L 2A2QT 4JY5L 4N5ED 4HK0A 1AY1L 3UBGA 4J8RB 4A7UA 3P54A 3ROLB 5I1HL 3TZVD 1NSNL 2O6FA 4GO8A 2BMKA 5F1NB 1BD2E 4OD3L 2K70A 1NLDL 3CFEB 1DQLL 3FQXA 3P2BA 4Y19A 3QS2A 3U2IA 1NTDA 3CUPA 4GMSH 4NHUA 2VL5A 5HD8D 2JSFA 2F7RA 3OPUA 1PVHA 8PAZA 4N26A 4W6YB 4TSBL 4R7NB 3T0VA 2RD0A 3IJHB 3TJEL 4PPTA 1FNGB 2P24A 2X09A 3GSUA 3A0OA 1ETZB 4DQAA 4W6WB 3J7HA 2GEEA 2H32A 4XP6H 2PR4L 2XG5A 1LTXA 4PGCB 1C5BL 4D3CH 1CXHA 3S3JA 5C0GB 5C7XL 4N2MA 3RI5K 1GGIL 2FL5B 2NY3C 2YGNA 1BZDA 5DD1H 4NWUL 3QZPA 2OJ1A 5CHNB 3TWYA 3T6WA 2VRAA 4KROD 2C1PA 2VSCA 1F97A 5MP6H 6FABL 5CILL 4ETYA 4YHLH 3X12A 2HTKC 3V0HA 4IHOA 4FHBD 2A6DA 5F7FA 1AO7A 1Z6JT 2Z31B 1QFOA 5SV3A 1A7PL 4HCIA 1S9WA 4ADJA 5FFGA 5C08E 2V2TA 1KTLB 2X4SA 4Z7WA 5CLZA 4TQ8A 1OHQA 4FYTA 3BQUB 5EZLA 2K9UA 1RJZB 3HA0A 3DMMD 1CFVL 1NGXA 2YD1A 4WHYG 3S5LG 4NGHH 4MQXC 4PJCB 4OLYL 3LXUX 2EJ1A 1T5XA 1W72L 1BLIA 4P5KB 3GMOA 4L3CA 3VGFA 1ZTXH 5MEQB 2Z93A 3P73B 4IRJB 2QKIC 4H8VA 4C56A 4BQ9A 2A74C 2OTWA 3PFUA 3EO1A 1X5FA 4HV8A 4ONGL 3QHFH 4R7DA 3EHBC 4KK9C 1S7RB 4FFYA 2VZOA 3RWCB 4O2EA 4Q6IC 4JVPA 4Z0BH 3STBA 3BUPA 1F6FB 2OV0A 3CH8A 3DDGA 3HNVL 2W59A 5JPNB 5DRNA 1F58H 3ZT6A 2AXWA 5CGTA 4XNUH 5FA4B 1NGWB 5D4IA 1BJ1J 1I8AA 1ADQH 1HHKB 5CEXA 1UEMA 4YXLH 3O2DH 4XRCB 3WFHA 1J12A 4UV7L 1MF2H 5F3FA 3HKFA 1FLTX 3O45A 2WINB 4ORGB 2ERJC 1NBCA 3TBYA 2Q2LA 3UYPB 1CDBA 4HCRA 1H6UA 2X3BA 2X6VA 1F4XL 2BVPA 5IWLA 1EEQA 2XN9E 4BWWA 3I85A 4FLRA 4AIOA 1J9QA 5B8CB 3FSZA 4MVBD 1KCRH 1FYTD 4P57A 1QFUL 4KOBA 3POHA 3ES6B 3DGDA 1OANA 5CO1A 5CMAB 5CLWA 1E4WH 2FEDC 3FC8A 5TQ0L 5A2FA 3DX9A 2VXVH 3MLWH 4F9PC 4XVOA 5DLLA 4CVZA 1H3UA 4QHKJ 3S96B 2NNAA 4HUNB 5IBTH 3RB7A 3FT2A 3DO4A 5EOCH 1UGKA 2X6UA 2DYPB 4NQQA 1P4IH 4OZIA 3QIBC 5GS0C 3QUHA 3N1PC 3ARWA 2BXYA 