3HC2A

Crystal structure of chicken sulfite oxidase mutant tyr 322 phe
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
372
structure length
372
Chain Sequence
DPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQCAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDESPSHWQQNDFKGFSPCVDWDTVDYRTAPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sulfite oxidase
publication title Structure function studies in sulfite oxidase with altered active sites
rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 98
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2009-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hc2A02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hc2A01
2A9BA 3HC2A 4PW9A 2A9CA 2A99A 1XDQA 3HBPA 2A9DA 2A9AA 1SOXA 3HBQA 3R19A 2BPBA 1XDYA 1OGPA 3HBGA 2CA3A 2BIHA 2BIIA 2CA4A 4PW3A 2C9XA 2BLFA 2XTSA 3R18A
chains in the Genus database with same CATH superfamily
5ANME 1MREL 1L4IA 4XNMA 3VACA 1GAFH 4QXGH 3A22A 4DO4A 1ZA6A 4U1SB 1F4YH 2IQAB 3KLAA 3VWJB 3KDMA 3LZPA 5BZDA 1N6QL 3B9KA 3DYMA 3REWA 2ZXQA 3TASA 1AY1L 4OV5A 3O4LD 1FNEB 2V7NB 2VWEE 4L9DA 4YDIL 3AXIA 1M7IB 4JPKH 2VR5A 5D7JC 1IIIA 4GXUN 3DJZA 3X1GA 3EUDA 3DX8B 1G7LA 3CE1A 5HP5A 2J57A 7FABL 2UZXA 2CLRB 1MCOL 1O75A 3UAFA 1CR9H 4GJTB 1NFIB 3HAEG 1MCQA 1CFSB 3QJUB 2XV3A 5D5ME 2DM7A 1OAYH 3LZQA 1MCEA 3H54A 2QQNH 3GXUB 4K7FA 3SPHA 3EJYD 4PJAE 1J1XH 3RPBA 5LBSL 1Q9WB 4MCYB 2JTDA 3OGCB 1EHLL 3RWFA 3VRJB 5C3IA 5HGAA 4FG6C 1JWMA 4JX0A 4AC4A 3BFOA 4KROD 4FQQB 4PLNC 1I1FB 2HLFC 2WTRA 4NQDB 4D0DB 3UAEA 4YL9A 1JGIA 3BD5A 4LVHC 3N6YA 3MRNA 3VMPA 1L9PA 3AS0A 2DMGA 3IMRA 3S3JA 4Q9QL 1TQWA 5D1QD 3T8VA 5C0IA 4QOKD 1M1SA 5J57B 2VLKD 5EFIA 4M5ZH 3LN5B 3MTRA 5CWSA 2DN7A 1S7WB 3V6OC 4ZAKD 1D5RA 4MMXC 1KDIA 2XG5A 4OGQC 2WXJA 4QJ3B 4EUPA 4PJFF 3MRKB 2E9BA 3B2UC 5ANMA 5F6HI 3VFMA 5KSBB 4OIBA 3AY4A 2AI0H 3BWUC 5BZXA 4BH7A 3EO9H 5FYLD 2A2QT 3P4LA 4FFZH 5E9DB 1UKSA 3W2DL 3AABA 4U6VL 4FTVD 3LPFA 3II2A 4XNYH 1A6UH 2QQQA 2NOYA 4Z5RA 4R5VA 4ZPVB 4LLMA 1CIUA 3VYPA 3ZYZA 3UJIL 4AYBA 3HE6C 5E5MB 1PX4A 3BP7B 2NTFA 3P3TA 2YPLB 2Y36L 1X5KA 4FS0A 5D7KE 5EH1A 2YD7A 4OB5L 3VI3F 1R5IA 1WS7A 5D5MA 3WEBA 3S3BB 2JI2A 3LDBB 3QT2A 5ESAA 1UH2A 4K94C 1KIUA 1XR8B 2IO5A 3MFFB 4FGMA 4PJAA 4ZSOB 5GJSL 2CJUH 4Z23A 5T3ZD 4TQPA 1INEH 1UWYA 5PAZA 4YQXH 1IC4H 4FE9A 2JK5A 5HVWA 5DJ6A 1NDMB 5AKVA 1LE9A 2E86A 4DP4X 1JZ3A 4FG0A 1HSBA 3T3ME 1S7XB 4TRPL 2B8OT 1YN6A 3FDWA 2F5AH 4TSAL 3N1FC 1FORL 1BBJB 2BS8A 4YPGA 3LZFH 2YXFA 2W65B 3NJNA 5BZZA 2QFPA 3D33A 4M7JL 1F45A 5CSBA 3TWCL 4F58L 1I8MB 3NSCA 1M05B 1H3UA 1NBVH 4LT7A 3LKSB 1J0KA 1IJNA 2ZE0A 2NUPA 3FOLA 1RZKC 5T5NG 1THCA 4Y2NA 5DT1L 4FG2A 2A73A 1Z9PA 5T3ZH 4OGXH 4M3JA 1T21B 2WQSA 4KKLD 3QJSB 1Q72H 2VRKA 4HPYL 4JO4H 3QEGH 2GJJA 3AT8A 2PW2A 3RDTC 1EA9C 3D5OF 3I75A 1OSPH 2IFFH 3KPTA 5HYSG 1C5CH 4IGBB 3DHUA 3A3YB 4XAKD 4BZYA 4Y4KB 5FEBA 4AL8L 4NERA 1XIWA 1Q0XH 2Y69B 3GSOB 1M2VB 3TCXA 2ERJC 2ZT9C 4U7SA 1XX9C 1MW0A 2WXOA 3QDAA 5EU7E 3ZMRA 2GC7C 3GF8A 5DU7A 2DBLL 3ATEA 1QFWL 3L3HA 1TZIB 4E5XA 2X9WA 5HPOA 3ULVF 2GTWA 2Q2LA 1BCIA 4XP6L 2NY2C 3EZJB 1QI5A 2VERN 4DW2L 5L2JB 5L2KD 4HJGB 2Y7QA 3D4YA 5C1MB 5I0XA 1K6QL 1MJJB 3QIUB 4FQLL 1A02N 5DQJA 2WWKT 2XX1A 5KBDA 2Q8BH 1P1ZB 4JHUA 3J07A 3FU7B 4PJIB 1VEPA 4MCMA 1M1XB 1T66C 4YL4A 2A9MH 1AVAA 1CT8B 5DLMH 3FO1B 2N59A 3TVMA 4QHNB 3R8BB 1S7RB 2FT6A 1PJ9A 2VRQA 2AW2A 2XKUA 5IVXF 1ETA1 4MJID 2DEYX 1T3FB 3VFGH 2FTAA 1FA4A 2WKLA 4XBGB 4G7VH 3WN6A 2Z93A 1UOWA 4R8WL 4Y4FD 1UG9A 5DK2B 1L3NA 4OVVA 1BVLB 1FGVH 4YSPA 3GK8H 3V79C 3K91A 5HGHB 3O3EA 9PCYA 1OTSD 1LXMA 4RWHA 3IFLL 2IOOA 3MC0A 1UVQB 3NA9L 4NHUB 4PR5A 3PL6A 1VGKA 5E8NA 1N3NA 3GSXB 5GGVL 5KS9B 4GXUM 2B1HL 2OA9A 3CLFL 3L1FA 4OTXL 3B83A 1T7WA 2Q7AA 4R7VA 2J12B 2AEQH 1MCPL 4I18C 4NHCH 4XOBA 2CDFB 4I0PD 4J4PD 4KKCD 1CLYL 1BFSA 4EZJA 1AGCA 1BJ8A 4UU9B 4HMEA 1MCFA 3PP3K 4KX8A 3ECBA 5F9DC 3B2PA 5KWYC 1T03L 5DRXB 1GPOH 4AZ8B 5SWZB 3N40F 2BSRA 1O5DT 1L9RA 5A2CA 3S36X 4DGIH 5CEYA 1JPST 1HL4A 5I8EA 1J5IA 3W37A 3GXPA 1M57B 1S9VB 3J8F7 4Y5YC 5CCGE 4ZMYA 4JO1H 4CU6A 2XN9B 4B9KC 1KB5H 1BPLB 3WNLA 1UD6A 1PZ3A 5B21A 3LSOA 4MJ5A 3UGEA 3MRGA 1PD1A 4JQIA 3TBWB 4L8SC 1RFDL 3NSXA 4JZJA 4ODSH 5K39B 1ACXA 1KDJA 3BN9D 3BPCA 5CLXA 2H1LM 4GH7B 4YO0B 2QZ5A 2UXFA 1KPRA 3JTTB 2UVEA 3QUYB 1ZVSA 3IJYB 4PJ9A 5I8CB 2GFBA 1TTGA 5I28A 1EFXB 3O6FD 3UMTA 1KEMH 2ZXAA 2E3VA 4ILDA 1Q0YH 4L3EE 3WXWL 2EKSA 1OTUD 3ZXAC 3LS5H 2ATKB 3HS9A 1ID2A 3SCMA 3R7QA 1M71B 1CCZA 5IWLA 3FT0A 5FYKD 4PJFB 1EWHA 3TA3B 2P3YA 3ES6A 5MEOA 3QUMH 1S7QB 5AVUB 1ZHBA 2F8IA 1A5FL 3MZGB 1QQDB 2Q3XA 2XIIA 1DLFL 3NTCH 1JXJA 2DD8L 2MSPA 4HD5A 4J8QA 4JFOB 4GBXC 4Y2DA 3UABA 2X6CA 1MNNA 1AMXA 4EZLA 3TZVC 3NCYP 1GC1L 3KGTA 4DCQB 4ODBD 3BPLC 1G6RH 3U9UA 4AQ8C 3QK0A 1YCSA 2NNFA 4OZFB 4CVXA 3DIVA 5HDBB 1LO4H 4HS3A 4CL7A 3O2VL 4JG9A 1XCTB 5K59E 4FERA 4P3DB 4M7LH 3WTVA 3GIVA 4J3XA 5JHLH 1QZ1A 5IROA 4R7XA 2SODB 3BZ5A 4U1NA 4D3CL 4F7EA 4K3DL 4LL4A 3U6XA 4X5PA 5D7JA 3WN5C 3VXMB 4AQ1B 2BRQA 4IJ3B 1RUPL 5E00B 1L0XA 3IDMA 2ZPKH 1PZ2A 1UQSB 1VLXA 5LGHL 5CZRA 3FN3A 5JPNC 1TF4A 2IH8A 5IEHB 