2BIHA

Crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
453
structure length
453
Chain Sequence
PFPVRQDSPLTEVLPTDLKTKDNFVARDPDLLRLTGSHPFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
total genus 137
structure length 453
sequence length 453
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bihA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2bihA01
1XDYA 2CA4A 2BLFA 2A9BA 4PW3A 1XDQA 4PW9A 2A9AA 3R19A 2CA3A 3HBPA 1SOXA 2XTSA 2A99A 3R18A 2A9DA 3HBQA 2C9XA 2A9CA 3HC2A 2BPBA 2BIHA 3HBGA 1OGPA 2BIIA
chains in the Genus database with same CATH superfamily
5BRQA 4XVJH 2OS7A 3BKYH 1KFGA 3ZL2A 5JW4R 1DQDL 1TZHB 1NGYB 1EEYB 4AEIL 5LNDA 4QTFA 1M53A 1XSOA 3GHEL 3HE6A 3K46A 1H3XA 1IGFH 3P73B 3LZOA 4NM4H 2V2TB 1A6AB 4OUUA 1TQCC 4U0QB 2Q8AH 2HLFD 4E5XB 3MLYL 3MO1B 1KIPB 4N2OA 5FDWB 4BH7B 2WLJA 1KN2H 1U92A 5TE6H 4JO4L 1F42A 4EOWL 3D69B 5C07B 5FYLE 1IGTB 5L9DL 4Q7DA 1IC4H 2NCMA 2HVJB 3Q6FA 1HH6B 3ARGA 3DTDA 3UP6A 3N41B 4QRRB 3MUJA 4GT7A 4K7FA 4ZXBC 4EIGB 4NQEB 2X12A 4LCUA 1MHEA 1BFVH 1PLGH 2ITCA 3EUUA 4I3SL 5DHDA 5AAMC 1HC1A 4AEHL 3JTTB 5DHYA 1BF8A 2IBZY 2QKIB 3FZUD 3FF8A 5FF6B 1JUFA 4KRPC 3TT3H 1EANA 3FO1B 4HPOH 5HVWA 1EK3A 3QG7L 5KW9L 2X89D 4P4KA 1LTXA 2A74B 1TJGH 5GGVH 3T65B 1NAML 4B9ZA 1IT9H 5I28A 5TE7L 2CD0A 2CK2A 3MRLB 3W39A 1BG1A 5IM7B 2F53B 3J8F7 3GSQB 1PG7X 1MEXH 5KSAA 4YDZA 5JZ7C 1T83C 2WXPA 5EF2A 4PLJD 1GIGH 4XVTL 1DO5A 3B9AA 2K6WA 1S5IH 1JHLL 4J2XA 2ITFA 3MRQB 2FBJH 4L23A 1A6VH 2R0WL 2WNXA 1G0YR 4JFSA 4I9XA 1KGUA 1FP5A 2VLJA 4CMHB 3B9EA 3UAFA 4JCWA 5DD6B 3HHSB 5FW6A 5CGTA 5GGSY 4ELMF 1JI1A 2VMDA 5IK3B 5EU4A 5JHBA 3OLEA 4PJ7F 3ZDZB 1IQDB 4LBEA 2EXYC 1GY2A 2MHAB 4RDQF 4WNQA 3X1FA 4PGEA 1NFIB 1B4RA 1F6LL 4MMYA 1I7RB 3VFVB 2O26U 2FT7A 4LFHD 4P9HL 2DM7A 4YDIL 5CR1A 4G8AC 1GJUA 1NLDH 2QJDA 4TKWA 3UTTD 3V0FA 4JJ5B 4M1DH 1VACA 3GDBA 2AZUA 1IGCH 2FH6A 3C87A 2IOOA 1DBJH 3P9LA 1HAUA 1D2OA 1M42A 3EFDH 1IM3A 4FQHB 4JKPL 12E8L 1Z5LB 4YK4C 4YX2L 3UYRH 5K69A 4XB3A 3NH7L 2ZUTA 2ZSWA 3H3PH 2E4FA 2HFEA 1N3NA 4OLUH 2ZYSA 3U79A 3DROA 4MZIA 3JWOC 1NBCA 4X42A 1X5GA 1JPTH 2Y2TA 4JKWA 3QJHA 5KSUA 2IQAA 2FO8A 2BXZA 1XF2A 2V7HA 3NRFA 1INEL 3B9KA 3L3KA 1T3FB 3M45A 3OJVC 1FSKB 4FFYL 2R69H 1S3KL 3C5ZC 3AU1B 3QQ9D 1GTFA 1TSHA 2W65A 3HHMA 3CZJA 4PJDB 4HPYL 3KXFB 2BSSA 2LGNA 5KS9B 4LLYA 3NGBB 4PJ8D 2E4TA 3EG9A 3TFKC 5HYSG 1NEZB 4J8RA 1MAJA 5LCVA 4ODSL 3SO3B 3WTYA 4YPGB 4WO0A 4MMXC 5INCB 4NQCD 2YAFA 5DQ9A 3PF2A 3U30C 3EF7A 2ENPA 2QKSA 3R06A 3RTQA 3LNEA 2YZ8A 3BJ91 1BD2A 4M62H 2KZ1B 5E8PB 1QSED 3GPEA 2IANB 1OT2A 5BOJA 1TETH 2WBKA 1T5KA 4JFTA 3SKNB 1U8KB 4NERA 2XYCA 3SBQA 5EU3B 1VFMA 5C8JB 3CFUA 1I1RA 3EJYD 3MOAL 2M2DA 5F70A 1PQZA 4NN5B 5DVPA 4KH9A 2OW6A 1ZGLA 2PNDA 4WSKA 4LSSH 3ZE2B 5IJKC 2G3ZA 2YD4A 3GMQA 5CMAB 1TQTA 2VDLB 3QVAA 4FFVD 5DJ8A 4PCKA 3ZKQD 4F80A 1X5MA 1JNNH 4B5EA 5C0CB 1O5PA 1NBYB 3WIIL 4PJ9A 2A73A 4U1JB 3D4YA 4FYQA 3MV8B 4AQAB 3KPSE 2YA2A 3P69A 4RBPK 4TUKL 2NY0C 5AOJA 4FFZH 2ALWA 5DUPL 5ESQB 4CJ0A 4FHKA 4ZZKA 5C0ND 3QRBA 4NQSB 1F90H 5EU7C 1WEJH 3GSWA 4HMCA 2UUDH 1M1XA 5EEZA 2FWOA 1BPVA 5E2JA 2FX7H 3X2QB 4UTAH 3AW5A 4TULH 5EUKA 2R1WB 3HG1A 4NO0D 4MD4B 3EYFB 4PWHA 1HOCB 2XJKA 1CGWA 3RAJH 1MW3A 1YHPA 3RHWK 5CZRA 2FSDA 3KWTA 1E28B 1XIWC 3Q3GA 1R0AH 5IQNA 4PWFA 4PJGA 1S9YA 2WXQA 3GXTA 2ZYIA 3EGSA 4OCRH 3H42L 5DMGD 3S35X 3KPMB 2H5UA 5E2VH 4P9ML 4UNIA 3KJ4B 4YDJA 3WLWC 3CK0L 2XFXB 1OE2A 4FZEL 3V2AR 2PYEB 2LT9A 5K93A 1DUZA 3LZRA 1XGUA 2DLTA 1I1AB 5DQJB 3PQYE 4F7TA 1JZ2A 2DM4A 2Y36L 5CD5D 3B3BA 3GGWA 1UB6A 2IADB 3TV3L 5IHHA 4IBWA 3DJ9A 1XZ0A 3CLEH 3MGTB 4FJZA 5SWZB 5I6LA 