5LDSA 4AQ1C 3ISYA 3I9GH 1IU1A 2ISDA 4AEIH 4WFFE 4HSQA 1OAKL 3C2AH 2PP9A 4Z0XB 3KPRD 5MEPB 3QZMA 2V2WB 4MS6A 1U92B 4POZC 2Z4QB 4KMLB 4F37K 3PNRB 2AEQH 1NFAA 3EFDH 2D0GA 1P4UA 4NRZB 1SVZA 1ACXA 5TK4A 2ZOUA 4Y7OC 1HXKA 4Z5RB 5E6IB 3GSQB 2G0LA 3AVEA 2BY0A 5AALA 2CCWA 1X6NA 2A9CA 5C0BB 5HHPB 1M56B 4NUGH 1TPXB 2NNRA 3EYQC 3SY0B 4OU3A 4RRPM 2XXGA 3PP4H 3QIUB 2NY0C 4P3WA 1Q1JL 5I1GH 3RRQA 5ADOH 2E8YA 5CFHA 4KI1A 3DURB 3KXFA 1OQOA 1EQWA 2OM5A 1AGDA 3FO2A 1JGEA 1BZOA 2OL3B 2JI1A 3GBNH 4FQ1H 4PRPD 2AJVL 4K7PL 3GSXB 4WGKA 3VXNA 1QRNB 1LM8V 1IKOP 4FTVA 1RZGA 3RNKB 2PCPB 4LGRB 4HAFA 4QJ3B 3V6OC 2COVD 3HE6A 4RMUA 1KIQB 4X6CE 1IILE 3SDCB 4ANXA 4LEEA 4F8LA 5GXBB 2R1XA 3UROR 4U1IB 1KACB 2WVTA 5B1BB 2DTSA 1DBAL 5E8EA 2XV0A 1P4BL 1AD0A 5DHVH 5K9JH 1EHLH 6CGTA 3HZYA 4H20H 1K4CA 4AIZA 4OGAC 1T1WA 3TO2A 3PGFL 1GHFH 5TF1L 5CEZD 2Q8AH 5DMKB 2DQJH 5I1EH 1PZSA 2DLFL 1NMAH 4XVSL 2E47A 1S6NA 4GKNB 4LVOB 4ODXA 3VGAB 3BZ4B 4DQOH 3WFCL 4QD2E 2AQ3A 3P9LA 1A6UL 4ZMZA 4YSUA 4GBXA 1FDLH 4J4PA 3AZUA 3BUBA 3UJIL 1IKNA 3KR3H 4X98A 5FYJL 1MW2A 1Z7JA 1BD2B 2LVEA 1U3JA 3HLAB 2AGJL 5JLZB 3K80A 1M3JA 5TE6H 4JO1L 5HGBA 4X5WA 4FRWA 4L8CA 1QAWA 2CJSA 2NY4C 3TJHC 1S7TA 3KLAA 5FUCE 1T1YB 3QO1A 4JY5H 3MLXL 4YDLB 2HTLC 4GW5A 2A1WH 2ED7A 4WW2A 4XMUA 1YY9D 1URIA 4F7KA 1NAMH 5I1HH 2NY1B 4IOIA 1NSNH 2J2ZB 1BSIA 3CPLA 4XI5D 4FQHB 2Z31D 1F86A 1DQLH 3GXPA 5DQDL 4XXDB 1U58B 3QORA 4WNQB 1F11B 4WSJA 3GPSA 3FUIA 3GZPA 5D5ME 4TSBH 2XQYG 2O61A 3BQUD 2ZD0A 3H85A 3QXTA 4TUKL 3TJEH 4QTHB 2Z9TA 4N0CC 1N10A 3H7LA 3SPVA 1QSFA 2NMSA 3VWJA 2WLYA 1VZHA 3S88L 4PV8B 4IRJD 4G9FE 3IPEA 4MMZA 1C5BH 1ICTA 3WIHL 5C0ND 3WV0A 4TNVF 4AJYV 5I0ZA 2HJLB 4N86A 1IC4H 4NDMA 2WWOA 1XBDA 5F21B 1ACYL 5CAYB 3TX4A 5GZOC 5C08B 4IIQC 2FYVA 