3SN6N 1AHMA 2XJKA 1LEGB 2CKBL 1A2YB 2HB0A 1BXUA 2QBWA 2BDNH 4P5KB 3FQNA 3KLDA 4RBPK 5D6CA 3GMLB 4WEMB 1IC5L 4M1CD 4OFYA 2G2PA 2JTYA 3IJSA 2JKSA 5D7LD 4NIYE 2EXSA 4HISA 4QRRB 5CUSL 4L3EA 4UB0L 3GI9L 3L5IA 1X5GA 3MR9A 4YFDB 3KYNA 2WUCL 3SDAB 1N8ZA 4ZQKA 3A67L 2ICWJ 1D9KB 2EXWC 4UOW0 3MBEB 1MVUA 2JIXD 1NGXB 3TYFA 3QEUA 1FE8L 1QLEB 2FT7A 3PAUA 4I48A 3DHMA 3LEXB 3V52H 2AITA 4HALA 2CUMA 3MCKA 4ONOA 1BP3B 4NKIH 4LSUL 1DN0B 3SYCA 1BBDH 1J12A 1KCVH 1OE1A 2A4CA 3CFBA 1U58B 3VXPB 3DMMD 1AGBB 4WDIB 3EZ8A 4ESKA 3O0RH 1FWXA 3R1GL 5MERB 4YSRA 4GKZA 3NDZE 4ZOEA 4NGHL 2HKAA 2EIBA 3W9DB 1Q9LA 3BVNA 3BEVA 4OZIB 2NY6D 4K8RD 2FK9A 2APWA 4GAJH 4JJ5A 2VDOL 5FUCC 2H47C 5I6XC 4HJEA 3UERA 4JDTH 4HSQA 4I3RL 1NAKL 4LP5A 1IBGH 4QO1B 4QHLB 1USZA 3VNZA 3LRMA 3NA4A 1HCVA 2E9IA 4UT7H 4JDZB 5GRVK 5IMKB 3V4VL 1F18A 2IH1A 3V6FB 1MRCH 3L5JA 3HE6A 3I9GH 4CC0A 5KEZA 1MHCB 3RUGE 3NPSB 1S9WB 1ZD6A 3HZYB 4QKTA 1MHHA 4IRJD 4IRZH 1L5GB 5EO1B 5ALCH 2VDRB 1YAZA 1BZQK 2UV3A 4LCUB 3MRMB 4YXHH 1F11B 1IJ9A 4H88L 1T0MA 1YJDH 1SUJA 5ETUB 1FG9C 4K8RH 5JOFA 3JWNE 4Y4HC 2OMUA 5DJAB 1WC7B 4XN9A 4EI5A 4LEOA 5AVQB 3V4PA 5KG9B 5DJ8B 4YGAB 3RY5A 4B9JA 2BWDA 3IMBA 4IK6A 1BECA 3MACH 3OL2A 1AC0A 1KCSL 1I3RB 3C08H 5JW4N 4ZOBA 1CE1L 3KAAA 1ADQH 2I32A 5LAXA 1KYOK 2B1AL 3GSQB 2GHWB 4NUJA 4PSRA 4FNRA 4JNXA 1HILA 3UZQB 3CC5B 2JJTC 5T3XD 4XMWA 3WFHA 4TLTA 4XE5B 1HQ4B 3IF1B 4YE4L 3LEYH 3H9SD 1I4FB 2Z34A 1DLHB 4JHZA 1A8ZA 4O5LL 3WNNA 1HQRB 3MLTA 2X6MA 2WNWA 3MUGB 1WD8A 5JW5A 3NIDE 1N64H 4GB9A 2DWDB 1N9PA 2CR6A 3U25A 5BQ7B 4PW3A 3T71A 1C16B 2GJ6D 1MY7A 3QIBB 4FABL 5B7EA 5DFVC 4HF5L 4G5AA 5A2BA 5GRJH 5CFAA 1IGJA 4UT9H 2AJZA 2HH0L 4AKQA 3EJPA 4HUMB 5D9SA 5CJXC 4FNQA 4LHUD 5T3XH 2RMNA 2VN4A 3MUY1 4OLEA 2F53E 3RUGA 2CBMA 4ONGL 1PY4A 1I9JL 2P8PA 1XGZA 3AY2A 3BEWB 2X4TA 1QPXA 3F65A 3HZKB 2LU4A 3ARQA 4P3WA 5CINL 3T2QA 5ABDE 2VAJA 3ULVL 3CHXA 4B9YA 3CVBA 1FVDA 1OY3B 1OSZA 4L1LA 3MV8E 2EH7H 2LTQC 2O5YL 1MAML 1OCWH 2Y07L 2MNUA 1CI5A 4HV8A 2FJHB 2QR0B 4Z18A 2VXUL 2G5BA 2YN5A 3H6JA 5KSAD 4JAMA 4RDQF 3U1QA 3H7BA 5I1GL 2P28B 1UA6L 2LFGA 1A6WL 3SE6A 1FAKT 2OYPA 2J6EL 3QO0B 3MJ9H 2O93L 1IAMA 4AC2A 3VM5A 3OC8A 5JO5B 4DEUA 2XXMB 4NWUH 3UG4A 1EJFA 4A2MA 4JQVC 3OKKA 5DO2C 2ENPA 1XGYH 5FYJE 1X5LA 5CP3H 3DX7B 1O6SA 2HRLA 5B3NA 1RIUL 1NCAL 2GITB 4OCSL 1J5OL 1GXEA 2Y2YA 3QFJD 2V3DA 4JM2D 3O6ML 2P5EB 5I9QC 1UKTA 4AVHA 3W5NA 1E5UI 4XWOC 4N5UA 3S88H 4D7PA 4TVPL 4B9FA 1RULL 5ILTL 1BQSA 1P0SE 1OGAB 3EFFA 1KYAA 1UB6A 3WYRA 1MW1A 1NBZB 1ZT7B 1NSNL 4KMTL 4OGAC 4AGNA 5IB5B 4H20L 2JLLA 1FJ1B 3C5SB 4L29B 5L4MA 1WGOA 1J87A 3VGAB 4I18A 4JDVA 3NZHL 2NY7H 4FZEH 4XPHH 1K9TA 4JZNB 1DFBH 1KG0B 4RRPA 3GS7A 2Q76B 3A6OA 2F53A 5IG7B 1DEDA 2WLHA 4PG2C 1LK2A 4CVWA 3X3GH 2OZ4H 4L8BB 4UM8A 4F3FA 1WD9A 3BW9B 3BXNB 4H8HA 3FJTA 5AAWA 5T1KA 1CGUA 1N4XH 1DL7H 3MV8A 1AGDA 3EHBC 5HHNB 2H6PA 4M6MH 4OBRA 5HTSA 1ED3A 3MRBB 3D18A 32C2A 3OHXB 1K8IB 1SFDA 4RFOL 5DSCB 1XGTA 2GSGA 4X4XA 5BQDA 1F6LL 4HK3N 4OLYH 2EDHA 2Q10A 1H0DA 5FKPA 3X17A 3AC0A 1PG7H 2YA2A 4B9IA 2EVJA 5F97E 4AEIL 3GMNA 4MYPA 3D50A 1UKQA 3IXAB 4K7PL 1HNYA 5LDUA 1RZJL 4W9FC 3MBWB 4LSQH 3FT2B 3QZNA 4DK6A 2ZX7A 5B39A 4CILA 2QQLL 5KN5A 3K74B 2D7OA 3OPZH 5LHDA 3V10A 2ALWA 5I1AB 3OJVC 4H2AA 5I0DA 4E36A 4NNXB 3B9DA 5IJCC 2VDQB 4P06A 4CMMA 4PS7A 1PSKL 5EZJB 5GGRA 5E8DH 5CAYB 4XOAA 2DQ6A 4NQDD 3RX8A 1DN2A 3QWOA 3GS4A 4QOKE 1ET8A 1CGXA 2VLKE 4UZUA 1MH5B 1QWHA 3AFLA 3EO1A 5D2NE 2VKWA 4ODHH 3EADA 2VUYA 4XTRC 2CSPA 3TZVA 2PCFA 3FXIC 2ZYRA 3AQDA 5IMOA 4DHLA 4YSAA 1VEMA 3IGKA 4FYQA 1A9EB 4GRWE 1OKEA 4P5MA 2F54B 3K72A 3O8XC 3BUTA 5FYLE 3I2CL 3O4OC 4Z9KB 3OX8B 2NW3A 1I3GL 4KX9A 4OJYA 3WKNA 3L08A 4PJDF 1E50A 1UT9A 4PTTA 4S1QH 1C12A 3IMVA 3WHXA 4CVZB 3GBMH 3F12B 1M3IA 2AAAA 4FTVE 5E9DD 4DOHE 4PU2A 4L1BA 3UG5A 5B7MA 1KCUH 4KVNL 4KRNA 4W9JC 4WHYH 1QUPA 4O2CB 3MCLL 1GGBL 3DK0A 3RBGA 1DVQA 1TZAA 4M6OL 2CD0A 4X6FB 5D1ZD 1VDGA 3KM1A 4A66A 5JW3H 1BFVH 1IBBA 1DVFC 5LGJB 2YPLD 1KY7A 3GSRA 4UM9B 4PWGA 3DWTA 2Y7SA 2PWDA 4JZOA 4KKPA 3FK3A 1FNSL 4HJ0D 4ZTPL 4U1IB 2ZOWA 2FWLB 3MRIA 4M5TA 2NR6D 1KCBA 4U6XB 4YIQA 1LWRA 3DV6B 2J71A 1FCCA 3GPEA 3IN0A 4NT6A 4BCYA 3BT2L 3M7OA 4LARL 3SE9H 4JPKL 4CDHA 4WHDA 5C7ZA 1T5KA 3O3AB 1JF5A 1ZANL 4JFXA 1HL8A 2XPGB 3R06A 2A6KA 4WTZG 4P59H 5LKNA 4KK9C 3L2LA 3TO4C 1HKLH 2WTOA 4HGWB 3DSNB 2HRPH 2HFFB 2X7LB 3HE7B 4N1CA 3BGFC 4QOKA 2VLKA 15C8H 5D2NA 1MW2A 2D9QB 1OAYL 4R9HA 2QQNL 2P44B 4ZAKA 3ZE2E 1CTOA 2P80D 3QCUL 5B1JC 5C08E 3S36H 3US1A 1KCRL 4KQ4H 5E03A 1E90A 3BUQA 3A24A 1R9FA 1CUOA 3PWNA 2WZAA 2TRHA 1TENA 3FU3A 4FJZA 3DETC 2Y1AA 3P4NA 1UXWB 3DTXA 3ESNA 3ILQC 1J9QA 4WI4A 4XAKE 1Q9KA 2HTKC 2KBGA 2VXTH 1TDQA 3HHMA 4FTVA 2Y25A 4N26A 1KIRA 1KJ3H 3MXWL 4Y4KD 3L3IB 3TBVA 5BRZB 1IE5A 4M5ZL 4TNWK 5DGQA 1DBBL 4LSVH 4N0UE 1CFTA 1E9PA 4WFHD 5TDNA 3BQUC 3SYAA 4DVBA 5AB9A 2X0WA 3ZUCA 3KPQB 3QH3A 2O5ZL 4XP1L 2QV2A 2GEQA 1OCOB 2DDQL 3QR0A 5M7QA 3P1VA 1C8QA 5JDSB 5L2KE 3GBEA 2EDOA 2EC9U 3V8OA 2R29H 2OXHB 4FFZL 3MI6A 2ENQA 3QIUD 4X9IA 3KGUA 2I9LA 1UWXK 4OCLC 4APXA 5GS2H 3RTLA 4XNYL 1KOAA 1A6UL 2W0LA 4G5ZH 4F93B 4Q6YA 1CFQB 2D4DA 1EIBA 3VH8B 