1D3CA 1IAKB 3FO2A 5K59E 2BPBA 4JEGB 4FG4A 2ARJQ 3BWSA 4J4PD 1RZFL 1HKFA 4JRFA 3S3CB 3A3YB 4AYID 1IGMH 4PRAB 3EYVA 1FL6B 2XV6B 4FNSA 3WNLA 1SOQA 2OCCB 3B56A 2JLPA 3FCUB 2IWKA 5CLWA 3BGMB 1ZTXH 3MLWL 4PYGA 5INDA 1SVCP 1FC1A 1DVTA 3ATEA 5KBNC 2VLRA 2IGTA 4M7LH 4JPWL 5EORL 1HHHB 5D1QB 3C5JA 2DYPD 3GF8A 3OKYA 3ZTNH 5F7UA 1CF8H 5F9JA 4WWID 1XCTA 1CICA 4KK8C 2K4WA 4LF3A 5IVXE 2DI8A 2QMKA 4KZEH 2DEYX 4HIEB 3ABGA 1UXMA 1AYOA 4ZUVA 3ZSSA 5B1BB 1PX3A 4UIMB 2ZJSL 3H9SD 4XNUH 4H8WL 3PABA 4FQQB 1WAPA 2F58H 2JCWA 4KMTL 2EVFA 2AEPH 1G9MH 4GJTB 3GZOA 4YO0B 3QZMA 2OMUA 4P06A 3AU0A 1T7XA 4BFBD 2B59A 2R69A 4G8GD 5DT1L 4FEMA 4K7PY 2QHRL 3LTVA 5E5UB 3L3DA 2JQMA 1QUNA 1EO8H 1CYGA 4MCNA 3GO1L 3SPGA 4PS8A 3UGUA 5JIMA 4M8UA 3QDMD 5FHBH 1WDAA 2C5DC 5DJ0A 3FT1A 4G80A 3RKDC 4B5ZA 1L9OA 3LRKA 3L3JB 3VXRB 5C08B 2XG5B 2XWBB 3IXTA 5D4HA 1LEIA 3ZQ9A 1OP5H 1PNCA 4DP8X 4XP9H 1JPFA 1F02I 2AS5M 2Q7AA 1J12A 1OWRM 1R4XA 4MMZA 4CN6A 2VDMB 4KAQH 1WFUA 3V4VB 3QWQB 3NOIA 1UWXK 4MA3B 3QRGH 1QSFB 3KBEA 4DO5A 4OGYH 2VERA 4YXLH 3U7YL 1OAXH 3FN3A 3WENA 3PWUA 2FD6L 2EACA 3Q9QA 4GG8A 1D6EA 4IU2B 3MFFA 4IW4C 4XP1L 5I0WA 1JZ8A 1T04B 5DCCA 3A4EA 5D8JH 1F1DA 2IH1B 4X99B 4ATTA 3CMOH 1UKSA 1E27B 5DRXA 2NY4B 4HWZB 1ZT4A 1S6NA 3LD8C 3O45B 4LHQB 3S35H 5FGBA 3TN0B 2JCCF 3DSFL 3O4LD 3QEUA 3F12B 2I24N 5K1JA 1ZHNB 2VZOA 4JG0H 4EIUA 5AAPA 1N0XH 1E6JH 3DVNB 3SB3A 3BW9B 3O6LL 2H8PA 4UCFA 1OQXA 2BMKB 2EH7H 4AYSA 1YC8A 1R3LB 1YEGL 1RZ7L 2BX5A 2WQUA 4YGAB 5K9OA 4AKPA 3P3TA 4OV6F 4CBZA 2VAJA 1D5IL 1E5YA 4WW2B 3VGAC 5I1DA 1KIUB 3O3DB 3VAEA 3MRGA 5I18H 1BAFL 5HPMA 4U1MB 5GRVL 4MQSB 4QTHA 5I73C 1NEPA 4JFFA 3MCKB 1YYMH 2WBWB 3DGDA 4NZRL 5AVVB 2VNCA 3WHE1 5C6WH 4PJ7A 4YE4L 4OZHE 2EVIA 4PJXF 4N2BA 5K9JL 4I1RA 2F54A 4LHUD 4Y9EA 5F7EL 4X5WB 3F6IA 4Z0XA 1VPOL 4IS6B 3WXVL 3UO8B 3VFTB 3EFOB 3U2SB 3GXPA 3CN1A 4XBEH 2IPTL 5IB3A 3VGHA 3PLYA 3LQMA 4FXKA 1Q1JL 5FKAA 5KYXA 4RAUA 3KVDD 4LDCA 4YHPA 3QPKA 2KL6A 3CHSA 3HJ0A 4JRXB 3QIUB 2ID5A 2XZZA 3DJRA 4Q4EA 3SE8L 1CLYH 5ACZB 4TPRH 1MWAA 4LVOC 3V4VL 4LVEA 3QYCA 35C8L 2Y24A 1R3IL 2EEBA 1OW0A 4YQXH 2HKHL 4XNBA 2BVPA 5TDPA 4QO1A 3TH2T 4MLSA 4WUUD 5F7DB 5ADPL 2DQHH 5IKCA 1QBBA 4IGBA 1WVZA 4I18C 2OZ4A 2WZ5A 4L8DB 3QDGA 3VFGL 1Y6KR 2O6DA 1CMOA 1JMXA 4ALAH 1G6RH 2IV9A 3ZKMC 1FQ9C 3KEDA 5D7SH 2RH0A 3CXHJ 4TV3A 4XI5D 2BSEA 2VAAB 3HMXA 4AT6A 1JPGA 1I8KA 2AK1H 4XNXH 5AOKA 3LMJH 5BMFL 3HI6H 1HL5A 3CVHL 2LFGA 1LE5A 4GRWE 2FJFB 5A43C 1MLBB 1ODAA 5GIRB 3CLWA 4R26H 3BP5A 5EOQL 2AQSA 1EBPA 3H56A 3GIVB 4MX7B 5DZOA 2A0LC 1DZBA 3BUQA 4WHTA 1A6UH 4H40A 4M61A 3WY3A 1FN4B 3RVUC 3NIDB 2RA1A 5F2FA 3N9GL 2WXOA 5E99H 1RHHB 1LEKB 4NBZB 4Z78B 1HKLL 5D96C 3TBBA 4OCYL 1IFHL 2Z7UA 1J0JA 5FLUA 1MCKA 1D6VH 5FYJD 2A9ML 4JN2A 1FZOB 4DZBB 3LIZA 2X1OA 4N86A 1KCKA 2CCVA 3ARTA 3FSOA 3EO1B 2G75A 1YEKH 3KPTA 4BSJA 5GS0L 1UB5A 2BIQA 1SRDA 2X2UA 4S2SB 1FL5A 3QQNA 1W0VA 4NQCE 2B14A 3R8QA 1NSNH 2GC4C 3GPSA 3QZPA 1RIHH 4B6ZA 1H5BA 5I1IL 1WH0A 1QSEE 2EZ0C 3OJDA 1S9VA 1DN0B 1MOEA 3KLQA 2NY2C 4LL4A 4Z5RB 1BMWA 4P2YA 2YXVA 2AKRB 2W0KA 3RY6A 2HWZH 2FHCA 3D48R 4Y4HA 1XF4A 4YHYB 1UG9A 3M17B 3BX7C 4PLKD 4PWIA 2VDKH 4NUGH 3VWJC 1FORH 1IBGH 4HS8L 4NX0A 5MEPB 3VACA 3QXDA 1L6XA 2EO9A 5EZIL 3GFUA 1MW1A 3GRWA 1SN2A 2B1AL 4F8NA 3MJ7A 1JK9B 5HYJB 2ADFH 1LP9B 3O6FC 4QT5B 1B9ZA 2HX8A 2AMGA 3NA4A 3D50A 3CHOA 5I1AA 2B08A 4P5TB 4Z7OF 2VLKB 3TBTA 1W0WA 4V2BA 3MRJA 2DPKA 4JGUA 4DGUA 1KELL 1EAJA 2CUMA 3EJZC 5IGXL 3NACH 1FL3A 3T09A 2NY1B 5B22A 4JMNA 4DERA 4RNRA 3ILEA 2WYTA 4IDJL 2GTQA 4LQ1A 1D2PA 3PG2A 2A1WH 2OLDA 3CQPA 3A5VA 1S78C 3MLRH 4QHPA 2VE6B 3ULVC 3BQVA 4R2GB 2P26A 