4OV6F 1NIEA 1BYOA 4E5XB 6FABH 4GT7A 3MGOA 3VGGA 4ZOBA 2VZUA 1NANI 2WM0A 3TNNB 5BV7C 2K4AA 1DVFB 1G4MA 2NR6D 3ARQA 4JS7A 2WYZA 1CF1A 4BSJA 4C4KO 3ILPA 4OKVA 1DLHB 4KKBC 3LXCA 2A0LC 1NUGA 2CO6B 3PL6B 5EO0B 5EF3A 2ENQA 4HHAA 1CFVH 3O3BA 5F9JA 1I9IL 4LPYA 4X6CF 1EXHA 4ZOEA 1B6UA 2IXQB 3QULB 3OMAB 5ECJE 5BVPH 3D18B 5E2VH 3S35X 1FFNA 3MAWA 3I50L 5LXVA 2R23B 4WV1C 3W37A 5E8OA 2WXIA 4CC1A 2P5EE 5DJZA 2BK8A 1AIFB 4ONGH 5KOVC 5CR8A 5LN8A 3MKKA 2J6EA 3DUHA 2NSXA 1RUML 1T0MB 2EUXA 1SJMA 4UQ9A 4M4RA 1I7UB 1G9NL 4W9IC 4JE4B 3IDJA 2ILLA 2J56A 4TSCL 4U1HA 3HNVH 1Q9WA 3E2HC 3VYOA 3S0PA 3VB8A 2QV4A 1WK0A 2A6JA 4IBWA 5H37A 3GIVA 4PU2A 1MW0A 2DYPD 3I6LE 3THMH 3R06B 4U2ZA 1N67A 1XFPA 2HRGA 3N3EA 4NOBA 3ARZA 4JM2A 2VN7A 7CGTA 4M56A 2KL6A 1SDDA 4RGMB 2ADIB 2WQSA 5J11B 1WIOA 3GJFB 1SM3H 1QVOA 4UV7H 1N2RA 3AS0A 1LQSR 1R3HA 2O5NA 4WY7L 1N0LA 5C09A 3WTTA 2Z7UA 4JHWL 4I48A 3D25A 1JHLL 3HHMA 1XSIA 4MSWA 3UP6A 1OTUD 1YSOA 5E6ID 1IL1A 2D2CC 3L3DB 1IBGL 3C09C 5C0BD 1S8DA 4XVUC 1IV8A 3OPZL 5L2JA 1QFUH 1KEMH 1JF5A 1TU2A 3EG9B 3U0TB 4ZMPA 5IMOB 4OY9A 3QIUD 2BDNH 4V1DE 4XMPL 3OXSA 4I89A 2XVGA 2IWKA 3AROA 3OJDB 4PLNC 4JLRB 1UA7A 4ELDA 1X9QA 1IC7L 1NFIB 2WKLA 3HZVB 1M2VA 1UJTA 2WSDA 5D5MF 1JGUL 1TTGA 1LO0H 3FZUC 1QTSA 2C3GA 6PAZA 3QCVL 1J9TA 4GRWH 1QRND 3QZWA 1H8LA 1J05A 2YAFA 4MWFA 3V5KA 5DQ9A 2OMVA 2WNXA 5IW6B 3IJEB 3VFMA 3H42H 1A3LL 2GVYA 3MRIB 3CAFA 3IMTA 5E2WH 3W9DA 1MEXL 5JMRA 5IHUH 2N56A 3MBEB 2N7BA 3NN8A 5KW9L 2K7QA 1C08B 1W0VA 3HBPA 4MCMA 5IMMA 3IRCA 4BD4A 1W80A 2VJ0A 3GSVB 3CLFL 4F8OA 3DOHA 2XDHA 3ARYA 1KIUA 1OL0A 2FEEI 5F93C 1A5FL 4I88A 2WTRA 5CCKL 4P2OC 5FM5M 2VYRE 1T83A 2HT3D 3MC0A 4BELD 1NWOA 2WZPA 3CSGA 5DZNA 5CM1A 1IFHH 1KGCE 5L9DH 5HY9A 3EJYD 3MVSA 4D2NA 1QZ1A 