1XEDA 1UT2A 3SPIA 2K9UA 2X2YA 2C1PA 3LKRB 3SKOB 2K8QA 1P7QA 3GUTA 1KELL 3M45A 4MJIE 2R0LL 2QKIB 2VO5A 2WVUA 3P02A 3Q6GH 1TJHL 2VAAB 5BZWA 2J1ZA 2WXHA 2JJTA 2B3RA 3AW5A 3CZUB 4BSVB 1MW3A 2OXGB 4N3TA 5D4IA 4HWNA 4AMWA 4JFEB 1RZGB 1WZ1L 5C08A 1XAUA 2CJUL 3B4NA 3GI8L 5ECJE 4YQXL 4I8DA 1IC4L 3UC0H 5I1KH 3CDCA 1IC1A 4WHCA 1EDHA 3L95A 4V2CB 2CKNA 3JQOB 1CE6B 4Y88A 1R3IH 4PGBA 4CKQA 4ODUA 1UOVA 1GMEA 1IEHA 4NN5B 1FVEA 3TJPA 1FC2D 2CNZA 3MNZA 4WZ9A 4QCIA 4MMZB 4HIJB 1NBVL 1XCXA 2F61A 1YLBB 4M8QA 2DQMA 3FTGB 4N0UA 5GRXG 3QUGA 3ALPA 1NCUA 4YFLF 3SY0A 2X12A 1MLCB 5SWZD 4BZ2H 4Y89A 1Q72L 4EPSA 4WY7H 1ZY9A 1KTCA 1QLFB 3VSVA 5ESQB 5E0QA 3B6SB 4GAFB 5L2KA 1J9CT 1P4BL 3JWDH 4J3OH 3LVTA 3L4UA 4MD4A 1OSPL 4JFDD 4OJFL 1AHWA 4I2XE 1C5CL 1KGJA 2XN9D 1F4HA 4S0SD 2XIBA 2OI9C 3H3BC 1URIA 1Q0XL 1JV2B 1C5BH 5B8CB 4RMBA 1PW3A 5DWUH 3EJRA 3BFQG 4HIPA 1W0VB 4JQVA 5C6WH 2ICEB 4BINA 1FIGL 2ARJA 4MJIA 4P23B 2X38A 3FU0A 5IBUB 1QP1A 3BKYL 4KNTA 1UASA 1FGNH 4HXAH 1A25A 4HG4J 5C97A 8FABA 2ARJQ 1P1VA 3QUYD 2WNXA 1A9BA 3C6LB 1FV1B 1ANUA 3L7EB 5KVGH 3T8XA 4X5XB 3TEUA 2FZ3B 1EFXD 1A1OA 4XZ4A 1A65A 4XCCH 3RVVC 4E9QA 2JKJA 1DFXA 3G5ZA 3KZ8A 4AVJA 2K0RA 3A21A 4KTEL 2A9ML 3F2LA 3UTQB 1MI5B 2MPAH 1PGRB 5DDHB 3TA3D 1A14L 2IVFC 3FZUC 5IY5B 2O6FA 4XX5A 4EDXA 2A0LD 2BP0B 3MJ8A 4OD3H 4F1SA 4TOYL 4X83A 5ADPH 1BIIA 5D8JH 3VFGL 2FJFA 3APFA 4J12A 2FHCA 3KVDD 3DHPA 4PG2A 1U95B 1QA9B 43CAB 3GK8L 1B0GB 2ZKWA 4N8VG 4ZDHA 5JR1H 3ZHKA 3A6BH 4HEPA 5EB9A 5EBLA 2KUTA 3II1A 1L9TA 5IM7B 3ZE1E 1ZTXH 4YHIA 3V0WH 4N8PA 1KPVB 4TF4A 4B9PA 2Z91B 5GISL 2YZ8A 3H2WA 4EI0A 4FL4C 3LZNA 5MEPB 1P4LA 3ZYOA 4I2XA 4A7TA 4TXVB 1ILSA 4Y9BA 4XN1A 3PP4H 3JT2A 1NEZA 2ITDB 4L48A 3GJFA 5JXAH 2AEQL 5BRQA 1MIMH 4R0LB 3I6LD 4HS8H 3BUIA 4N2OA 3HB3D 4ZMVA 1NUGA 2YJQA 4XC1H 1Q9OA 4YXLL 3VD2A 3W3BA 4IU3A 4KKAC 1WCBB 3NOIA 4U3SA 1ACCA 4G7YH 2CGRH 4OZFH 1R75A 1ID5I 2DLEA 2YXVA 4D9QD 1CXLA 3D8MA 3QNXB 1UXSA 4JO1L 1FZOB 4NI3A 1EBAA 3JV4A 5G4NA 4QRRD 1QSVA 4E9WA 3F6IA 1E9QB 2FD6L 1OGTB 3RY4A 2OMXB 5LXGH 4YDLC 3SDAD 1U8NA 4Y5VC 3ZL2A 1U8MB 2BO0A 1K3IA 3HI5H 1XGQA 2VSMB 1NEZG 1J8HE 1D9KD 4ODSL 4MA3A 4PV8B 1F2QA 3IDYB 1WRFA 3NZUA 5CEXB 5ID1B 1AKJB 3MRFB 2G4EA 4D8OA 2XBZA 4YDJB 4S11A 5CN1A 2VZUA 5CMAA 3PIQA 4MQ7B 4S1SH 3VX0A 1V54B 2SEBA 1G7QA 2NXYC 1Q0EA 4PRHE 4WWKB 1TU2B 1Q0YL 4HAKA 5BUGA 3EYVB 4DFIA 1WA1X 3O8XA 4HMCA 2CK0L 3LS5L 4AL8C 1XF1A 1JGLL 3QHZH 4JDEA 1XH0A 2ED9A 4AIEA 4JY6A 5CZVL 1BYNA 5INDB 3QUML 4UANA 8CGTA 4Z78A 1PX3A 5EO0B 1Z6JT 5GSVB 5D7SL 2C9SA 4DZBA 4L1DA 2A5UA 1AC6A 3MBXH 4WW1A 3EXLA 2BVOA 3ZYJA 1G7MA 3C9NB 4LCWB 1AI1L 2G5UA 3MUZ1 2XY2A 3Q5YA 2FEDD 3GDCA 1NDGA 1E4JA 4YHYC 5E94A 3FUHA 1A6AB 3CQFA 3IETB 4MXVE 3KBPA 3PHOB 2BCMA 3P4MB 3GMOB 3SDXF 3MLZH 1X5YA 3MJ7A 3SDDC 3EBIA 4LKXA 1Y6MR 4CMHB 1QSEB 4M4PA 3C12A 4FQXC 4MD5B 4TMPA 1MFCH 2IQ9H 3HBZA 2DQJL 2ID5A 2EVHA 2HFGH 3EOBA 2KI6A 2ZCHL 1KJVB 2W91A 4M5YL 2R2HA 4DKFH 2YGOA 2QLYA 1OAXL 3K2MC 3MROB 3PE9A 4OQTA 2Z8SA 1R24A 1OHQA 3EF4A 4HKBB 1GS7A 2JIXA 1U4FA 2R1XB 5IJKA 1J8HA 2ZPKL 3ETTA 3VRLE 4RRPM 3ABMB 1ITCA 3BUYB 2NNAA 2NPLX 5DYOA 3VTTA 1XF2A 2XWBB 4MDJA 4YZFE 4NJAH 3PG2A 4NZTH 4U1KB 5FF6B 5HHXL 5IV2A 3KDPB 4YXKH 2BDNL 2VDRH 3EO0A 1WAAF 3K8MA 1HJCA 3DMMA 1K72A 4JE0A 4HUXB 4PRHA 5HHVL 5DJ2B 1WBZB 2PABA 2CXKA 5MP6H 3VTMA 1T7XA 2Y5QA 4Q74A 2I9TB 5I1IH 5B4MC 2BLFA 2WGNB 1MKFA 4BFIA 2XI9A 4F5CE 4CN4A 5CHNA 5TGBB 1OGSA 4OSUH 3QIBD 4XVTH 3L3GB 3V52L 5DQDL 1TKWB 4AQAA 4MCZA 4MFHA 4BGDA 4U1JB 4XO3A 2E5EA 1HEJC 3ZYIA 2OM5A 3Q3GA 1LD9B 2YXMA 1BBDL 3BQUA 3VD7A 5C86A 4IRJA 4IBLT 3KW8A 3O0RL 1YYCA 4KH9A 4V1DD 3HA0A 5BS0E 2D2OA 3TV8A 1UTDA 2NNCA 1ZE3H 4L1HA 4AYFA 5INCA 4YDZA 1EVTC 2R1WB 4DUWA 4KK6D 2VM3A 4FCHA 1A3ZA 4JDTL 1MFEH 2EYTA 1D2PA 1IBGL 1JDCA 4UT7L 2EDBA 1V3LA 5CU9A 5DJDA 5CGBA 5EBMB 2X4UB 1YNKH 3EGXA 4O58H 5FO9B 5FK9A 2J4WH 2X1XR 4XMVA 1XR9A 2PTTB 3BWSA 3K6SA 5B1BB 1ZJBA 3MNVA 3EH5B 1KTJA 4IRZL 4J28A 4N2LA 2VR3A 5DK0A 2OJEB 4MDIB 4NDMB 4DFHA 4IJTA 4Q6KA 4Z7WF 3GXFA 4OD1H 4TVUA 4YXHL 2G2RA 4C56E 1A1MB 1PU0A 3IRZA 3O9WB 3RWIB 1YJDL 3N3EA 3K4DA 4K8RL 4M3HA 5H94A 5HJBA 3RPIB 5IBLD 4ISVA 4N9GB 2GHZA 4YNYB 1ND0B 1OP5H 3VVVA 1WZAA 2F15A 3U7AA 2IADB 1UA3A 1D6VL 2OV0A 3HS0B 3KMDA 1PBYA 4F5CA 3RDJA 3ULUF 4R7DB 1ACYH 1NIBA 1SYVB 3DOSB 5HJ3A 3C08L 3OG4B 1E6JH 2FRGP 1GC1C 2O5XH 1ADQL 2I85A 4XCEA 4OJEH 5JIKA 4AKOA 3U4AA 4HX1B 3I50H 1EVUA 1G9ML 2WQRA 1WQVT 3PDDA 4ABUA 3TH2T 3QDMD 3LKNA 2R2BB 1SY6H 3I6SA 3MLXL 1AIFB 3LV3B 1ZWIB 2EUXA 2APXA 3QQ4A 5ICZB 2H6UA 3A0OA 5BS0A 3AG3B 1ZGLB 1I1CA 1GYAA 1IQDA 4PGZA 3QULA 3WTWA 2YOCA 1G43A 2RFXA 4XB3A 1VFUA 5LWYH 3NQIA 4GUCA 4OD2B 4LMQI 3BDBA 4UIMB 5KSAA 4YHZH 2ZUTA 1F1GA 4YR6B 2DI8A 2WBJB 5FUOH 5GRJL 2LR4A 2NXZC 4PRBB 4UT9L 1DQJB 4NRXB 1G7IB 1GHFL 2X1PA 3DX9B 3HMXA 2X0UA 1L9MA 4EMZA 2BINA 3FRPG 2ZX8A 5LBSA 1HAWA 1UB5B 3HLAB 3STZA 1KBKA 4M93B 1GH7A 3UIYA 2VT0A 3S4SB 2E27L 2H32A 1QNIA 4AJ0A 4HP5A 3KR3H 3FFDA 3HRZC 4N3UA 4C56A 2J5LC 5I8OH 1B4TA 1ETZA 4F7PA 2EIJB 4HUKB 4WKXA 1WO2A 1JHLL 3CFQA 3FQUA 4JM2A 5A7EA 1JG9A 1XBDA 2VJXA 4QRTA 1FG2B 1OF2A 5AD0A 1ZS8A 3CH1B 3GHPA 5JIPA 