2O72A 1GGBH 3NZ8B 3TO4D 3HPJA 3HE6B 3QO0A 4AGPA 4XOCA 5CZVL 2APXA 3P0VL 4Z9KB 1P7HL 3CIAA 2UXGA 2DJMA 4OUUB 4W93A 3DTXB 1WSST 1A1NA 1JP5A 3BZDA 4K94C 4MQTB 4PU2A 2LTQC 5J6SA 3TGXA 4N0FA 4M4PA 2WUBH 2XFGB 2W95A 4M9PA 2R2HA 3BVNB 1ODUA 3NFSL 5C0DA 4GUOA 3FONB 4ANXA 3EYQC 1ADQH 5I5RA 5CP3A 2OW7A 2J8UF 2C7UA 3HZ3A 3ARGB 2D31A 2EILB 4JFPA 2ERJB 3FT4A 4K7FB 2FTAA 4LCUB 2HCZX 2ITCB 2F9BT 4MXWH 5CN2A 1G6RA 5DHYB 3EXLA 3A6BL 4U3CA 1ZVSA 1SXBA 1JUFB 1IV8A 2HP4A 5FFLA 5T1DH 3BI9X 4OZFG 1P5UA 2G2RB 5CIPA 1MREL 3WY2A 4P4KB 1AR1D 4FQXD 5D7LD 1E2WA 2PR9A 5I23A 2P1YA 3PDOB 4XMKL 4JFYA 1NBZA 1KB5H 5GRYA 1QAWA 2WBJB 5DRZA 1ZLVH 1B6DA 5KSAB 3P11H 5L6YL 4Q9BA 3H9SE 3BT2H 2V5MA 4U6VL 1DVFD 3D3VD 3H6AA 3VFPA 4QDGA 1JGDA 1R19A 2WSKA 4DEPC 1WCQA 3ARWA 3NJHA 3RPIA 4BQ6A 1CL7H 2GQHA 2XQBH 2K1MA 4OTXL 4O5LH 1CD9B 4G8GE 2VLJB 4M8QA 4Y1AD 2Q3ZA 3OLDA 2Y72A 1M4KA 3LPFA 5EU4B 1LO2L 2LVCA 2B1HH 4HHGA 2R7EA 3QDME 2H6PA 1S7TA 3TS8A 3H1ZA 4PGEB 4NYLA 3F64A 2VDPH 3NDYE 3ABZA 1AI1L 3AQYA 2RTTA 4MMYB 3UZVA 3WTVA 1FO0B 1U3ZA 2NY7H 4GP8B 3QS2A 3QFJA 2HRLA 2BOCA 3GXNA 3P4OA 5GISH 4EN3C 4F8PA 2JCCA 2J5LB 2X9ZA 3P9LB 1GW0A 5L8LB 1KXHA 1HHIA 3EYSL 1IM3B 4KRLB 2PCXA 4YMPA 3H2PA 3ZLQC 1HZLA 2FEEL 2ZSWB 2WZ0A 2HFEB 1N3NB 3DROB 3KPQA 1UZ8A 1HX0A 3OC8A 1YRKA 4RGND 4IOFC 4G59C 4WKZA 3KPLA 4IMLA 3VGFA 2NYYD 4LSVL 3WFHA 1TJIL 3L1GA 1KCVH 3TJEL 3QJHB 2Q7YA 2KYIA 4BQCA 2IQAB 5I0ZA 2BY0A 2F8IA 2EDWA 1XF2B 1M7XA 2CUIA 2V7HB 4PJXA 1KB3A 5DURB 1TQUA 3B9KB 2E6JA 3L3KB 2WD0A 4L1SA 4MMXA 4F7MA 5DS2A 3O4LE 1WD8A 1ORSA 2WWNA 2YRZA 1I3RA 1AH1A 1ITBB 4MNGE 4APQD 5T1JA 2L7EA 2W65B 4QOKD 3EIFA 4QYOA 3MR9A 2WW8A 2YJLA 2BSSB 4FS0A 4LLYB 3RWGA 4EKXA 1LILA 2J4WL 2HB0A 2BW4A 4R5VA 4AMWA 1V3JA 2F7OA 4J8RB 2E9GA 4Z7WE 4NKIH 1B0WA 2BCKA 3CIQA 3D39D 4LDEB 2DQEL 2CJSA 1H6EA 3G08A 3FYIB 4KO7A 5DQ9B 5IJKA 4PV1C 1KXTA 3RTQB 3DPBB 1D7CA 1JERA 2WYZA 2QADD 4EUPB 1BD2B 3F83A 3JZYA 4PM1A 4Y5XC 3BO8A 1IM9D 3PAVA 1RUKL 2UY7A 1MAKA 2BJMH 2QPUA 1F8TH 3DPDA 1D9KD 4KXBA 3OSKA 1Q4NX 1UM4L 5IQ7L 1F1GA 1ETB1 1RU9H 1RMFH 4LSQH 1PQZB 4N9OB 1CI3M 3FHEA 4XN5A 4ZOAA 1ZGLB 4GEJA 5CCHE 5IFJA 3T8MA 5GS3A 5I19L 4GKSA 5AB2A 3OD3A 2QDVA 2JWYA 5DJ8B 4FJ6A 4NKMA 4EZKA 4E41A 4NNYA 4OBSA 2Y07H 3NJNA 3ARFA 2A73B 4PJ9B 3DMMD 4QTIL 4R90H 1UWXH 4Y4KA 4GAYA 1AY1H 4PJAF 1D7BA 8PAZA 4FFWD 4WUUE 1NWOA 4M5ZL 2GKIA 3NCCB 3MXVH 5ESAB 4Q58C 1XIWA 4KXZI 3DVIA 1G4RA 2YMXL 2M83A 3GSWB 3WFEH 1ZDSA 3VU2A 3TZVA 1M1XB 3BVDB 2FLMA 2HKFL 3CX5K 3DDGA 5C0GA 3G6JE 2WXJA 3B3IA 4KUCD 5EUKB 3HG1B 4XCFH 2HRHA 4R7NA 4A1RA 5CLZA 2JKSA 3CZNA 4M02A 5E2TH 1QATA 5C86A 2R83A 3BISA 4HIXL 3W1ZA 5L2KA 2PXYA 1OM3H 1GS8A 1U3HA 1K72A 4J3BA 3Q3GB 3PWPD 4FQ2H 2F8OA 2CMRL 1S9YB 3STLB 1KB5A 3EGSB 4LZKA 4Y1SA 1KN4L 4QRAA 4YDLB 4BD4A 2CXGA 4ZYKA 4YDJB 2EDYA 1UEYA 4I1PA 1YYLH 4BK5A 1AQHA 3AS2A 4WFGD 1GAFH 1XGUB 2VR8A 1QBLL 1F3JA 3FQXA 3R4DA 4XVJL 1RZKH 1N7MH 3BKYL 4F7TB 5FYJE 3LNIA 1UB6B 2EDHA 2CWRA 3RJQB 2DQTH 1M7IB 5E8DH 5KYYA 3MLSH 4HH9B 1XZ0B 5CJBA 1IGFL 1M2VA 1TTAA 4U6HA 1GGCH 3TIDA 1G4MA 4GQZA 1T7ZA 2OULB 2VXTH 1MFCH 1NIDA 2JTDA 5BUPA 2IH9A 3KLLA 3EYVB 1N6QH 3M86A 2J56A 4ABWA 2JKRM 1KN2L 3MJWA 1NFKA 5INDB 5AYUH 5E6YA 1IZKA 3UDWC 3VXUA 1HWGB 2VLRB 1IC4L 1CIDA 4Y2DC 3CD4A 2EUVA 3B5HA 3C5JB 1F4AA 3D30A 5DVOA 2BWDA 3SDDA 4F7KA 5F9JB 2R0KH 1BFVL 1PLGL 1XCTB 1HZKA 1N5AA 4LF3B 2B15A 5FM5O 4PY7B 4DN4H 4HKJA 3KDPB 5IFHH 4HFWA 1RZQA 2ZT9C 3D33A 2JB6A 4ZUVB 3TT3L 4NP9A 4J6RH 3Q8AA 2OJEA 4IK6A 3PABB 3UBGA 1EEUA 1TJGL 5GGVL 3H4HA 5AD0A 1IT9L 1EGJA 2NXYD 4F9LA 5IR1A 1AQMA 4HGKC 3OMNB 4LDLB 3L5IA 1WFTA 2IAMC 1QMUA 1ZY9A 