4B5EA 3LZFH 3KPLB 4LLDB 5CD3B 4X6CB 3MN8A 3RWIA 1Q1JH 5EDSA 1SHXA 2V9QA 4OQ1A 5JA9A 4HA1A 1PG7X 3T8VA 4P46A 4F15B 1CF8L 1RXLA 4UOQA 3IGAB 3VI4E 3Q8CA 4ENZA 1HAWA 1RERA 1ES0A 2YSTA 3ARPA 1JJUA 2I07B 4NKDA 1BD2D 2E27L 4PP2A 1KLUB 4KK8C 4YDZA 5DJ2B 1JYNA 4L2YA 4TQPA 4HWZB 2P8MB 1XF3A 3OGCA 4Z7VA 3MX0A 5EA0L 1BQ5A 2EDNA 4LSPH 5CUSL 4PVBA 5JOPD 3CXDL 1Z9PA 3VQLA 4QRSA 2YQ3A 4TQEL 1BGXH 1P4BH 3VXTA 2NY1D 5I1DA 1RZ8A 1NM9A 4QWWD 4WJG3 1Q0XL 4MD0B 2JQMA 2UUDK 3F5WA 1C7TA 1HL4A 5ACZA 4FZ8L 3UACA 1QO3A 1XIWC 4XVSH 4YBLB 5F9WB 1HZLA 5I8CA 4CRPA 5KUMA 4IKJA 1SGKA 3BSZL 4XNZB 3GXMA 1E4XL 5DJDA 1BAWA 5CIPB 5JW4Q 3UJIH 3O9WC 1I7TA 4RLDA 1A7RH 2PYFA 3QI9A 1RSFA 4XMWA 1MAKA 2WQWA 2Q3AA 2AGJH 3RVVC 1T2JA 1D7DA 4N8UA 4EZKA 5C08D 2ZUTA 5D5MB 3P30L 3SE3C 3WE6B 4OCMC 1C5DA 2WGXA 4AKOA 1F1DA 3GMNB 1BECA 3GIZL 2B16A 4YDJA 5DZOA 5D1ZC 4Q9QH 5I6XB 3MLXH 4JPQA 2FT6A 4Q6KA 3FB7A 3JTTB 3MRNB 3OC5A 2QFPA 3SDXE 4BUHA 2Y2TA 1MUJA 1DVFD 4MNGA 1LEKA 4G9FB 1S7QB 2HLFD 4H2AA 1IBDA 3Q01A 4WJ5B 5G2NA 5HGHB 2VC2L 4XMXA 2B1HH 3RBSA 4L29B 4B9IA 2HMIC 3U30C 3Q6GH 4DF9A 1VENA 1DVQA 1VHPA 3HR6A 4XP5H 3CBJB 3S5LA 1E4KA 3LQAH 5DRZB 2VMFA 3CXHK 4NZRL 4TKWA 3I2CL 1INEH 3V10A 3HS0A 4TSAL 4GT0A 1AXSB 2MQ0A 3RX9A 1YNTF 4OZHA 1K3IA 1CGYA 2BHFA 5J9PB 2UXGA 4OIIL 5D2LE 2ICEC 1KENL 2FZ3B 1JNLH 3G5ZA 5LBGA 1VPOL 1ZDSA 2UZXA 2EC9T 1ACYH 3APMA 2X4TA 2E76C 5F88B 2QZQA 3RGHA 2G9HA 1LVEA 1A7QH 2YGQA 4FC3E 4FFWD 4JDZA 4Y88A 3DETC 1WZAA 1L9MA 5EULV 3WTXA 4NC1C 3EOTH 2BRQA 2W65A 4J27A 4GI9A 2QHRH 4ZTEA 3GJEA 1P1ZA 2BS8A 1NICA 1X5AA 3HAEH 3EBIA 4ZDHA 4YC2B 4AUJA 3VI4F 2UUDH 4QHUB 3RVTD 2P5EB 2G5RA 3BVNB 3EFFA 4LKCA 2HG0A 4YLBA 4DUXA 1U8CA 2VR8A 3DECA 3P69A 3ULUE 4ZAKA 4OZ4A 1KPRB 3VH8B 4S0HA 3O8XB 2Y24A 