2VR8A 2EE2A 3C8KB 4YGVA 1X5XA 3RAJL 1KNOA 5E2TH 3RP1A 1TG8A 3MJ9L 3WMSA 2H3NA 1H5BB 2VH5H 1DDTA 3KPRB 4ATWA 4A2GA 1V3JA 4A7UA 5FGCB 1GW0A 5F0PB 1JD9A 1XGYL 2D7TH 4GUPA 3O6LH 4GYBA 4YAQB 1HK6A 4FQHB 4WWPA 3DBXB 3N42B 2YPKA 2OMBA 5CBAA 3OC5A 3Q1SH 5I1HL 1G7HA 4JFFB 5DZLA 2W94A 4X80L 4HBCH 5KSBE 1T04B 4PJHF 1YSOA 2H9GB 2F54D 3WKMH 2HLAB 3ELAT 5EF3A 3S88L 4N2FA 3SBPA 4R4NC 4G82A 1XD1A 2ZWNA 1VZGA 4FFVD 3ZPDA 1OAKH 1SN2A 2YMOA 3A6CH 1U2HA 3KPOA 2KS0A 2B14A 2YAHA 3DROA 2BOBA 3LS4H 3VFOB 3QUZB 2D7QA 2NY7L 4FZEL 2OTUA 4P2OB 2JNZA 4XPHL 3CSPA 1JGEA 1M6UA 3PWVA 1DFBL 4ZFGH 1W0YT 2CLRA 1BEYH 2XCMC 2Z4QB 2YPLE 2OZ4L 5B38B 5DD0H 3RWEA 4AV5A 3LPOA 3D0LA 1E43A 1NFDF 3AREC 4UM9D 4JFZH 1JWSA 4YBHA 2BIMA 1N4XL 2PO6B 5A40E 1HYSD 5BNXD 4L0PB 1HESA 4D9LH 2DYPB 4M6ML 1ONQB 3MYJA 3ZDZB 1K85A 4IS6B 4NSKA 2DKMA 4HMDA 5DURB 1AACA 1IE4A 1P7BA 4N8CH 3EJUA 4JRXE 4MJJA 4PYHA 2NY1B 3ZHLA 4OLYL 3B2XA 4DWHA 4GT7A 1V5JA 5FECB 5I1EH 1PG7L 1I1FA 4JHAH 4BQCA 3CN0A 1TJMA 2FUQA 2NY0B 3RFZA 1ZV2A 3NFNB 4JFSA 3C5JA 1GGUA 4YSEA 1JYWA 4U1GC 4HS6A 2LOEA 2JKLA 3HE7D 4LSQL 3WDIA 3CQPA 3ILPB 2NZ9C 2EUWA 4YSCA 3S2CA 2G3MA 2G30A 2KT6A 3OPZL 4G9FB 2AZUA 3QI9B 2YKLH 5EUOB 2ZWKA 5KSBA 2JE8A 3FPXA 1B0WA 5DGRA 2E0PA 1FSKC 4NN6C 3GZKA 5TQ2H 4PCTA 1T1YA 2F68X 1IV8A 5AVTB 2I7SA 3D4CA 4X98B 2J88L 5AVWB 3ULVC 1FYTD 3V0GA 3CAFA 4E9SA 1BX2B 4HYTB 4ZMQA 3ZDXB 4RMQA 1A66A 4JN2A 4PJGF 4ODHL 5J6GA 5BRZD 2FR4B 4ZS7H 5MHSD 4M7ZC 4WFHE 3U48A 5D1ZA 4B96A 1IGYB 4XXWC 5H37A 4WJ5B 4BGLA 3CVHB 4PW4A 3LNEA 4D2NA 1ZT4A 2YPLA 3SDDA 3FU9A 1FRGH 3NIFE 1G7PA 4ZO6A 4EN3B 5E7FA 3QUXC 1YEDA 1E4HA 2BSTB 2DJ4A 3RIFK 1EAOA 1QFPA 4NQVA 1F97A 1K4CB 3IE9A 3CDGA 1YPZB 3WIFB 4JRXA 1NDMA 4JY4A 4PJIE 5EZPA 1KCUL 5H8DA 4AVKA 1BEXA 5J1AB 1RZFH 1S7XA 2E8YA 3O45B 4FYSA 1AOZA 3WS3B 3AJ7A 1V3MA 4S10A 3MA7A 3DJRA 4PREB 3V5DB 1IEBB 4MNGE 1D7BA 5GS0L 3JTSA 1ZA3A 3ECVA 5DVLA 4Q4EA 1I8MA 2XICA 2FLBT 3KWVA 1M05A 2VZ3A 3IXTA 1MQKL 3GXTA 3X11A 2BC4A 2VE6A 3LKSA 5FYJU 4DP9X 1QYGL 1R33A 3CK0H 2HX8A 4RQQA 4XNDA 1WFOA 3X12B 2X89A 4XB8A 1H8SA 1T83C 3ZOAA 2X44D 5IOPB 2XZAL 3LH2H 1A4BA 4LF3B 3SE9L 4P2CG 4P2RE 2YQBA 4BKSC 2J1KA 2CIIB 4P59L 4I0CC 4UV7H 1HKLL 5F96H 6PCYA 1HXYB 1F4WH 1AGEB 2VXVL 3DVNA 2ZCLL 15C8L 4Y7OC 1JFQL 3QJOA 3O41B 4GRMB 3BPNC 2YR3A 4XXCC 5I0YA 1I7RB 2ARWA 2IAMC 43C9B 3RWDB 4M48L 3S36L 1L9OA 4K0OA 1RK0A 3MLPA 1T80A 1TTFA 2A74B 5SWZE 4KQ4L 2GK2A 5IIEA 1DJSA 3L5WB 1TZIA 3LY6A 1OB1B 2ZOUA 3SDCC 4JFDE 4K07A 2OZNA 2VN5A 2IDTA 3JVGA 2JELH 3QIUA 2X40A 5B1KA 3QHTC 2VXTL 3ZIYA 1P1ZA 1U3HB 1RZJC 4HZLA 3SD5A 3GSWA 4WW2B 3FT3B 4JPIA 4PJIA 4M6NL 3KHOA 2GTQA 4J3SA 4XMXA 4J2QA 4LSVL 4ONFH 2A99A 4TSBH 4OLXH 3OJDA 2A9DA 1UH3A 2H0PA 3ARGC 4MNGA 5I1CL 4LSPH 5J12B 3TF7C 4UUJB 1T3FA 5I17B 1G84A 4NCC1 4XBGA 1MWAL 4ODXB 1E5YA 1A6VH 4PV1C 2H2SD 3C6LD 2FSEB 1BVLA 1BQHA 2K70A 2ITCA 4B97A 1JZIA 1BM7A 4BCXA 1ZSDA 2V7HB 4G5ZL 3ULUL 2AXHA 2MEJB 4NHUA 4P2RA 2DOCA 2Z0UA 4PJFE 5FA3B 5ANHA 3CFTA 5H4YA 2FX8H 1MI5D 1TZHA 4M1GL 1SOSA 1CL7H 2ADGB 3BZ4B 3ABKB 4JHBA 3GSNB 2XYBA 3Q6GL 2H3XC 2XG4B 1V3KA 4EOWH 2CM6A 1RUAL 2CDFA 5KVEH 3BAJA 2B9BA 3F7KA 5E4EB 3FB5A 1X5AA 1N8OE 4EN2A 4PRNA 1THAA 3BDXA 5FGSA 3MREB 3RKPA 5DRXA 5SWZA 3V0AC 1VB9A 5I1KL 3V5HA 1EJOH 2W9LA 2XTSA 1DQMH 4ZMZA 4P8QA 2BSED 1BQHG 3FB6A 5I82A 4PAZA 5EOCH 1GZPA 2F1EA 2R2EA 4WK4B 4D0CB 3F83A 2XNAA 3AB0B 3HW7A 1DUZA 4JFDA 4JREC 3VFUA 1S9VA 3NFSH 3VI3E 3WEXA 5BO0D 1UUSA 4PJXB 5HI5C 2XN9A 2DB8A 1YNLH 1QPKA 3VCLB 5ACLA 2A9NL 2CKBA 1L7IH 4L5FH 3QQ3A 5EO9A 5IB2B 3O0LA 3I6LE 1BVZA 5IEKB 4HUWA 1S7UA 5FDWA 3WL9B 2OS7A 4YHKH 3T0EB 2ZUUA 1HSAB 1W0WB 2PETA 1ZIAA 2ED7A 4YO0A 3RNQB 2NNRA 3OM3B 1X9QA 2OMTB 3QG7H 4BZ2L 2OW6A 2FQDA 2GQHA 1R34A 5I6KA 4XP5H 2GG1A 5I8CA 2Z92B 4OKDA 3VRIB 1GZQA 4DEPB 2X4OA 4XBPA 3T77A 3C5ZB 5ACZA 2IOIA 3L7FB 2ATKA 4G6AC 1U3NA 5EC2B 3I84A 2WANA 1BM3H 3NSJA 1KLUA 3AMKA 4PJFA 3VFSB 3A4DA 2OR8A 1KTRL 2D7NA 2X28A 3U36B 3QDJB 4JY5L 1NL0L 1WDAA 1SEBB 3JV5A 3AXLA 1AKJD 1FGNL 5DS8B 5F7DB 2X1WL 3UZVB 2YGVA 4NM8H 5JMOC 4GI8A 2DQUH 2PR9A 1NANI 3VD5A 2RQEA 4UYPA 2EDYA 4Z3EA 4I89A 1Z66A 1ZHKA 2WJ5A 4DP5X 2C3WA 3W0WE 1HFUA 2MPAL 4MBRA 3VI3A 1T7YA 2VZVA 4Y9GA 3ULVE 2XHNA 1RURL 1HNFA 1TTBA 3SSGA 5E1GA 5ADPL 2WD0A 3HUJF 5CM1A 5D8JL 1AXSB 1FNAA 4EF3A 1DE4B 3DJTA 5L8KB 4I87A 4ZK8A 2X88A 1TETH 4PJBB 5L88L 4LCWD 3ZJAA 1FPTH 4F2FA 5K9KB 3I3BA 4HIEA 5JR1L 1RK7A 3AREA 3M6DA 1ZTXL 4YK4B 1IBDA 1A2YA 2EDFA 3QQDA 4QR7A 5HHQA 2WXRA 3OV6A 5IVXE 2R9HC 1QSED 4GAGH 4I3GA 3AS1A 3VWKC 4H8PA 1ROCA 1YY8B 4RFNB 4XN5A 2CO4A 2LV4A 3T4AB 2JV6A 3D9AL 3PP4L 4DIXA 8PAZA 3ZKND 3DO4A 5JXAL 1MIML 1H3GA 2W0FB 4HH9B 5AVRB 4IIZA 4GKNA 2OR9H 1D9KA 4JRYE 4JW3A 1VPOH 3K4AA 4MNHB 3N0PB 1MRFH 3LEXA 5LNEA 1EUUA 5C07B 1S9KC 2CGRL 1GSMA 3TTYA 2XWDA 3NIGF 3ARDC 4UQIM 5CBEB 4KK8C 4PB9H 2WIIA 2JXMB 1U58A 4J7RA 5IR1A 1LNUB 5CN2A 4B7IA 2PXYC 4GMTL 1VENA 1FNFA 4L3CB 4J6RH 4PJ5E 3APMA 3X14A 4OLZH 1E42A 3W9DA 5I6OA 5LXGL 3IGFA 4KUCF 1NCHA 3APCA 3W0WA 3HI5L 2QKSA 1EERB 4XMKH 4P57B 4ALAH 1AD0A 1CDJA 1MHPH 1NGYA 3IGAA 3P0YL 4QO1A 4QHLA 3HG1E 1WT5C 3D0VB 4R97C 2VISB 5D4HA 1A7OH 