3GB7A 5HI4C 2WNKA 2B59B 2R29A 3Q2VA 4KU1A 2VSKB 2MCPH 3C60A 1JZHA 1AS6A 3L3DB 2GTZA 2C1PA 4HU8A 1QUNB 1S5IL 3FFDA 3K74B 3SGDH 1I1FA 3PGFL 2Z8SA 3QHZL 5EBLB 5DJ0B 5TFSH 5E2UH 2R8SH 3CVIH 4G80B 3WTTA 3HG3A 1A3ZA 1OKEA 2X2IA 2GABA 4Y9CA 2XV2A 5CAYB 4GSDH 3IF1A 3IXTB 5MEQA 2WOBA 4XNDA 4BFRA 5HHPA 3N55A 2J8UA 3UEQA 5DR5H 1JPFB 3WO4C 3L8QA 3HAEG 3WFCH 4MMZB 3SHSA 1S8DA 4YC2B 4ODHH 3SKMA 1BIIB 1UXSB 2YEVB 4NC2B 5JO5A 1WHPA 2QPFA 4KK5C 1NLDL 5LXGH 1YZZA 4M1DL 1ERNA 1TVHA 4P23C 4MBRA 2H32H 1QTYT 1DBJL 3PWUB 3DSNA 2WVTA 4GG8B 4NZTH 4ERSL 3MFFB 2VQ1A 3EFDL 3KLKA 1P5VA 4J3OF 4OM0H 5TDOA 5DRXB 1WFOA 3H3PL 4OLUL 1WBXA 3WYRA 1ZT4B 3LEYH 4EAEA 4N6RA 1G0XA 4AW4A 2XQYG 1I8AA 4AJ0A 5T5FA 1E4KC 3MUHL 5B1AB 2XZCH 5AVRB 4JKNA 5EEVA 2AHIA 4U3XA 1B3JA 1JPTL 3FUKA 2GI0A 1AKPA 4W4NA 3DX2A 3VNZA 2H8PB 4WI2A 4JRYA 3QUZA 2ZX6A 3JSSA 1ONQA 4PPTA 4AQ1C 2R9HC 5K9OB 4P5MA 5I1DB 1OTSD 2R69L 3BEWA 3MRGB 2AABH 1AYRA 5C2UB 4X6CF 4Y0GA 4P4RA 5F7KC 3U48A 2IWEA 2XN9D 4OI8A 4QTHB 5A6IA 5BZZA 3Q8CA 4JFFB 4ELMB 2WLYA 1LNUA 4YGVA 4PJ7B 3IMVA 5D7JC 5F44A 1IO4C 5DJCA 2F54B 2MWCA 4Z0XB 3RWDA 3CQQA 2BHUA 5D70H 5KBPA 4QRUA 4TLTA 4KRMB 3L13A 3D3VE 4U3HA 5IB3B 4U49A 1KT2A 2F1BA 3D87B 2VSMB 4FXKB 3GMPA 1AP2A 4I18A 5FKAB 2N01B 4RAUB 4M62L 4TLUA 5KYXB 1WF5A 4YHPB 1UACL 2FLRT 2EDFA 1TETL 2CG9X 2AAAA 1MWAB 2P80A 4MZ3A 4U7MA 1CDGA 2NPLX 1KYOJ 3QUYC 4Y1AE 4NSKA 3LS5H 2IXQA 4HV8B 3S9DB 5FOBB 3O0LA 5AW4B 2BVPB 5TDPB 4QO1B 3QDAA 4YZWA 3KLHC 3V0VB 1W72H 2GJJA 4IGBB 1Y7VA 1F3RB 3QDGB 3TWYA 3IGLA 2VDRH 2CBQA 3I50H 1S7XA 3NCJH 3UYPA 3LHAA 2GJPA 5D2LE 2EE6A 3VG9C 1R6VA 5D2NA 4GRLA 1KUMA 4XMTA 1QFUH 5J6HA 3GSXB 4AT6B 3ELAT 3S3SA 1KIRA 2LV4A 1DJXA 3HFFA 4FFZL 4FN0A 4G1MA 4PJFE 5HDWA 4LKCA 1LE5B 1LMIA 2BWIA 2EADA 3IDNA 3MACH 4DGYH 2GC7C 4GQQA 1CTOA 1F90L 3BP5B 1WEJL 4PW4A 1JZ3A 3VD2A 1K4CA 2FX7L 4RGNE 1A9EA 4UTAL 2FIRT 4UQ3A 1X5JA 4CU8A 3EJQA 4TULL 4LEXH 3OKDA 4GQRA 4WHTB 3B9DA 1K6QH 1UM6H 4M61B 2ALAA 5BQDA 3X3GH 4YL4A 3QEQD 5BVPH 3KPRA 3RAJL 1UENA 3LKOA 4PLNC 4UT9H 4G6FB 4PP1D 3CZUB 5D6CA 2L3BA 4XN1A 5EOTA 5TK4A 3PAZA 4I87A 1EJFA 1R0AL 1ZD6A 3HZMB 4FEIA 4LP4A 2N56A 4OCRL 4QOKE 3BQUA 2OCJA 5E2VL 4I3GA 5B3JE 4JN2B 4PGBA 2FVNA 5DU7A 4KDWA 1OGAD 3BDXA 4G7YH 2G75B 3RX8A 4GQPH 4G9FD 4G6AD 1BOGA 5AW0B 1UB5B 1MWAL 2GUOA 2AXFA 5E70A 1FL5B 3D39E 4NC1C 2BY1A 3WTSA 1W0VB 5FUZH 5TPWH 3Q13A 1DQVA 1I1YA 4YSQA 4XNYH 3N2JA 2JV6A 5IW1A 3FQNA 3HZYA 4KUZH 1H5BB 1TU2A 1WP6A 2GHZA 4PJAA 5JTWA 1TT6A 1QLEH 4OW6A 4YBHA 3E2HC 1MNUH 2EP6A 3MV01 4MS6A 2VXQA 3OJDB 4A6YA 3FTXA 1S9VB 3VWJA 4UM8A 2IDUA 1KV7A 4OJFH 3OR7A 4P2RE 1PJ9A 2WPGA 4IKIA 2FO4A 3KWWA 5HHVH 1ZTXL 3OAUH 4XOBA 5HHME 5IMMA 2J8HA 4Y4HB 1XF4B 4M7LL 5CHNA 2EE3A 5FLVA 2YD9A 4PCSA 5DEZA 2QPSA 2OL3B 4M8RA 2DWTA 3ZTNL 4Z76A 1CF8L 4W9IC 1JDAA 4NT6A 3IMTA 2D4DA 1XEDA 3GRGA 4YDKH 1KJ2B 3QXDB 5E94A 4WJKB 3AG3B 3RFZA 1U30A 1E67A 5L4FA 5FM4A 3O4OB 4EI6A 3A23A 3HS8A 4JFEA 4YXKL 3WJJC 4PRPA 4ZO9A 1KBPA 3OHMB 4PP2A 4XNUL 3MJ7B 2D3LA 1SY6H 2F58L 2O6FA 2W0FA 1M56B 2BP8B 1UWFA 5I1AB 2ZP8A 5LDUA 2AEPL 1G9ML 2MOGA 3TBTB 3QRFM 3VH8A 3SCMD 1W0WB 5AVXB 2YEQA 3MRJB 3CC1A 5H94A 4JS7A 3OX8B 3I2CH 1D7FA 4NKQB 1FL3B 4D0DA 4RNRB 4DPRA 2B5IC 1NA8A 2JJSC 5FHBL 1V27A 4KTDL 1NGZA 1MCFA 1QBMH 3IE9A 4WGKA 3DUSB 3BAJA 4I0PA 3N5AA 3HPJB 4WFGE 4NS0A 3T0ED 1L7TH 4MAUH 1MVUA 4QHUA 4I3RH 2XXCB 1A1NB 5AG8A 4OZIE 4KAQL 3VE0A 4JO1H 3NPSC 4JZJA 3VFOA 1X5FA 3UROR 1J9SA 4PGCB 4FNLH 2R2HB 1YJDH 3LXAA 5IBLC 4J23A 2NQDA 3OMZA 3QRGL 5CR8A 5H4YA 1I8LA 4JPIA 4YXLL 1OAXL 3IJSB 1JF5A 5C0RL 4YHIA 4XXCC 2C7UB 1BLIA 2D31B 3CZSA 1QTSA 4JFPB 3FT4B 4ZMAT 