4H26A 4MNHB 1N8ZA 3FU9A 1CDIA 4ZNEE 2NQCA 5HP5A 1I9IH 4FLSA 3QNFA 1ND0A 1UXMA 4BFFA 1E5BA 1SJXA 2A9NL 2QQNH 2QPDB 4P23C 5K9OB 1TETL 5TE7L 4TQIA 4D94A 3E8UL 4LRIC 3G9VA 1JGDB 3CMGA 2IDTA 3ARGA 4WFFD 4XPBL 1NCTA 5D7SH 3ZMRA 3KL0A 4I18A 4N2KA 5ID1B 1IKFH 3BAJA 4YDMA 4JR9L 1EHXA 1NZRA 4J3BA 3ZVVA 4K3DH 4R96B 5DMJB 2YSSB 4U4IA 2CHWA 4HZLA 2R4RL 1DL7L 5DYFA 4FXGB 3UJJL 4GAYB 3CFJB 5DJXB 1SMDA 2UV3A 1IM3A 1I8LC 2QSCL 3IMUA 1G6RL 3VXRA 2IALB 4FHJA 1A4JB 3FT1A 3UTZB 1AH1A 2EDHA 3TA3C 5D96C 2W60B 4V1DB 3BXNA 3MBED 5E95B 4WY7H 5B39G 2Y0SA 3LDBC 4JHWH 4FX5A 2X70B 3T0XA 4BFEA 3V0GA 4E9YA 1J8RA 3HR5A 1I3RB 1YQVL 1XCWA 2KQNA 2BOCB 2I5YH 2Y69B 3VWKA 4LMQI 4QLWA 2ICWB 5B7FA 3QQ9C 2WWKT 3IVKB 4Z77B 3UTSE 5IFJA 3VU1A 5GGTH 5GS3A 4NQEA 5D7JC 3QEHA 3SDXF 2YD6A 2R4SL 3CH1B 3KMDA 3T8XA 1J0YA 1X5IA 3L6FA 3ECQA 2F53A 5DD6B 3VSUA 1NFDA 2H1LM 3RGVA 4A37A 5FUZL 4BHUA 4Y4FA 4RAVB 3VU2A 1VA9A 1YNTB 4JY6B 1QI3A 3UMNA 1LILA 4JK0D 3EKCA 4FTDA 2XX1A 1NDGA 4QXGH 5DT1L 5JYMA 1SXAA 4GNKB 1YEHH 1DVZA 1VDGA 3BE1L 3CHXA 2IWEA 3MJ6A 4OLZH 5J56B 1WCBB 3AACA 2O93L 2EDKA 1A3LH 2WLLB 4P2AA 3TOPA 3DIFA 1ETB1 3K72A 5L7XL 3BVUA 1S9VB 3ZYIA 2TSAA 5B3NA 5E94B 1JFQH 1ZDQA 1YLBB 2HCZX 3K6DA 7TAAA 1UB5A 5I0VA 3FH7A 3BVTA 4KRLB 3VI4B 1F18A 1OCWH 2J6WA 3MRMA 2DWEB 3PXLA 1LO4L 5CSGA 1YZZA 4AEFA 4UM9B 1AO7E 4TVSa 4AVKA 1GSMA 1D7CA 2WY3B 4MLIA 4YIQA 3KVQA 3VDBA 2XQ0A 4GG6A 4HALA 1U91A 3MQIA 2Y6SC 4MRBA 2F6AA 4D7PA 1I9JL 4Z7WE 1XF5B 1DJZA 1P6AB 2AXJA 2W1NA 3FOMB 4JRFA 5AKTA 2QGEA 2FSDA 1EHKB 1N64L 5DHEA 4NNXA 4NO3B 1RKRA 3ULUF 3E9UA 2D9CA 2NSMA 2YN5A 5KYYB 2K0RA 4OF8A 4QO1A 4OFQA 5KYUA 3QIWC 2WLMA 5MHSD 1T1ZA 5JOFA 5JDSB 2E27H 5ERWA 4JM0A 4MJ6B 4QAMB 1G9NC 4GSUA 2IAMC 3OAZK 4MD4B 3QXDA 5FECA 5CEYA 2DLTA 