4N5EC 2KLTA 4NKOB 5CSGA 3FQXA 3FUKA 4V1DE 5EO1A 1NBCA 4HT1H 4M9PA 1NDTA 1RUQL 1F11A 3EFDH 2Y3AA 5EOCJ 3ZIMA 4BM7A 2PCYA 3QUXA 4OFVA 4GG6B 5IVXA 2ZYIA 2UUDH 5HGBA 3UPAA 1YEJL 4MX7A 4K9EH 3CX5K 5DVKA 4IOSD 3GJEA 2P8MB 1MCWW 3FONA 5DJ8A 4UZGA 3RQ3A 3MBXL 2ZNXA 5KG9A 5FO8B 4LSTH 4XP9L 4G3YH 2VC2L 5D70H 3AT9A 4JRYA 4IIQC 3BZFB 1ZCRA 1R47A 3HR5A 3ZW3A 4Y16B 3WJJC 3IM1A 4LOUD 3U2JA 5IREA 3S8WA 1ICTA 1RL1A 4Q56A 1G5GA 3O9WD 3UBFA 2PP7A 1MFCL 4M8RA 4OKVB 2IQ9L 3MRDA 1W72B 3M1BA 2HVBA 1DLHA 1T83A 1X4YA 2QSVA 4DQOH 1TZGH 2BHFA 4PJ5A 3MUGA 1PD0A 1QNZH 5DHDA 3UACA 4G8IA 3QORB 3OAYH 1BGXL 2DWDA 3P2DA 4JVUA 1MF2H 3UYOD 3W9EB 4ZFZB 2AZAA 1RZ7L 1LO5B 2NYKA 3VGEA 3CXDH 1CZ8H 5F71A 5FC9A 4FD0A 1AO7B 1KCLA 5A2AA 2DYRB 1Z0NA 5CLTA 2AJ3A 3HG1A 1MEXL 4NJAL 4NZTL 3SQBB 3K8KA 4YXKL 3QDME 2GBTA 2WXKA 3N50A 1XTLA 1KIPA 3V7MA 2IAMA 3EJZD 4FMVA 2Q3ZA 3U0PA 4PLJD 1XH1A 4YHNB 3N43B 1MJ7H 3MV7B 4KFZC 5JZ7D 4V1DA 2KPNA 5MP6L 1FHNA 4PHZA 1DANT 4M3KB 2DPKA 3SDCA 5I1IL 1NBQA 4QHMB 4BZ1A 2MNJB 3GYRA 1E4WL 1OM3H 4KO7A 2HPOA 1XGUA 1RIVH 5G4OA 2QR0A 2WBJD 3REVA 4OCMC 5ENWB 3N40P 3DIFB 2M26A 3CPLA 4JGJA 1T89C 3MRCB 3ARGA 5CJQL 5AB1A 5IT2H 3AG4B 5JO5A 2WQWA 4P05A 2WLLB 1QLRA 2I27N 3PGDA 4XMZA 5EMYA 3RJDA 4G71B 3IK2A 4JRLA 3ZTNL 2R23B 5C0EA 3PNWB 2B9AA 4NNYA 3P9MA 4MZ2A 1JNNH 1WAPA 1W8OA 1MFEL 2E7MA 3RZWA 2WTPA 5AAMC 3PDGA 2QPFA 3CHPA 2D73A 5DA4A 2UY7B 5DZAA 2F19L 1Y7VA 2H1XA 3PS6A 4BRVA 3U0TB 1QFWM 1XGRA 4AG4H 3WFDH 4UILH 1YNKL 4GNKB 4LAQH 2XACC 4GP5B 2NY4C 5D6DA 2NMSA 1ITBB 1FJ1A 3ARFB 4AM0A 4L29A 2XKNB 3VXSB 3KPRD 4OD1L 3C09B 3SZKC 2YZ1A 2X41A 3QDMA 4MBOA 3WO4C 4G59C 3H7LA 1HOEA 5DFAA 3TBTB 4P46B 2HLEB 3HEIB 1ZDSA 1SNRA 3I02B 1R1CA 2WLIA 3IFOB 2Z1PA 3BYTA 4FNSA 4JFFD 1ZOXA 4UNIA 3BXNA 5HD8C 3VUAA 5GZNC 2DQDH 1WBYB 3WFCH 3BHBB 2ZNWA 3HAEB 4H25A 3P4OA 5HHNA 3TBSB 4FTDA 5I75B 3K71A 3N41F 2CIKA 2PUQT 4WEEA 1E6JL 3O6FC 4B7LA 3OHXA 3UTSD 3NH7H 4BUHA 2C9XA 2KZWA 4XNMB 2AXFA 3QUZD 4J5VA 2X09A 3GEFA 4P2OD 1SY6L 3KLAB 3KDMB 3HFMH 3OSKA 3B9KB 1WV7T 5SV3A 3LD8C 2BWQA 2E7DA 4TS6A 5DMIL 5AVVB 3UTTE 1L9SA 4PJ7F 2L7QA 3FCUB 5T33H 3MBWA 4MXQD 3RGVB 1I31A 4WO4B 5FCUL 5IW3A 4S0HA 2PO6D 5LWYL 1G7LB 4O02L 4DGUA 4JFTA 1KWGA 2DYPD 3GZQA 2UZXB 5DO8A 5DURD 2WQ8A 1JVOA 4IK7A 3LHPH 3PHQA 3NIGB 2RR3A 4NJ9H 4Y9EA 5D96B 4DAGH 3OXRA 3GWJA 3GIZH 4NNXA 3DRTA 5E23A 4NXSA 2NY1D 3BSGA 3OHMB 4K7FB 4NIKB 4K3GA 2WXGA 5AUMB 1S9YA 2VLRE 5EU4A 4ICXA 4NKQB 3WNKA 3U9PL 1XSKA 4M56A 1EO8L 5I8OL 1YEGL 5HGAB 1JWMB 4PWHA 1G4MA 3Q5OA 4KZEH 2OCCB 3Q2LA 1B9KA 1NM4A 3AWEA 3ET9F 3WGVB 2X4SA 4Z7OB 2WTRB 3Q9PA 4QRQA 2VN6A 4N0CD 4YBQC 5GS3A 4BFBD 1A9EA 3O3DB 2JH2A 1DJGA 2FWOA 3ARPA 2ZKYA 3MRNB 4G9FD 4GW5A 4AT6A 5C0IB 3C2SA 3ZKMD 3PF2A 4OF5A 3OX8A 4IBZA 5CWSB 5E2TL 5AYUL 2C1OA 1KC5H 4LPYA 5JQ6H 4W4OC 1U36A 4OJAA 2DLTA 2X1OA 3F12A 5GGSY 2VH5L 4EUPB 1FYTE 1IFGA 1MN4A 2XG5B 4BQ6A 5C6TL 2FYVA 5ANMB 3MDJA 3O6LL 5MHSE 1ULVA 4S1DC 5I18L 4BH7B 4O2CA 1NUDA 4BWTA 1TLKA 2Y3NA 3U6RA 1VKXA 4X6FA 1OANA 1OLLA 2ADIA 3OR7B 4L37B 5F7KC 4W9DC 4F7CA 5A16A 2BWIA 4MJ4A 1KCWA 1LQBC 3LIZL 5LGJA 5BUAA 3UTTA 4XO8A 3WKML 2VZSA 4ZZFA 2ICCA 2IDSA 4URTB 4FQCL 3WDJA 2VL4A 1NUFA 4Z5RB 1AXTH 4LLMB 4EN3D 2Q1EA 1OAKL 2IF7A 3A6CL 3RTQC 3S5LA 4JM0A 2EVIA 2NTFB 3DV6A 1X5JA 2EIDA 2XWJA 5JQHC 1F4XL 2N7SA 3LS4L 2FYYA 1DCEA 3CFDA 1R5IB 1IAII 4OAWA 3RVUC 4WGVB 3PWJA 1YJDC 2GIXA 2BS9A 3BVXA 1X9RA 1KIUB 3BZDA 4K8RC 4PJAB 4F15C 1BEYL 2VLRA 1OPGH 3DSNA 1GYVA 4R6UA 1A4KA 1MCIA 2FWSA 2X7LA 1SF3A 4UTAH 1PDKA 3CVHH 2HJLA 4OH2A 5DD0L 2JK5B 5E1IA 4DKEH 4ELDA 5DJ6B 3ARDA 5HYSB 1LE9B 4JFZL 4NO2A 3ATAA 4BKLB 1AR1B 1HSBB 1SXBA 1YN6B 2A9AA 5HGDA 5E0FA 2VITA 3FB7A 3RFRA 1FFQA 4YPGB 2YD3A 3MODL 3LQAH 4TUJA 3MLVL 1WLHA 1G9MC 1MCSA 4FYTA 3S5LG 3HZVA 3MLRH 2BP5M 4UZSA 3CDFA 1UXWA 3OKMA 4EBQH 4Z7UF 4K23H 1R17A 2AP2A 1FYTA 2MTAA 3VB9A 1BAFL 3DBSA 4XNXH 5DA0B 5EZOL 3UBXG 1OB0A 4FP8L 4M29A 2AK4E 1UJ3C 3AG2B 2ORBH 3GMQA 2PW2B 2I7OA 4TLSA 4X6BA 4ENZA 3UJTH 2BVEA 4MA8H 1X9LA 1AH1A 1X5MA 2DF3A 3I75B 4DUXA 5C0GA 1QFWI 3BIKA 1QACA 1RD6A 2YKLL 3ECWA 3VYNA 3ZBMA 1NMBL 4QEGA 2K45A 1XIWB 4OLUH 1NAMB 3HC0A 1D6EA 3OQ3B 5D1ZI 5TQ2L 1XV8A 4MJHA 2BSSA 3BWUF 4PUBL 3OKLA 1UT1A 3ETBJ 1HDMA 1WZMA 2L7UA 3U0WL 2TSAA 2YLHA 5LLIC 3MGTA 3F58L 1U3HD 2R8SL 3L3HB 3AS3A 4E5XB 3II3A 4N0RA 3HVNA 3ESPA 4LOVA 2OJZH 1RSFA 1OTTC 4IIQA 2ADJA 3HKFA 2Y7QB 1NICA 5BVPL 3ASOB 5I8KL 3WJJA 5DQJB 4XX1G 4HGMA 2P4AB 3CSBA 3HFFA 5KBMA 4NO0A 4KITB 2GABA 5SX5H 3MO1A 5FFLA 1AG6A 4QWWD 5F6HJ 3GXMA 3T3MB 3F7QA 2R56H 5AB2A 1CD1A 1JK9A 3BJLA 3TVMB 4XOEA 1XD0A 2FQFA 1G1YA 4PJCB 2ZJSL 4G6ML 2ZAIA 5F3HA 2X2HA 3U82B 5GGTA 3DX6A 1BZEA 4PWIA 1RZFL 1CE6A 2X42A 3BPOB 4LRNL 3TEWA 2Z93B 4AGOA 5F2FA 1G94A 4K4KA 2MKWA 2QHLA 4FNTA 4W6WB 1QPPA 3O3EB 5I66A 2EH8H 2ISDA 3ATBA 4PJDE 4PYGA 2ZOTA 4NO5A 2AK4A 5KJRL 4PR5B 2H5UA 2YO3A 3PL6B 3CK0L 2VO8A 1VGKB 5E8NB 3NEXA 5LN4A 4XI5D 1WG3A 4IKJA 3KLHC 1SHWA 2Y6SC 2HG5B 3VSTA 3IPFA 2O6EA 1OWRM 1SOXA 1KBWA 1SHXA 3FHEA 5DC0A 5TK2A 4Y19B 3V6ZB 2WYZA 3K6FA 5DCCA 1QVOA 2BPBA 1AGCB 4UV7L 5DMGD 3ECBB 4GEIA 4GKOA 4D7BA 1XF5B 5F96L 1F4WL 4HGKC 3ASNB 