5CN3A 2V33A 3A6OA 4AL8H 4ZUSA 1QRND 3QW9A 5D8JL 2UWEE 2TRHA 2X6UA 4JPQA 1EDHA 4N5ED 4DFHA 2KLTA 4JGMA 4XPHL 3S35L 3LPOA 2XACC 5HHXL 4U1NA 3FCBA 4PB0L 3PAUA 1ZVSB 4OFQA 4I77H 1P5UB 1IBZA 3GRWL 5CIPB 3G5YB 4JG0L 2XZAH 1N0XL 2ESVA 4QF1A 2HRPH 2EH7L 1EERB 1RUMH 2IEPA 4XVUD 3LVTA 4ENED 3HC3H 4JFYB 3RWFA 1NBZB 2XOTA 1W9XA 2R1YA 5DRZB 1H9DA 4JG1H 3OKMA 3SPVA 5L8KB 5I18L 2DBLH 1NC2A 1TENA 1P9MC 3L3GA 4D2NA 1YYML 1JGDB 2NR6D 4WV1A 5I1GL 2AQ1A 3S8GB 5FECB 3RPIB 2CA3A 4JR9H 3QAQA 4UT9A 2WKLA 4IBSA 3BLKA 1UZGA 1GJIA 3GMOB 5CBAA 1HHGA 2P7TA 3OJMB 3PFQA 2VUKA 5ALBL 3L4YA 1KCLA 3ABLB 2R7EB 1NEZG 1WC7B 2H6PB 4N68A 4PG2C 2J5WA 1S7TB 1M7UA 2A4EA 4N1CA 7PCYA 4NGHH 1CLYL 3KJ6H 1W16A 4TPRL 5IROA 1EDQA 4ADGA 2WYHA 4FQ1H 3UZVB 3ULUH 2GJ6A 5I1EH 3L1EA 4G72B 4XB7A 1T4WA 3QFJB 4EI5C 2BOCB 4YQXL 1UT2A 3P4OB 3VFRA 2DTMH 4CJ1A 4JDEA 4XT1C 5GGTA 1OM9A 2JCCB 4TRPL 2DQHL 2V6HA 2ZG2A 2B0SH 1HHIB 2Z31A 5ABDE 4N2KA 3K81A 4P48A 3RUGE 4PJ5A 5AVZB 1KTDA 1G6RL 2FJSA 2V9RA 2VITA 3GSOA 5D7SL 1Q38A 3KPQB 4YSDA 1UZ8B 2CNZA 2APVA 2P49B 1Z9OA 3FU8A 4X6CA 3ZE0F 1OTTC 3KPLB 2AK1L 4IMLB 3DO3A 3LMJL 4XNXL 2FQFA 1YEFH 3AXLA 3HI6L 2YUWA 4D0CA 2KPNA 4KROD 5H37H 2Q7YB 1YMMA 5KAQG 1YN7A 4R26L 3ZHLA 1Z2KA 5A2IH 2KHAA 1Z0NA 2VM9A 3NAAH 4PJXB 3QG6A 1RHFA 3M1CA 4NPJA 4MMXB 4F7MB 3N1GC 1TZIA 1ORSB 1T6VN 5SWSA 1PIGA 1NH6A 1I3RB 1PZCA 5K9KA 3IGFA 2FGWL 3RX5A 1RK0A 1ZCRA 2B2XH 4Y5XA 3MR9B 5HVGB 1WTGT 3SGJA 4NJAH 3RWGB 3ARUA 3BZ5A 3PXHA 3REVA 4KO6A 4NQDD 2AQRA 5E99L 4WWKC 3SDCA 3GC3A 2BCKB 2H0PA 4MVBD 2XN9E 1AQKH 3TA3A 4OM1H 4OV5A 3G08B 4JFUA 1D6VL 1KXTB 1QZ1A 4G71B 3FPXA 1SJEA 4F91B 1YEKL 4M1CD 3TH3T 3BO8B 4UMSA 5T3XH 1P2CA 1Q1PA 5EEUA 1JXFA 3KYKH 2UY7B 5T5NF 2BSDA 4AGOA 4E36A 3QIBA 1NSNL 3FBKA 2GIYA 3RL1A 4Q14A 3FTZA 3LZQA 4TS6A 3QNFA 5AZ2H 4HOXA 2YAMA 2GJZA 2GHWB 5IFJB 4GKSB 3H9ZA 4I89A 3F7RA 2EVGA 3DHMA 3Q2LA 4NNYB 1DN2A 4JG9A 5FUCC 2R1XA 3ZRFC 2RFXB 3ARFB 1R3HA 2V3FA 4Y4KB 3HNSH 1YDPB 4GAYB 4H13C 5LWYH 2AZAA 4UNUA 2HWZL 4M7KH 3MZTA 1JPSH 1TTRA 1AQDB 1O7DE 3ZGHA 3EHBC 1GJWA 3T4AA 2AJUH 5HJ3A 3B2PA 1XIWB 4XWOC 3TVMA 2VDKL 3GSNH 4EZJA 4NUGL 1DVQA 1FORL 1IBGL 4XAWH 1E9QA 3BFOA 5C0GB 1QPXA 3B3IB 2WANA 3H2QA 4KX8A 5LGKA 4V2CB 3OKOA 1BZ9B 1RUQL 5F9OH 3HEIB 4R7NB 3UH8A 3QORD 1SYVB 2G2NA 2ADFL 2GT9A 5L2KB 2PXYB 2ARJA 4H7VA 3E80A 3IMUA 4KQ3H 4LIQH 2A99A 1U3HB 1N64H 5DS8A 1X6LA 4O02A 4G8EA 2WXIA 3ULAB 1GOGA 2ICWA 3NACL 3QEQE 4ZYKB 2VC2H 4U1SA 1YAZA 2ZZUT 1OE3A 3AY4C 4AV5A 3MODH 2A1WL 4XXDA 4BFEA 4LEOA 5HDLA 5B1CA 1F3JB 3FQXB 3ETSA 3CVBA 3MLRL 1EBAA 1AMYA 3HVNA 3H0TA 3HC4L 4LOFA 3MUY1 4ZUWA 4K5NA 1GGBL 1OGAE 1R5IA 5F7MC 2XWDA 5KYYB 1JZJA 4G9FE 5CJOH 2BSTA 1M2VB 1J8HD 1QLFA 3UG4A 1PYWA 3TIDB 3C09C 4I7ZC 3I6KB 2CRIA 4L3ED 2EABA 1RH8A 2WUBL 2FLBT 3LN5A 5JIIA 1UCBL 1SHXA 3KLAA 3BVTA 1HHKA 1IAIH 3VXUB 4G7QB 2B9BA 1KCRH 1B0RA 4XGZA 1S3RA 3IPBA 1XGZA 2IAMA 2MMXA 2VWEC 2ZXQA 2WLMA 4JFOB 3SDAA 3IXAA 4MXWL 3N91A 1N5AB 4P46A 4Z7OB 2NZIA 4KKNA 1IZJA 3B6SB 1M9WA 2ORBH 4HFWB 1ECZA 4P0DA 1XB3A 3NJJA 3WN5A 4RX4A 2OJEB 1J5CA 3L45A 2K6YA 3L5XH 5AD0B 3B2XA 4LP5A 4HIHA 2VSCA 4P57A 4K5OA 4BGLA 5IR1B 4P2OC 4AYFB 1KB5L 3BT0A 1UASA 5FCSH 5HHOD 3F5WA 3P11L 1RERA 1KYFA 1KB9J 5KSBF 1MFDH 3C60B 3BT2L 3JV5A 4OZGF 4ZK8A 2GTZB 2C1PB 4MGXA 2QDWA 3ARBC 1ZLSH 2XVKA 5CFHA 3K6OA 3FFDB 1CL7L 2RCSH 3ES6A 2XQBL 2MPAH 1XMWA 4JO5A 2AVFA 5T8IA 3VXSD 5IREA 4P23A 2F8VA 2WQXA 3ARDD 3MNZA 4X9BA 3HE7D 2B1OA 3IF1B 2B1HL 3IDYC 5MEQB 3SN6N 1GC1H 2R23A 5HHPB 1CL7I 2J8UB 3VDBA 3IMBA 4X6DF 1I1CA 4AW7A 3SKMB 2C9AA 3F01A 5JO5B 2NY7L 3L4ZA 2EC8A 3HI1A 1U6AH 4W9EC 1TVHB 4K3HA 5D1ZC 