3CSBA 2Y7MA 1NCBL 4K07A 5EA0H 3U4BH 5DJCA 5ES4B 4G8GE 4JRYA 5CUSH 5JIQA 2ZX8A 4J6RH 1A7BA 3T0EB 1II4E 3AREC 1U3ZA 3LIZL 3HN5A 4OJFH 4TQEH 4HMEA 5KYXB 3DSFH 3BPNB 4R4BA 3S7GA 4G9FD 4WNJA 5BRPA 5IMKB 5IBLC 3K71A 1TQWA 1Q0XH 1MLBA 4IU2A 2IQAB 4AXWB 3I6GB 1U93A 4PRHB 5CINL 3HE7A 1ZSHA 2FT8A 3GMLB 4RAHA 3WYRA 1JWUB 32C2B 4LIQE 5AYUL 3ZDXE 2XQYA 3L5HA 5L4IA 2EDEA 3MACL 4FQXB 3FOLA 3WS3B 4DNLA 2XTSA 1UD8A 3BSZH 4HEME 3O6LL 5EIIG 2XFGB 3CFNA 4JKPH 1RUPH 4ZQKB 4M5YH 4P5MB 1HQ4B 3F8UB 3SDXB 3WTVA 5J6SA 4H8PA 5TDOA 1A9EA 5IP4A 1NJ9B 3MXWH 1O9VA 5F6IB 5BS0A 2HG5B 4K8RH 4DN4L 3HVNA 3FFCA 1I1FB 4Y5XB 2R29A 4I5BB 5A6MA 1LE5A 1QBBA 4EAEA 2X1PA 1TSHA 1U8LB 1UADC 5D7HA 1Z9LA 1WZ1L 2YOCA 4G6ML 3GTVA 4ZUTA 3RQ3A 5MEOB 5SWSE 4BEIA 4G8FB 4RH4A 1PCXA 4NBYB 2VR9A 2VWEC 4UDUB 4YNYA 4X4ME 4P5TC 3FUEA 1PQZB 2Y7QA 4OZIE 4WO4A 2DBJA 2X4OA 3C08L 4YUEL 2P5ED 4FEIA 2AVGA 3NZ8B 3QJUB 2VC2H 4ERSL 5BMFL 1IFRA 4DT2A 3O8XD 4PY8I 3FT3B 2NT1A 5DGRA 3RKPA 3M1OA 4MMXC 3MRHA 1MNUL 4MYPA 3RZCB 4E0RA 4OZGA 5MERB 1KDIA 2D3VA 2EEDA 2H3XC 3L5WB 2YD3A 3S35L 1YECL 3I6LD 4TSAH 2EH7L 2NTFA 3WY2A 3MNZA 1ZWIA 2ZSWB 5BO1L 3NEXA 5ECGA 5E8PA 1A1NB 2CWRA 2J5LC 5JR1H 5LG6A 1FFPA 1NCAL 2A77L 4MJHA 1KENH 2EICA 2FSEB 3MUJA 1JL8A 3L3JA 3ZDYB 3WTYA 5D7LA 3S34L 5CJOL 3U9UB 3U83A 3WKNA 2IGLA 1CTNA 2IF7A 3QJQB 3GS4A 2EDDA 2WSKA 1EBAA 4JW3A 4K7FA 1R5VA 3KXFE 3NCBB 5ISZA 4XBPA 5I28A 3L9YA 1S9YB 4XMKL 4AY0A 4Z7WF 3RNQB 3X13A 3BUQA 5EEUA 1E40A 4IRSC 2G2RA 3KPQB 3D2UB 1MH5A 2PP7A 1YDPB 1DQQB 5I18L 2CR3A 2O30A 2P52A 1WG3A 3IXTA 3LPGA 3NSYA 3DX6A 5LGHL 2EXSA 3MMEB 2VXQH 4GAJL 1ZY9A 3NQKA 4OFKA 4V1DD 1E6JL 2EADA 4KI5E 2YAEA 3KNBB 4P59H 3SGDH 5FGRA 4CMMA 1E9OA 4ZXBC 3L3GA 5FGCE 1I4FA 2YZ8A 3S4SG 2Y4SA 3W38A 4Y9GA 