2BSRB 1MIEH 2K4AA 3QUKB 2W38A 3QEQE 3GSNH 5B8CA 2VW7A 5CEYB 1NZRA 5I8EB 3PAZA 1HOCB 3LEVH 5CZXC 3BFWA 4HC1H 3NUKA 3S7GA 1UM5L 4GQPH 4J2XA 4Z77A 2CU9A 3T0ED 5G2NA 4AEEA 1JZ2A 4PLOB 2X2JA 3LSOB 4CA4A 2HT2D 4XNZB 2R69L 5KOMC 2I60H 5F6IB 3MRGB 3L7EA 2DJUA 2XZQH 1X5ZA 3AT0A 5AAMA 3PFQA 1YY9D 2DI7A 1OQOA 3TJHC 4JZJB 3CMGA 3B5GA 4RMUA 1MFNA 2EEXA 3BPCB 3C5ZD 1AZZC 2FH8A 1KPRB 1XB6A 4JBSA 2RGSA 3LKOB 4L0YA 3L81A 1CXKA 5IB4A 2CHDA 3U1SL 1ZVSB 5ITFB 4PJ9B 2C4XA 2AGJH 3CFCL 2GFBB 1Z9LA 5TF1L 3VXOB 2DAVA 3QQ9D 4TSBL 4IKLA 4OLXL 5LCVH 3IKKA 1IGCH 3VWJC 4ABWA 4KZ0A 1LM8V 3QDJD 4LESA 1RH8A 4LBEA 1QZNA 2EKSB 4PJDA 3SCMB 4GIOA 4LLUA 3VW3H 1A6VL 3FUMA 5F3BA 2VYRE 1IX2A 2GJRA 3ES6B 2K9FB 1JPFA 5MEOB 1B0GA 4NBXB 4AYSA 5BO1H 5EIVA 1ZHBB 4APQC 2BSEA 4HXBH 5GZNA 4ELMB 4HCIA 3P30H 4Y2DB 1KPVA 2Z91A 4LPCA 1OW0C 3SGKA 2MFNA 2LFEA 1CL7L 4IYKA 2NDGA 3TV3H 6CGTA 2IV9A 1KB9K 1Z7JA 5C0BB 2AAVA 4EOWL 4CVXB 3QDHA 4R0LA 3QEQA 4HS3B 4HIHA 5KVEL 2D7PA 2Z31C 1Z5YD 3ESUF 3FUFA 3LB6D 5EDSA 3EYFB 1II4E 3SKNA 3GIVB 3MOBL 4BFJA 3E8UH 2BNRE 4U1NB 4F7EB 4TTGA 1E7UA 3W5MA 3ELQA 2WVTA 5D7JB 1DQML 1UFUA 1X4XA 2J20A 1EAJA 1U41A 3GSUA 3PGCA 3EJQA 3RKDC 4AUYA 3NFSL 2EADA 2LLGA 2AKRA 3ARZA 4WGWB 2CDGB 1YNLL 3QFDA 4W9GC 2AABL 1L7IL 3NACH 5FFGA 3S96B 1UD4A 2VLJD 1D3CA 4QF1A 5FM5O 1I85C 3ZLQC 3FQNB 2W81C 3FQTA 5D6CB 3K2IA 1DBML 2EO7A 4YHKL 4X2UA 4Z3FA 1A3RL 4IMKC 4YX2H 3MRFA 1IM3A 4L3EB 3QG7L 4R3SA 4YDJA 1NKRA 3TO2A 1JZHA 1T5XA 3E1ZA 3MR9B 3KYNB 1N8ZB 4XP5L 4ZQKB 4HLZG 5BW7C 4PB0H 2O1AA 3FQ4A 4KJQC 1DSYA 1MVUB 4LVHB 4B3EA 4JPWL 3EYVA 1DQDH 2NYYD 4K71C 3TYFB 4RIRA 3QBTB 2X4NB 4P9ML 3DURA 3L4TA 1BM3L 2GY5A 4IMLA 2EIKB 4PD4K 4W4OA 1BA9A 1EX0A 1I7UA 5EZIL 3GRBA 3CNKA 5F9JA 4MMXB 4WTQA 4O51A 4TL5A 2VDLB 1OD9A 1FL3A 1Q8MA 1NPUA 5I16A 5KZCD 4GKZB 1UUNA 2A77H 4OU3A 1Q9LB 3BVNB 3BEVB 3Q06A 1FAIH 4H8UA 3ISWA 3UC2A 2V5RA 4ZG1A 3UAJD 2P24B 1TZOA 1IU1A 2GIYA 1A6AA 2GY7B 3DX3A 3IETA 3NAAH 4NENA 2BNRA 4N25A 1E2VA 3P4MA 3QXAB 1TUPA 3QIWC 1J11A 4RFEA 1XH3A 4UTBH 5AYQA 2YARA 2IH1B 4A38A 4CSSA 5DEFA 3RTQA 2C34A 3OKEB 4RA3A 3HE6B 4Z76A 2BIHA 1IGFL 5L7XL 4JKLA 2QGEA 3GHEL 5JOPD 1CPUA 5JLZA 3QAZC 2XWZA 5KANI 1DO6A 1GMIA 1C08A 1TETL 5DZPA 2F18A 2OX5A 2WP3O 1T0MB 3OQRA 1XDQA 2MPVA 4KXZI 3SEPA 3B3BA 3WUWA 3WXVL 5JOFB 2WXMA 3BH9A 2OMUB 2F7IA 5D1XC 2XWBA 3FQRB 4EI5B 4LEOB 3MLSH 3V4PB 3INUL 4Y16D 5DRNB 2WBXA 4IGBC 4D0BA 3ULUC 2A4EA 4K73A 5K93A 1LO2H 2BW4A 1YEKH 2WIMA 1P5UC 4ZO9A 3KLKA 1ADQA 3ESVF 2VLME 3LNGA 2C9PA 2QTVA 2XA8H 4FDWA 2EXYD 4QAWA 4FRWA 3MCG1 1W6LA 5EIIG 4NUJB 2I9TA 1OSYA 3R18A 5AZEL 1XF3B 1XAKA 3D48R 3QORD 3QQNA 4S1RH 1BAGA 1CIDA 2OQJA 4X6DF 3P3YA 5E24E 2OR9L 5J9PA 3WFHB 1MDTA 4ANWA 5EZLA 2WZPA 3T0VA 4OLWH 3QC6X 3EJTA 3KPPA 1PFOA 2YC1A 1MRFL 4AYMC 5FW8A 3CCHA 4Q14A 4YSSA 5BRPA 1TKWA 1OCCB 5EEVA 2LAAA 3MLTB 3GHBH 4ZFOB 1GGCH 1UJ3A 5JW5B 3MU3A 5IFAH 1LD9A 1CYGA 1DQKA 5MENB 1KXVC 2XQ0A 1J9SA 1AFVH 1I7TA 2QPUA 4XVUD 3RWHB 3B7RL 3MV7D 3WENA 5HYQA 4ZXBA 4J6RL 4KHXL 3QPKA 1L6XA 1IGJB 2AJZB 5SWSE 3O6KH 2ERJB 4OLZL 5BPPA 5ADOH 3QAQA 4TNGA 5EPMA 2IOMA 1NIEA 1S7VA 4GO8A 4PRPE 1AD9A 3GLEA 5D9SB 3SQRA 1MHPL 3FHAA 4NQEB 2F58H 3ME0A 1AIZA 5CEZL 2K6ZA 2X4TB 4URKA 3BVDB 2NY2B 2OL3A 1FVDB 1XZ0A 4H2CA 1OSZB 1A7OL 1U93A 1JPTH 2AQTA 3BESR 4J3OC 4UT6A 2PTTA 3I74A 1KJ2L 1LO0L 4HV8B 2OJEA 4NDMA 3H7BB 3HPJA 2VQ4A 1FFTB 2XUWA 3O9WA 3ARWA 4QYAA 4X7SH 3MJ9A 3RWIA 3AAZA 2OSWA 2H1PH 2CRIA 3CVDA 3GRWH 3RWCA 4N9GA 1C8PA 2JKNA 1QUNB 3ULAB 5CP3A 3OKKB 5K69A 1OPOA 5FPIA 2IADA 1T5WA 4Q9CA 3HS0A 4LSTL 1NCCL 4N4YB 1KT2A 2B77A 4LCCC 1LLAA 1N59B 2WBKA 2NZIA 4JLRB 2JJWA 4N6QA 1R3LA 2L4OA 5FGCE 3MXVL 2E4TA 1HHKA 1X6NA 3ARFD 3QWNA 4OVUA 5CIPA 3VXSD 2YMXL 3RI5F 2EIZB 4WVRA 1DUYA 1K4DB 2WLNA 3NIDB 1NOLA 2R2BA 3EFFB 1UB6B 4OI7A 1CICD 4J23A 4P46D 1JDAA 4HOMA 1U2YA 2X1QA 4JFFE 1I9RL 5F7EL 2ZSVA 4HKXB 5KVFH 3CTTA 3UBGA 1ZLEA 4IRSC 1QNZL 4OF3A 4I18B 4JDVB 1DBAH 5SWSA 5I23A 1EQWA 1KBBA 1MF2L 4BWWA 1COBA 4PRPA 4Q9RH 4C8XA 2BNUA 3HG0A 1U92A 3CXDL 3SDXE 3UTSE 3HMWL 3G5YA 2CCVA 2F53B 4OJDH 3FFCE 4AMXA 5SX4I 1DQJA 5I24A 5E08H 4YSQA 1G7IA 1P6FA 1B3JA 4UM8B 4GSXA 4EEEA 4F3FB 3DX9A 1G9NH 5FV1L 5T1KB 1LO3H 3MV8B 2V3EA 3VXRE 4NO3B 2B4CH 2DWSA 1UB5A 1AGDB 1FDLH 3DVIA 2H6PB 3RWJA 3OJ2C 1ED3B 3B7UX 5IW6A 2AJXH 3D18B 32C2B 3U1PA 2WWMC 4F37F 2FQGA 2GSGB 2NTSP 3N06B 3U30B 4KO9A 4X4XB 3RGVD 4GQQA 2C9UA 1H0DB 3PAVA 2BH0A 3ECUA 4WO4D 5AG9A 3CDZA 2O26U 4L8SB 1RIVL 1CB4A 3OAWA 1U4EA 1AS8A 4S2SB 3B8YA 3HAEH 3GMNB 1ZGLP 3WIHA 1WAAE 1P2CA 2WY3B 2NY5H 2EZ0C 4HBQA 2Q8AH 5LJYH 1IFHH 2ZOLA 3UTPE 3EYQD 3TNNA 3NJLA 3T6XA 1BLNA 3DX1A 5KN5B 2VUOA 3X3FH 2ZXBA 2MOQA 2H0FA 4EE2A 4L9LC 3EH1A 4AEFA 4YAQA 4ZI8A 5JIQA 3DBXA 3HPLB 2QHRH 3VSQA 3BH4A 2LW3A 1JNNL 4AQ1C 5GGRB 2G75A 4APQA 4JFFA 3QWOB 4CAGA 2BNQE 2C7UB 3OB0K 1DVUA 4GBXB 1OW0A 2C9QA 4AG4L 2YQ2A 3WFDL 4TQIA 1S7SA 2P52A 3TZVB 4W4NA 2OULB 3GQFA 3SDXA 3UTSA 3BPLB 5IMOB 4Z0XB 3FFCA 2IXQB 1YYLH 2J56A 2NZ1A 4P5MB 2ZUYA 4PQXA 3K72B 5IF0B 2Z31A 3UPRA 2ZP0T 1M42A 2B20A 2PWHA 4DSYA 1JP5A 2NW3B 4FFWD 1HH9A 3VXRA 5DHVH 4KZDH 2V8LA 4PTTB 3WHE1 1C12B 1J1OH 1FL6A 