3QWOA 4JFVA 5AYTA 3T0EE 3L48A 2Q7NA 3T3MF 3DX9B 3WJLC 4Q9QH 3CFDA 2KQMA 3MUGA 2EKJA 2VQ1B 3WAKA 3SGEI 4PUBH 1WAAF 4R4NC 1P5VB 1OCCB 3VGAB 1FBIH 2CDFB 5E4AA 4NIKB 5TDOB 2AVGA 3QZBA 1WBXB 4K23H 2E5EA 4ZUTA 4N6RB 3FXIC 2AJYH 2V9UA 1QX1A 1CK0L 5I71B 1CXIA 1MFUA 5DO2D 1CI5A 4XPAH 1DVUA 1IRAY 3TA4D 1KCVL 1QRNE 4BK4A 1ZSHA 1P53A 2VW4A 4CGTA 2YWZA 5LNGA 1TITA 4YPJA 4JRYB 3QUZB 3RVVD 4XNMA 1ONQB 4DWHA 2EIZA 3BFQG 5H4ZA 4P5MB 4HJJH 3UEZA 4DO6A 1KLGB 1ZT1A 4FP8L 4P4RB 3R4RA 3K7UA 4HCGA 4DK3A 3WGVB 3CSTA 1LNUB 5E1HB 2HN7A 2F19L 2MCAA 2WQSA 3NIFE 4HAKA 2P52A 3RWDB 2ZUSA 3A6CH 4NKIL 2Q2LA 3KZ8A 4EDWH 4QRUB 3ZDYE 2YSTA 1YPZF 4M5YH 4HCFA 1KT2B 1KCBA 4G42A 5BVJA 3GMPB 1AP2B 4I18B 4X0NA 2A9NH 2GBVA 4BFKA 4C8XA 5KBDA 4HALA 4Y19D 3N50A 3JT2A 2C9UA 3EGXA 3Q7JA 2BJML 1F8TL 2JJUA 2UXTA 1L0XA 2CQVA 2MTPA 2FO1A 4HWNA 4NSKB 2H41A 1J0IA 2IXQB 2Y7SA 2NXZD 1J0HA 1RU9L 1RMFL 4LSQL 1C5CH 1CC3A 3VRIA 1HXMA 2VMEA 3FHAA 1EH9A 1B0GA 4XCCH 2BIOA 1WRFA 2ZAIA 5KVDH 2CLVA 3ZBMA 2OR7A 2WCSA 3UYPB 3LX9A 1S7XB 5L7XH 2D2OA 1M9SA 2Y07L 1M1SA 5EIQA 4NI3A 2Z4QA 2XRAL 4K8RH 4R90L 4Y7OC 4GRLB 5D2NB 3V95A 1M57B 5J6HB 1SHSA 3JWNH 5IVNA 2Z0UA 4NQXA 2QQNH 1KIRB 3MXVL 4G1MB 5IHWA 3PL6D 1E5AA 4LKCB 1EA9C 5J89A 1FNHA 5LB1A 2OAAA 1T2XA 4P5KA 3WFEL 3WN6A 5DTFA 1K4CB 2E7BA 1JAEA 4X5QA 3MROB 5B7FA 3RDTD 4UQ3B 3KCPA 5C3TA 1N26A 2D9CA 3OKDB 3MV7A 4G5AA 1IJ9A 4XCFL 1BFOB 2VCOA 4YBLB 5DFAA 3AREC 3MBEA 2I85A 4PMFA 4PRBA 4LCWA 5E2TL 3ZTCC 4QJ4B 3LKOB 3MLXH 4HISA 1OM3L 5D6CB 3PIQA 5TQ0H 5EOTB 4IKNA 4FQ2L 2LAGB 2ZOKB 3PXLA 3BQUB 3F6JA 1N6VA 5EU6D 3CFTA 4ZFZA 2JKXA 1ZIBA 4WHCA 2YLHA 1DANU 1AAJA 2UYLA 4PGBB 3C2AH 3B4NA 2ZXEB 2EDEA 5FM5M 2PTTA 1YYLL 3SE9H 4NJ9H 3FAXA 3IKCA 3HLAA 4NQDE 4RRPA 3I9GH 5SWZD 4URKA 2GUOB 2AXFB 4LCYA 5LLIC 1JZIA 1RZKL 1JIBA 5GQBA 3SZKC 5LG6A 1I1YB 1I3UA 2HFGH 1WZ1H 3CZGA 5HI5D 3ZT6A 5B8CC 5IW1B 2IVFC 1JWUB 4NO3A 4O2FA 1TU2B 4PJAB 2DQTL 2AERT 1R47A 3EOTH 5E8DL 4HEME 3MLSL 4L1HA 5KVEH 1NLBH 2JMRA 4A6YB 1GGCL 3JVFC 3VWJB 1XD0A 4UM8B 1RKRA 2VGLM 4G6JH 3OR7B 3BGFB 4UWQB 1N6QL 2EIEA 3TJPA 4XPBH 3K4AA 1F86A 3KWWB 4PSRA 2VB5A 3BH9A 4JAMA 2WCGA 2ED8A 4LRIA 5AYUL 1TEFA 1KJMA 1KPVA 3NRQA 4X2UA 4PLOB 4PN6A 3MA9H 2EVJA 3NSCA 2Q8BH 4NNPH 3X14A 4NAMA 1MN4A 2MFNA 5J13C 5IVOA 3DRTA 3GDCA 4Z76B 1BWMA 2WNWA 2R0KL 4NT6B 3FN0H 2JK5A 2PPCA 3AAZA 4QI3A 1L9SA 5E0FA 4ZFGL 3RFZB 3U2JA 1NC4A 4XPFH 2J88L 4ICWA 4LEEA 2CH8A 4EI6B 2WN3A 4J6RL 4JFEB 4RMRA 1E8WA 4PRPB 3ECQA 2NX5B 1MJUH 3FTVA 1NGXA 1NKGA 2ICES 3BUYA 2W0FB 2O5ZH 4K73A 1GYWA 3RZCA 3IFNH 1ZMYA 4UT6H 2C9PA 2Q0ZX 5BS0A 4H0LC 3VQ1C 4A04A 5D4JA 4NUJA 5H94B 1AGFA 5T1LD 2MCPL 2J43A 4D0DB 1PY4A 2NSQA 5HYEA 2LR4A 4HWBA 1OGTA 2ITEA 1INQA 5JPNC 1KFAH 4E9XA 2LTQB 2AANA 3KYNA 5DHVA 5JXAH 1KYUA 4CAGA 5TFSL 4HUUB 5E2UL 3CVIL 1GA2A 3V8OA 5AZEH 4GEIA 3NTCH 4I0PB 1MFAH 2YAOA 1FC2D 1MPAH 2ZUWA 4GSDL 2VXQL 5ACMA 1QFWM 5DR5L 1MVUB 4QHUB 3SGDI 4D7BA 2MJWA 2AEQH 1SBBA 3FUFA 1OLZA 3P2TA 5IMOA 3WFCL 5J0BA 4UF7C 4ODHL 3LS4H 5FGSA 3VE0B 1O6SA 4JZJB 3VFOB 1M05A 1MCLA 1VFAA 3JWOH 1Y18B 5L2JA 3ZDXF 1A0QH 2ZXWB 4PRID 1G9NH 5EMYA 5LXGL 5HGGS 3EZ8A 1QFWI 4OJCA 1J8HE 2GFBA 3BYYA 3U1SL 4JPIB 1PZ5A 3RKPA 4YHIB 1NMAH 5GRUH 4NZTL 2YA1A 3OKKA 5IB5A 4L3EE 3OXSA 4XN7A 1ROWA 2UXFA 3ZGIA 2IV8A 4ZUSB 1ACCA 3RIFK 1MQKL 3OHXC 2DMGA 2QSQA 1D5BA 2ZG3A 5E8NA 4N24A 4OM0L 2H3KA 1DQMH 2J7LA 3VTTA 2CR3A 3TCLA 1MLCA 1PZDA 1XQ4A 4PHXA 2XZCL 1B2WH 1CDYA 4OJAA 1FLRH 1BXUA 1MVFA 5KSBA 4L0ZA 2ESVB 3F00A 4QF1B 2K7QA 1XX9C 4OZGA 2OMWA 5ETUA 1IIKA 4GKNA 5J1SC 3U2IA 3RWFB 3ZYZA 1GZHC 3C6LA 2CJ3A 2R1YB 2LABA 3G5WA 5ABZA 3TEWA 3SPVB 3OKMB 