3KLDA 3CC5B 2WJ7A 5IT2L 1PY0A 3QVAA 5A16B 1OCCB 3RVXD 3EYVB 1JMZA 3FRUB 4XB7A 2G3ZA 4Q2ZA 5DSCA 3GSOA 1X5YA 2GTZB 4XPBH 4E42B 4KJYA 1KF9B 3MJ9L 3K8LA 1M05A 4KGJA 4JR9H 1XAKA 1BQHB 3QHZL 4PW3A 4Q58C 2LLLA 3LEXA 4ZPVA 5I1IL 2O6DA 4XBEH 4QRQA 4MDJA 4ZUVB 3ZDXF 4WGVB 1SJVA 2BZDA 5B4MD 1MDTA 2BNRA 1DL7H 4KHTL 4N0FA 3FQXB 5EU7E 4TLTA 1IE4A 3MBXL 2APXA 4NHUB 3UTSB 1UD6A 2QSCH 1WP6A 3BP5A 3LX9A 1G6RH 1MCCA 2IQ9L 4XPGH 2EVGA 1KGCD 4NQDE 1PD0A 4P4KB 3RHWF 4JKNA 1PD6A 4AENA 2I7SA 5GS1B 2P24B 3GSUB 2GAZB 5I74C 3MYJA 4JPVH 5BZDA 2XXFA 4KKCD 3V4VA 2QFRA 3OAWA 4UM9D 5T1KB 1I82A 2XG5B 1VGEL 3H9HA 1U8MA 4J1UB 4IBLT 1J1XH 1NFKA 2MJWA 1MCNA 1VCBC 1G87A 2Y7NA 2F74A 3FB6B 4H5SA 2X38A 4OGQC 2R4SH 3FCBA 3RWJB 4AX3A 4F2ME 1LK2A 1P7BA 1ZXQA 5FDYA 2M1KA 4KVNH 2W8CA 3O0LA 1F8TH 5FUZH 1T22A 2AJUH 2C1PB 5GGUB 1SHMA 2K8MA 1KULA 2A99A 3DTDA 3B2UD 5T3ZE 4BBWA 3HBZA 2VDMB 4IHOB 3TT3H 1PYWB 4WF7A 4PP1D 1AO7B 3WTWA 5DT1H 1BXVA 1LNUA 1BZQK 3D9AL 1WWBX 2CLVA 4ZMAT 1A1MB 1U8KA 2X4SB 5FKAB 5HYQB 4Z7WB 4RIRA 4HPOL 3MCLL 3H9SE 1HS6A 1CGUA 1NGXB 1BG1A 3RUGF 3T0ED 2WAHA 1JWMB 3IMWA 2WXFA 2GJPA 4AMXA 3X11A 2GFBA 1T5XB 1Z1WA 4M00A 4L3CB 4RGNE 1SQMA 1WYJA 3K5SA 2W81C 1J8HE 2Z93B 1KJVA 4OFVA 5EU3B 4BSVA 2Q9OA 4LDOB 4PRHD 3P4NB 3EO1B 4HV8B 3NFNB 3EF4A 1FA4A 5LBVA 4DO4A 1Z3RA 2HPOA 4JO3L 5IFHL 3KM1A 2A4ZA 1I9JH 4UANA 1ZLUH 3O6FC 2ICCA 4N2OA 3UP1A 1FFQA 5DD0H 3GXUB 4FQXD 2FO1A 4M8QA 4UWQB 4KY1L 4XN4A 3D8MA 1OSPL 1N64H 1RUQL 3ZX1A 4CNIB 5BJTA 4G8GB 1U8JA 3V4UH 3KJ4B 4KI5F 2GJRA 3HC0B 3N41F 2MCPL 1SEBA 4YGAB 1MCDA 3E3QC 3AM8C 4FFZH 1Q38A 1MG2C 2CG9X 5CEXB 3F58H 4HFUL 3X14A 1NC4B 2KLTA 4KK6C 4LCWA 4WSGA 5H8DA 5CP3H 5A2KH 1D6EB 2HKHL 1G7IA 4ACTA 2FX7L 3R4DA 5I2IA 4GKSB 3TBYB 1PG7W 5A2LH 5DJ0A 2IBBA