4AX3A 5CLWA 3MBEC 3IJ7A 4XCYA 4LFHG 2RQ8A 4ODTH 2DQDL 2PO6A 2AQQA 3H56A 3K1DA 6TAAA 4Z7WE 2HMIC 3HI6L 1DEEA 4LIQH 4RSVA 3D87B 2BY3A 4YHMH 2VIRA 1JHTB 3NH7L 4JKPH 1WAAA 1X7QB 2R0ZL 3EOAA 1I85A 4EUPH 3GSRB 1UD3A 3HVDA 4HETA 1MFUA 1TQTA 1E28A 2DMCA 2FGWH 3HFML 1YEFH 5D1XE 3MRIB 3QJHA 1WK0A 1WBXA 3BKMH 3JSSA 4PGDA 3PPEA 4YIQB 3ULUE 1Q1JL 1WFTA 1A7QH 4YLQT 5T33L 4NT6B 1GTNA 2DQCH 3SKMA 3ZQWA 5G5DA 3DPDA 5F8QC 1AR1D 1CG9A 3D09A 2N56A 4JFXB 3R06B 4FXKC 2A6KB 4WHYG 3QRFM 4NOBA 3TN0C 1KEGL 5HXMA 3LHPL 1MFVA 3NPSC 4DAGL 2BNQA 4QOKB 3QZMA 2VLKB 1J18A 2KH2B 3ZRSA 4M7LT 4XN4A 4ZMLA 3EDDA 1HC1A 4ZAKB 1AANA 1YMMB 2XWTA 3DO7B 3CZJA 2ADFH 1A7PH 4X98A 5FDYA 2YQ3A 4GRWB 1SDAB 2R4RH 2YD1A 2UXVA 2A1WL 3CHQA 4NLHA 2WB7A 5E8EB 3ZK0A 3PWNB 4YS4A 4ZMOA 4XVJH 4X7FC 2AVFA 4JB9H 3WLWD 3P4NB 5I6XB 4KZEL 1IGYA 3DTXB 1YEIH 4NQCE 1JI1A 1BVKA 1BF2A 3QIWA 4QMEA 2ZOKA 2FSDA 4OZHF 1WZLA 4DOHB 1YEHL 1U2CA 5T1LA 4ZYKA 4QDGA 1XIWD 2FIKB 4BJLA 1MFDH 2W5PA 2RIKA 1P4IL 2BSTA 2FB4H 1KC5L 5JQ6L 4Z7WA 1CFTB 1E9PB 5TDNB 4Z95H 2YJLA 3FH8A 1HXKA 2VNCA 3OMZA 1GRWA 2B59B 3QH3B 1MWAA 3CVCA 1ZE3C 5D7KD 4U6HA 1MG2C 1BWWA 5J1AA 3JTBA 3LTVA 3WAKA 1YN7A 5F1OB 1BPVA 4Y4HB 2XTJC 4PREA 3V5DA 1CLCA 5D1XA 3K46A 2DQTH 3HHRB 1DJYA 2I9LB 4APXB 1I9EA 1M9WA 4IBVA 2IIJA 2FNBA 1AXTL 2G5RA 4R2GC 3QP3A 1R0AH 2ZXDA 4M03A 4NZDA 3AMLA 2C1PB 1A7BA 1P7QB 3GUTB 3ZL4H 5EOTA 4BSWA 4PCKA 5KYNA 2YPVA 5TE7L 4ZUWA 3FO9A 1DJWA 4L1TA 3S98A 5K9OA 4PJHE 2FDBP 1FNLA 3BIBX 3OAUL 4EJ1C 1CLZL 3K6DA 5DI8B 5C08B 3T8MA 4UTAL 3CVHL 1F02I 1Z9NA 3ZMNA 3FF7A 3L95B 4QLWA 4N9OB 2DY2A 1ZKAA 2VN7A 1T6WA 2WCSA 3PL6D 4PGBB 5I73C 1DVYA 2YRBA 4NQCA 3PP3H 1FVEB 3U46B 3I9AA 3LQAL 4WKZB 2PF6A 3MNZB 5DFTA 4OJCA 3L4XA 3CFEA 3L5WA 1CF8L 2YFNA 2Y5TA 1WZKA 4YDNA 2O5NA 2F1AA 3V95A 3H0TA 4M8QB 3O2WH 2X10A 4Y19D 3LRKA 3RX7A 3ZL1A 1DJHA 1EEYB 2M83A 3L45A 2DQIH 3PXJA 2Y7LA 2XA3A 1NFDE 4N2IA 3TPUA 1ZTXE 5GZOC 1ZS2A 3SY0B 5EU6B 1J10A 4PWEA 5JQIB 1BZ8A 4XPFH 4K5PA 2Y1VA 4MHHG 4FQIH 3CHSA 4K3EH 2HT3C 2LTQB 2R59A 4NUQA 1TIUA 2ORBL 4ERSH 5FAAA 3IVKA 4QRSA 3UJTL 2XZCH 4ABQA 2BVUA 2DBJA 3S5ZA 3ZTJH 4MMYA 2CMRH 1N19A 1PQZA 4UUJA 4QXUH 4XWGH 4OLVH 1T2QH 3VGAC 1A9VA 3H4FA 2FSEA 5DTFA 2FAUA 3FQ1A 1OARH 3ECQA 4TTDD 4YDVA 2XN1A 2ARJB 4LKCA 4MJIB 3KNBB 2OSXA 1KTDA 1TCMA 2V7HA 4MYWB 3IMUA 1EAPA 8FABB 4LCCA 1A9BB 2ZKMX 7PCYA 3JT0A 4XVSL 1OAUL 4PJ9D 1X4ZA 3RHWF 4PJHA 4NPYA 3KYMA 1JBJA 4JKNA 5I9QB 1A1OB 4UMSA 4J3OG 1Q94A 4YHPB 1WS8A 2KMWA 3G5ZB 5DLLA 1U6AH 2Y7MA 3LIUA 4F92B 2J25A 1JRHI 2ZCKH 2V37A 4W6YB 3SCMD 3L5XL 2R56L 1FO0A 4GAAA 4JQIH 5LQBL 3QRGH 4TSCL 3JWOH 4PJGE 4EDXB 3MJ8B 1NCTA 3LRSA 1BIIB 3QZWA 2WKOF 3ZT6A 3L4VA 2FJFB 2GI7A 2JKXA 4Y2DD 4PS3A 4BUGA 3EDFA 3RZCD 3QJXA 2N7AA 1O7DC 1NFDA 3HNVH 3ZTDC 3WJLC 4ZDHB 3HG5A 1NGPH 5EBLB 2EH8L 4N20A 4LQ1A 5C0BD 4B50A 2WKGA 2DWTA 3QXUA 4LLDA 1ZLVH 5IEKA 2OSLB 3EHBB 1MCCA 3DYOA 1P4LB 2CO2A 5E5RB 1I1AC 4HWUA 3WFBH 3B2VH 1IL1A 5CLYA 1NEZB 4Z0BH 3GJFB 5D7JD 3LN9A 4UNVA 4RBPH 3DXAB 3OD3A 4OIFA 4OIIH 1TJIH 5H2BA 1EEZB 1S7TB 1TXKA 3QZWG 4EI6A 3WU1A 3KVQA 5L9DH 1Q9OB 2VLJE 1H6UA 4A2DA 5F3FA 4IU3B 1MIEL 1D5IH 4U3SB 2J1YA 3ML9A 3FB8A 1EH9A 3QXWA 3QXDA 3B2DC 5L88H 1ZJAA 4HC1L 5DEGA 5J56B 4E41D 1K5WA 3M8OL 4OZGF 4M62H 4L9LA 1MLBB 2CJTA 1U8CA 3JV4B 3G6DH 5DS8A 5KYYA 3T1FA 1KTBA 2ILLA 3HC3H 4L3ED 3ZZQA 2WPGA 4FG6D 4AMKL 2I60L 4GEJA 2J43A 5AW5B 1H3WM 1U8NB 4MNQB 2C9RA 4WGKA 2HLFD 1XGQB 2AQ2A 4MA3B 4PJGA 1XHHA 3SKUD 1I82A 2IPTH 5DEZA 1EEUA 1F58L 5JTWA 1IAKA 3SPVA 2E7BA 3KLQA 1UADC 1IAOA 1RP9A 3PIQB 2QVIA 2G0KA 3IRCA 2N01B 5CMAB 4YHOL 2SEBB 1HYSC 3NSFA 1G7QB 4HVBA 1IGCL 2DWYA 5DUPH 3B2UD 3O8XB 2GUOA 1JMZA 4WK0B 3BT0A 1OHZA 3O4OB 4MLSA 4LXFA 3KBEA 4N1EA 4W70A 3ZE1B 4CSTA 4JDEB 4NZJA 2IWEA 3M86A 2GSIB 2R15A 3KXFE 1RU9H 5A6IA 5KBKA 1ZPUA 2HWZH 5BO1L 2P49B 1Z9SA 5I30H 1YNTF 5JORA 2XFGB 4FADA 1TT6A 4NRZA 3SOBL 5AZ2H 1ORQA 4WW1B 2BVOB 1S6NA 2FVNA 4U7KA 1JE6A 1CMOA 1NDGB 3QSKB 3HE6D 1EANA 2YD6A 5E94B 1KV3A 5FHAH 3TV3L 1YY8A 1DVFB 3T4AA 3UJJL 2NY3C 4F24A 1G1OA 1HVXA 2VDNL 2VLJA 4QRAA 4BBWA 5TH2A 3FCGA 4XMTA 1ZLSL 2WINA 1I9IH 4LKXB 5FM4A 4DGVH 3HBQA 4FI6A 3PABA 3D06A 3GSVA 4JL2A 4LU5H 3FCTB 5DHMC 3EOBB 5F9WC 3WTTA 1NCGA 4O4YH 1KLFB 2FLRT 2R2HB 2GJPA 4PWJA 1ZK5A 2BIIA 4X6CF 3O2DA 3QWQB 2GW5A 4TULH 4A2HA 4FXKA 5FGRA 1R24B 4NZRH 3TN0A 3TO4B 1LNUA 3LYRA 1J8HB 4BDVB 2IMNA 3V0JA 3BGFB 3INOA 3QHFH 2IPUG 4HFUH 4MDJB 4UQEA 2IH3A 3V0DA 5IV2B 2FIRT 3F7LA 1DYZA 1EHAA 4QTHA 5IQMA 1IT9H 3DMMB 3P69A 4K94H 2WNKA 4PRHB 2IPUK 1OOWA 4YX2L 4DKTA 1MAJA 3EW3B 5ERWA 3OTTA 2R4SL 4HEME 2AMUA 3JZYA 3NJMA 1D2OA 4FKHA 1P69B 3FO2A 4HHAA 4Q6IC 4U4BA 3UEQA 4BFIB 3V4PH 4EIGB 1ACZA 4EQ3A 3RDTD 3KXFA 2GK0A 4W1TA 5HY9A 1M56B 4J3BA 5MEND 5FOBA 3RIFF 2W8CA 1J7VR 4Q9BA 3GKWH 5EEZA 4AQAB 4MCZB 4RMVA 4I9WE 4XO4A 2QKIC 1FH5L 1S78C 3Q3GB 4AQOA 1J9TA 3BQUB 4FXLA 4UDTA 5JMRA 4GT0A 4Z7NF 4IRJB 1AZVA 4QNPE 5G55A 3AM8C 1UWEH 2Z7YA 3LRGA 4NQED 2W88A 3N04A 2Y7OA 4LLVA 5SV4A 2B0SH 2VDML 3FQWA 2A77L 4HJJH 3C2AL 2HFEB 3TYGH 5HDLA 4AYFB 1NLDL 5INCB 2NY2D 3EKCA 3UDWC 4XZUA 2DL2A 2R7EA 2BVPA 2F7PA 2E9WA 1UATA 4JFVA 4PN6A 