2AABL 5IB4A 1NC2B 3JWDC 3LAFA 5DJ6A 1SNRA 2OSYA 3L3GB 1KENH 4JREB 1P1ZA 2CHWA 2FE0A 2JF1A 4QKXB 4RFNC 3EDKA 4CW1A 4Y5YC 1JF1A 1QWNA 1FFQA 1GGYA 4GMSH 5HHOE 4LO9A 3E0GA 1HNGA 1MG3C 4X6DA 5D70L 5TTRA 3BLBA 4IJTA 5B3NA 4JKKA 2P7TB 4EN3B 5CBAB 3DX3A 3MNVB 4X9GA 4BCZA 1S9WB 1SDDB 3C8DA 4A7SA 3VNYA 2CM6A 2E7MA 5JW4M 3RJOA 1G1KA 3NCFB 4AQ8C 1GPOH 1WD9A 1J87A 2LFEA 3E6HA 3MREA 3V5DA 4JFXA 3VXSE 1MRFH 4BA0A 1WAAA 3G9AB 4R97C 4G9DA 2GJ6B 6FABH 4H1LH 4EUPG 2ZKHH 3LS5L 4KXAA 1Z9MA 1T89C 3FRPB 4RA0C 2WXNA 1DZ0A 3SOBL 3HBQA 1BDYA 3A4DA 1XSIA 3VFRB 4JDEB 3FUNA 2F5BH 2UZPA 4LLAA 4ZMYA 1MCIA 1W72L 1JL8A 2Z31B 5DUBA 2VDRL 4PJ5B 2WHVA 3DHJA 3I50L 3NCJL 3T0AA 4XCEA 3TONA 1XBRA 2VITB 3GSOB 3UTOA 3FFCA 5F0LB 5KVGH 1QFUL 3Q1SL 4R7DA 1CN4A 5LAPA 3VVWA 3CBRA 2FRGP 2H2PD 2VDOH 4X6CB 1H3GA 4G8FA 3REWA 2DYSB 3AXLB 4K2UH 1YMMB 3KGRA 1YN7B 4DGYL 4PY8J 3MKGA 1GMEA 4GQ9H 3QG6B 1URZA 1R5VA 4F58H 3S88H 4PSPA 4A37A 1TZIB 4F27A 5ISZA 4MRBA 5SWSB 2GEQA 4C54A 4YFEA 1YPZA 1K6QL 1IC1A 1UM6L 1RK0B 1N2RA 2VXVH 4WENB 3X3GL 4GI6A 4Y5XB 4TVPH 3QIWD 1T7YA 3DYMA 1H6TA 4UT9L 3REVB 2G3NA 2FECL 4JQXA 4N25A 1F3DJ 3TTSA 3DIDA 4LLMA 1AKJD 4GKOA 4H8UA 4PJCE 4BSVA 4EDXA 2WTPA 3FQYA 4ZMWA 3TA3B 3ZIMA 4EQ3A 2QSTA 3F7VA 4RWYH 4YOKA 4OV5B 1O7SA 3VXPA 5K39B 4AVJA 4DESA 4U4IA 4NZUH 1RZJC 3UZQB 1SJEB 2IJ0C 4JFDA 3CVCA 1OGSA 2BHZA 3QJXA 4G7YL 3RGHA 5L0QC 1HT6A 2IPKA 3U1QA 4JN1H 1P2CB 3G6AA 3SQOH 4MA1C 1J0YA 5FUZL 1NBVH 1AC6A 5TPWL 3SZ6A 4F7CA 3ROLA 4PIRF 4WEBH 4XNYL 3RL1B 1C16B 3SIKA 4KUZL 4PRHA 4XNZC 1QLEL 2GJZB 1MNUL 4Y19E 3ZE2E 2V9QA 5E8EA 3ARQA 4OVVA 1Q8MA 2YO3A 4LBAA 4OJFL 1ICTA 5E6IA 3QT2A 1CURA 2R1XB 1I3GH 3WIFA 2J2ZB 5HHVL 4B7LA 1R3HB 4EKJA 4YWGH 3BESR 2EUZA 4DO4A 2AEWA 1YY8A 2WZAA 4IKKA 1EFQA 3T4AB 4Y4FA 5HJ3B 2Z4TA 3QI9C 4L3CA 3P3YA 4LVNC 2FR4A 3HZVA 3OLIA 1TCMA 4KY2A 2ADIA 4ZUUA 1E9QB 1MRCH 2NZ9D 4YDKL 2OBGA 4Z7VE 2XHNA 1A5FH 3CTTA 4R84A 3OKOB 5JA8B 2GEEA 4IRZA 2NQ3A 2CCWA 2B4CC 5GZNA 5HD8D 3T6VA 1KBBA 4TQPA 1ILUA 1SY6L 5DFVD 5T1MA 1I85A 1QFOA 1U93A 5GRXG 4CDHA 1WO2A 5BO1H 3QUMA 5E4EC 1MFEL 3LPGA 4TTGA 4O02B 4G1EA 1LE9A 4MJ6A 4G8EB 5HI3D 1OO2A 1ED3A 2GITB 1W6WA 3G5ZB 2LQRA 3GBMH 4YFDB 2ICWB 2YGVA 3V0HA 3MBXH 2V2XB 3BUTA 2OMVA 5IJVA 3L95A 4M4RA 3ZKND 4XXDB 5DQDL 2X4SA 4HJ0D 4R3SB 5FYLH 3BC9A 5EU6E 1J1OL 4L4TA 5JQHC 1QBML 4Y16D 4KTGA 3H0TB 3P3RA 1YEIH 4ZUWB 1R5IB 4LHJB 4L4VA 5DFTA 2WWKT 5M7QA 5E6RB 5SWZE 2HT4C 2BSTB 1L7TL 3B2UD 2ZOUA 4MAUL 5IV2B 1PYWB 4N22A 2WM0A 4RCAA 4I3RL 1RULL 4RZCA 2UZIH 4F57H 2BH0A 2JI1A 3ABKB 1EHXA 4JO1L 4QRQB 1RURH 2V2WA 4M6OH 3OC5A 3LN5B 5KVMC 1HHKB 5BXFA 1UURA 4UILH 5E1QA 2D3VA 1XTLA 3B7YA 4NN7B 4OF6A 3UAJC 2EUXA 4IIZA 1B0RB 4XGZB 4UBDD 4AL8L 3DX8A 2PW2A 5C9JA 2IAMB 2ODIA 2OCFD 5JORA 1I9RH 1T66C 2C4FU 2PCPA 1W8NA 3IXAB 3SDAB 4HYTB 4P46B 5BZDA 2X6AA 4Z8FH 1EHLH 2FX8H 1BGXH 1NTDA 3GTNA 4UV7H 2WBJD 4I77L 3ZO0A 2XZAL 1EEZA 3WN5B 4L29A 5HYJD 2HRPL 2L0DA 3KEHA 1HL9A 1RUML 1BM7A 2XX0A 4HWUA 4IRSD 3VXNA 3IJEA 4D94A 4HIHB 4P57B 4UQ9A 4O02L 2JJTC 4HUCA 3PGCB 4JHBA 3V0WH 4FLOA 4Q6YA 1E9OA 4JG1L 3WNMA 3SPJA 3F5WB 4QXUH 2DBLL 1NEUA 2NOYA 2OYMA 2K7PA 3QUKA 3D4CA 4JY5H 2DWDA 5I74B 1GS6X 4M48H 4FQCH 4IYKA 5D4QA 4AZUA 3QH3A 1HINH 4JR9L 4PJHE 5IOKA 1MCPH 2BNQA 3ES6B 1T1WA 5F7FA 3RGVD 3AITA 3GXUB 4P23B 3Q6GH 3VUAA 7TAAA 3MNZB 3IDUA 4FRWA 3FUHA 1BVKA 4RDQG 3QDJD 4GAFB 2R23B 2R51A 4LL9A 4H0GA 1ZDQA 3WEMA 4ETYA 3AG1B 4NGHL 2WP3O 3KJ6L 4RGOH 5F7HA 2UV3A 4ODUA 3ULUL 1JI2A 4KHXH 5I1EL 5K59F 3HI1B 4KDTA 5DI8B 4OLVH 4F20A 4X7EC 1ORQA 3QWOB 5JA9A 3ISWA 5DD5H 4M93B 2BRQA 4Q52A 3CFDB 5BUAA 1LQSR 3MUGB 4NUQA 2B0SL 