3WKYA 4KI5F 2EYTB 4P5TC 2WXIA 3JXAA 5IHUH 4PMEA 3NGBC 4KOCA 3A47A 4NN5C 2XV2A 5D55A 3ARUA 5IKCA 4UTBL 1T66D 4QHPA 3EGXB 1P4UA 5LGKA 4MMZC 5FK9B 4Z7VB 5D93C 4NNPH 1G4RA 4KTDH 3MNVB 3I6KA 3QR2A 4ZUVB 1SJXA 1W8EA 3VDCA 2G2RB 2JQMA 5IHBA 3W9EA 4ZFZA 4G7RB 4KXBA 4D94A 4DN3H 1OXYA 2GAZB 5H94B 4ISVB 2AK1H 3P77B 5HYJE 2QQKH 1T2JA 3KL0A 3MLSL 3JWNH 4HEMA 2I5YL 3L1OH 4YFLI 1LO2L 3VXNA 1J8SA 3HUJE 3AUWB 1J1PH 4PGCA 5ESVB 5AEAA 5EBGA 4EDWL 3K0WA 4KNQA 5ICUA 4DGYL 2HZHA 4R83A 2VCOA 1UCBH 3K6OA 4P23C 2YWZA 1KZQA 3SIKA 2FJGB 4GI9A 1O7DE 3LKNB 1GKEA 4OLWL 4OCRH 3QQ4B 3ZT7A 2F53D 2EDWA 4DJMA 3GHBL 5BS0B 1GGCL 5IFAL 2FO4B 1IQDB 1XZWA 2R0KH 3QULB 4O02A 2RFXB 4H0GA 1LWHA 2CH8A 4K3JL 5T1KD 3UPRB 3GMPA 3MV8D 4G6KH 1URLA 3RJQB 4C83A 4PSPA 4QJ5B 4A1RA 4TQ8A 1QBBA 2JVUA 2OI9B 4X8JA 5KSAB 2WLLA 5TQ0H 4Z7IA 1EXGA 1WF5A 4M4RA 4NFDA 3Q5TA 4G8GE 3TBYA 4OZGB 1EAQA 4DN4L 3AXHA 2WYHA 3PJLA 5BVJA 4HQQL 4D9RE 3SPGA 3STZB 2DV6A 4ZUSA 4GXVH 2ETWA 1AJ7H 2F7RA 3NIGE 3H9HB 2H32B 4K5OA 1IO4C 3KM2A 1G1KA 1NFAA 3FFDB 2BRRL 4C56B 5FYJD 1OL0A 1ETZB 4F7PB 1IKOP 1QBLH 3FQUB 4JM2B 5DZVA 3S35X 5IVNA 4E9RA 1MJUH 5HYJA 4QRTB 2DQHH 4WFEE 1OF2B 4YC2B 1ZS8B 1PZBA 1CQYA 1E5BA 1HCFX 4M1DH 4U0RC 1E7VA 1CD8A 4A2FA 4X7SL 1KIQB 3EXJA 1FL5B 4LVNC 4LEXH 5C0AE 5T8IA 1CICA 3DVFA 3TBTA 2Y24A 2H1PL 3D39D 1MPAH 3HUJA 3COOA 2H3NB 3HC4L 5L4FA 3L5HA 2C3VA 3RA7L 4NB7A 2GBUA 4GBXD 4GUPB 1Q38A 1WBYA 1RUKL 2YPKB 3BHBA 1GGYA 5FYJH 5FB8A 4DP2X 5CBAB 3TZVD 4F33A 3LIZA 4Y2LA 5AOMA 4YSUA 1G7HB 5C2BH 4GMSH 4Q97A 3KYAA 1KGYE 1SMOA 4HIIB 3U4BH 5DD5L 3ZT5A 3CFMA 3BKJH 4X4ME 25C8H 4FL4B 1E8XA 3VM7A 3UYPA 1I1AA 3KPOB 4R4BA 5F9OL 1DSFH 3BP5A 3S5YA 2BFVH 2BHZA 5KVFL 3HLKA 3BX7C 4JKWA 4RGNC 5EU3A 5I71C 3DROB 2BOBB 3RGVA 1VIWA 4I77H 4ORZC 4WO4A 3NYKA 4G8GA 2OTUB 1BQKA 1RI8A 2WXPA 1JGEB 3NT0A 3PWVB 4Q9RL 2VXSL 1F56A 4ZX3A 3GLAA 4X6CB 4G8EA 3SQOH 4WWKC 2VDKL 1OT2A 1TJGH 1JGUL 1HTYA 1J8KA 1IUZA 3RWEB 3D0LB 4JPSA 4JHWH 1JWSB 2PKDA 5JW4R 1FDLL 1QRNE 5HHPA 1F00I 4M02A 3MYJB 2QPSA 4Q0XH 4XMPH 5AUMA 5B1CA 4NSKB 2YUWA 1SJEB 2FECL 3TTSA 2G2NA 5ABZA 2PP9A 4YDLB 5LN8A 2HG0A 5KSUA 5G4MA 4N8UA 5C0AA 1E4XL 2EXWD 1TEFA 4LNRB 2APFA 3RFZB 3WNMA 4BKTC 4TVSa 5CGYC 3O3DA 4GQ9H 3V0EA 4CC1A 3C5JB 3HG3A 1VF5C 4HS6B 2ZKXA 3N91A 3QZPA 5E4AA 1IFHL 1HKFA 3ABGA 2NXYB 4N0YH 3KCPA 3WIIH 2OYKA 3UP1A 2L0DA 4FQPA 4FZ8H 1U8KB 1YMMD 1NGZA 2N1TE 2VXQL 3X3FL 3D07A 2VQ1A 3SBQA 1UWGH 4O00A 4PJ8C 4Z7NB 3SBWA 2AJYL 3PWUA 2QHRL 4X4MA 1DQLH 3DPBB 1T1YB 3SY6A 4NM4L 1PS3A 4LSDA 4L37A 3OR7A 2BOLA 4XP4H 4QI3A 2RTTA 4H1LA 3E8VA 4WWID 5L4JA 3FKUS 2DEXX 1VHPA 4JG0H 2N3JA 4JN2B 3WE1A 4FQJL 5J6GB 3QPQC 2Y9RT 4YHYB 5D1ZB 1EEQA 4LCVA 2UY6B 4OCWH 4Z8FH 4N22A 1A3LH 1ZT4B 1YYLL 1A7NH 3IFNL 1UWXH 3NCJL 3SDDB 2DICA 3QC5X 4GRWH 2ZF8A 3DUUB 1G7PB 4NN7C 1YEDB 2B2XH 4E9LA 1E8ZA 1QRNA 5FYLH 2OPCA 1NCWH 4NQVB 4Y4HD 1J1OL 3Q05A 3CDGB 5AVSB 2E74C 3B9EA 4JRXB 4JY4B 5TDOA 5HYSA 4ODTL 4FXGC 1WEJH 4BKLA 2B7DT 4H1LG 3FT4A 5T1DL 4KPHH 5ALBL 3FSVA 2YAEA 4LIQL 3MA7B 4UDUA 4PJCE 1OZTG 1P7QD 1W9XA 5A2IH 3JTSB 1PG7X 1ZA3B 1TQUA 5F7BA 1CGSH 1G7JA 3POCA 3IXTB 2V2TB 3TFKC 3X11B 2BC4B 3VQ1C 2VE6B 3ATDA 2FGWL 4RQQB 1JERA 3SE8H 1YEFL 2VW4A 2BZ7A 5E1AA 3BKML 1R3HB 4P3CH 4IBWA 5C08D 5B3SB 2VMFA 1K3ZA 4Q6IA 4G1MA 2DQCL 4GSDH 2X87A 3VD1A 3I6GB 3VGFA 4RCAA 5DFVD 2CWRA 3S0PA 1BD2E 2X4QA 4ODWA 3HBGA 1V7MH 4PWKA 3ARBC 3DVNB 3NDYE 1NAMA 3GBDA 2X6BA 5DHYA 4Y19E 4Z3IA 4ZMXA 4JVWA 4L3FA 3AM8A 4L4JA 3BVTA 4LSRL 1RK0B 4XNAA 4AK2A 5AWNL 2V17L 1CYWA 5AAPA 5IIEB 2R69A 2R4RL 3L4YA 4DO5A 5EU6D 3L1EA 2ZOOA 4G72B 3NIFB 4JB9L 5EORH 5AOZA 1JF6A 2KDGA 4KQ3H 4P5TA 4UQAA 4M43H 5EC1A 1RUMH 3VYOA 3N2JA 2FX9H 1Z0MA 4FQ2H 4HZLB 3VH8G 4P4KC 2D03H 2HJFB 3GSWB 4JPIB 4F2ME 5KYYB 4AV0A 4P9HH 1MFDL 4UOJA 4FMKA 4TUKH 2FB4L 5D7IF 3A23A 4Z95L 3OJDB 5K1JA 4RGMC 4PJCA 2YUXA 4MNGB 4WSKA 2D2CC 1QFOA 2AJUL 5I0WA 3Q1EA 4N2NA 4JO5A 3SOTA 3FOMA 1RQ5A 1F41A 1BQHB 3NCFB 3ISYA 2ITCB 2HTLD 3L9EA 1CDHA 4QUOA 2IWKA 1A4CA 4XWOD 2E9GA 2IV8A 3OMNB 3QNZB 5FO2A 4WFGD 1ZSDB 5KW9L 1DDHA 3TT1H 4P2RB 4QRPE 3VGBA 2DWEA 4OGAD 5EWIH 5IHLB 1TZHB 3DA0A 2PLTA 4A37A 2AC0A 2GBVA 4JM4H 3CDYA 1BD2A 3ZL4L 4ELME 2UWEF 5D2LF 2HG5A 5KAQF 4ZTOH 3KWUA 4Y19A 3V6ZA 4PRAA 3FB5B 4N0FA 3CJJA 4G80A 4PRNB 4MXWH 5C0BE 1XF5A 2PR4H 1A6TA 1WPCA 1GR7A 1W15A 3FSZA 3QUKA 3GEWB 4N86A 3IBOA 3RB7A 3V5HB 3D2UB 1V55B 3FB6B 1CGTA 4PY8I 4YEFA 1GZPB 1HOCA 2R2EB 4MS8C 5CFHA 3EHBD 2XNAB 4RGOH 3WEXB 1DUZB 4JFDB 1EZVY 3VFUB 4RX4A 5F93C 2NXZB 4RGNE 2VMCA 5D71H 2V2XA 5MI0C 3FUDA 1B6DA 1NANH 3B5TA 2CKBB 3AU1B 3QQ3B 5EO9B 3G6AB 4F2MA 4HLJA 3ULSA 4XNQA 4HUWB 4OFPA 4U31A 1S7UB 5FDWB 5MEQA 3O2WL 3DXAD 4MAZA 1VGEH 2DQEL 2DQIL 4MAUL 2Y6TE 3H2QA 1HAUA 3T04D 4X0KA 1JZFA 2VL5A 3HRZB 3LKOA 2J5LB 2AQRA 5I6LA 1GSKA 2W9DH 3IYLW 1RP8A 2V2WB 4JUTA 1O7VA 5ITFA 4KVCL 1QX1A 3VXOA 4E41E 4ERSL 3QARA 3CN4A 1GZQB 2DJSA 2X4OB 4JKKA 5DF0A 5ACMA 3ZR5A 1G1CA 4XBPB 3T77B 2WGXA 1AQKL 5F72S 5BV7L 5ACZB 1IQWH 4XBMA 2JLPA 3VG0H 4Z7UE 1XBRA 5J13B 1L0PA 1KLUB 4QRPA 2WW8A 3M88A 4ZW3A 35C8L 1LP9F 3GJFH 3RL1B 4MNQD 2CO1A 1TVBB 5IUCA 1NCBL 1OARL 4I3SH 4NBZB 4GSUA