2W92A 2OK0H 4AQ1B 1ZGLM 4G43A 5F93C 1KPUA 4OD2A 1ZJAA 5FIEA 5FX3A 4PD4J 4N8VA 2QKIC 4PRIE 4CU7A 4ZUTB 3CFKA 2YGOA 3FU7A 3HRPA 4RA3A 1MFVA 2C9XA 2JELL 2PN5A 2A74C 2RJMA 2WQ8A 3FOLA 1KGYE 1YEFL 1MCWW 2VZVA 1RL1A 3QUXA 5IVXF 4NM8H 2GB2A 5DRWA 3QISA 4XNMB 4BQ8A 3T0DA 3NAAL 2EIZB 2COQA 3FKUS 4UANA 3QJTB 5EB9A 5EO9A 1A64A 2V9TA 1IC5L 1ZT1B 1H3VA 3NCWA 1TTGA 4LPTA 5FC9A 5A2AA 2WLKA 4OF5A 2PP8A 5F1IA 2WV3A 1JRHI 3OWEA 4KI5C 5DSCB 2B2XL 4FQJH 2EIMB 3DJSA 1VRSA 2HN7B 3RTQD 3CFEA 4LPXA 1BD2D 3MNWA 1VDGA 4B9JA 3ML8A 1HIMH 5KVFL 4CMHC 3ESUF 3EXJA 5FYJU 1BBJB 4R8WH 4GLRI 3ULUD 1AQKL 1FYTB 3UACA 4OM1L 3BDBA 1PGRB 4HLZH 4G42B 5BVJB 5ADOH 3WE6B 4B9IA 4PH8A 1AS8A 5T3XL 1CFSB 3KYKL 2IOMA 3EGXB 4RFEB 3UCQA 3QP3A 2EYRA 5EFIB 3LQZB 2JFCA 1AJ7H 2ENQA 5IQOA 1V3KA 2W91A 4OLYH 5F6HI 2DQDL 4EE2A 5T1KA 3KNBA 1E8YA 1NFDF 2DIBA 2LAAA 2Q1EA 5AZ2L 4GKLA 2G30A 3FTSA 1R3JA 3HNVH 3KGTA 3SJVD 1HXMB 3VRIB 2X4UB 5IT2L 3ZE0B 1B0GB 5HYFA 1MHCA 3WOVA 4Z3TA 1FV1B 2ITDA 3NYKA 4MXQC 2CLVB 3BPLC 1G5GA 2EDKA 1OCWH 2ATPB 2Z4QB 4MZ2A 3HNSL 2EE9A 2L7UA 3DX6A 5LWYL 3ZKXB 3KBFA 4KKAC 3E6FA 5E5MA 3II2A 4NQXB 4M7KL 3VMNA 5JW3H 1UGNA 1JPSL 1YEEH 1NAKL 2Z8VC 3ARSA 5C0AD 2EXTA 3C2SA 3GSNL 3RWJA 2ZCHH 3ZU8A 1RXLA 5DTFB 3D12B 4DKAA 4XAWL 5CCGE 3NRPA 5LDSA 1MIMH 3RNQA 3KCPB 5IQ9A 4Y5VA 3D0AA 3MV7B 1KDIA 3NGBC 5F9OL 1JD9A 5CP7A 3VQMA 3K0WA 4LVHB 4A68A 2EICA 3MBEB 2RQ8A 3EDFA 4LCWB 4PRBB 3SOTA 4MNQD 3US9A 4KQ3L 4LIQL 3PIQB 3SO3C 5IJBC 1N64L 1PKOA 1Q9KA 5B8CA 3N1FC 4WI0A 4ICXA 1RUAH 3ULVH 1CFMA 1XH3A 6TAAA 4ZFZB 4HMDA 4ZW6A 2UYLB 2VC2L 1THCA 2XA3A 4EQ2A 4QXTA 4ZAKC 1ET7A 2H6UA 3MODL 1HJBC 1QBAA 3IKCB 3HLAB 2Z65C 4AV4A 5DZLA 5IIEA 4K94H 3DYPA 3ARRA 3G9VA 2A4CA 1T03L 3F2LA 2PF6A 4RMBA 2VH5H 4NO3B 4O2FB 2E27H 3AGVA 5BW7C 1KEGH 2BWQA 3VB8A 3RPKA 1WUZA 4EO5A 3F85A 5TK2A 2Z92B 3V8CA 1OOAA 2DYRB 3OKLA 1IC7H 1MCEA 3PCYA 5HXMA 3HG0A 4JAMB 3BH9B 3MRNA 3F62A 4UQCA 3MN8A 1XBDA 1KJMB 2ADYA 2XI9A 4AVKA 1U2CA 4HLJA 1KCRL 3X14B 2QFPA 1MJ8H 3JZ7A 2SEBA 3AVEA 1JDDA 2W1NA 2ENSA 3DRTB 2BOBA 4MS8D 4RGMC 1ZHBB 2IIJA 5KG9A 2E74C 3V0EA 4H4NA 2JK5B 2CM5A 3AAZB 3KL3A 4HKBB 1WBZA 3BP4B 5GZOC 4ZQTA 4IOSD 2BXYA 4GRWF 3N3EA 1IAII 1IE4A 2I69A 2ORBL 4H8WC 1RZIA 1T4KA 4OFPA 1Z7JA 3L5XL 1NGXB 3ASNB 2HRGA 3BUYB 4P04A 4R4BA 3RZCB 1PZ2A 2VZTA 3K0YA 4TUUA 3O9WC 2EDMA 1X7QA 3NDZE 4KTEH 3SYPA 4ACTA 3AMLA 5BS0B 3D52A 1AGFB 3KJ4C 3WSQH 1FRGH 3JTSB 3ILQD 5FYKU 5KJ4A 4ABQA 1H8SA 5CINH 4L4JA 4ABVA 1K8DA 1SHWA 1OGTB 4E42B 3BUDA 3MLTB 1I1AC 1ZLSL 1INQB 3KBHE 3L3HA 3QEHA 4HXBH 4IHBA 5JHLH 5TDNA 3KYNB 5DHVB 2MPAL 1GHFH 3POHA 3ZMNA 5F96H 4Y2OA 5MI0B 4NCC1 1MFBL 5E9AA 1JGVH 2CPUA 1CXEA 1CBVH 3SYQA 1YA5A 1GC1L 5L4MA 3MJ9A 1PW3A 3F6LA 1AG6A 3KPSA 4HG4J 2OMZA 1O6SB 2GSIB 4EZLA 1M05B 1VFAB 5L2JB 5I0DA 1U6AL 2JI2A 1J9TA 3JXAA 3GQFA 5HDBE 2HJFB 5D1QC 2GFBB 2Y5TA 4Z7NE 5C09D 1PZ5B 3GJEA 4FA6A 4N0UA 4Q9QL 2CPCA 3OKKB 3KMDA 4U33A 3OXSB 5F1SA 1ZSDA 5D4IA 5DEGB 4PUBL 2Y6TE 1GZHA 4J3XA 1D5BB 3ZJAA 3B2DC 2CO6A 2OSLA 1C08B 4K23L 4MAYD 3TCLB 1MLCB 1A9VA 3RIAK 1TFHA 1R3KA 3D4ZA 4XPAL 1OANA 5KSBB 4DCQA 3PWNA 2QTEA 4OZ4B 4OZGB 2OMWB 5ETUB 1NZRA 5JHDD 4GKNB 4QRPE 2ZOTA 2QGEA 4UDTA 5D1XC 5E1IA 5LN4A 4C57C 4OKVA 2QFRA 1FCGA 1KY7A 3C6LB 4HJJL 4KI5F 4W9GC 2DOCA 4W1TA 4WHYH 5IB4B 3BAEH 5KTEH 5DJ6B 5HYJE 5LN8A 4N2IA 1P1ZB 5ERWA 3U1PA 4FQLH 4ADJA 4U1HA 4CW1B 1UWGH 4BJLA 3PQYA 1T5WA 4WO4D 4E9QA 4ZOEA 1CDJA 3V55A 3A6CL 1IBDA 4X6DB 4EDWL 2DAVA 4LU5H 4MA7H 4JKMA 1FGNH 3K1DA 2CBOA 4M5YL 5GPRA 4U1LA 2X5PA 3R0NA 5CU9A 4AGNA 2C3GA 2A6KA 5TE4H 2A9NL 2DQUH 4G5ZH 4YJZL 3MREB 3E6HB 3T3MB 3V5DB 4DF9A 4UTCA 4JFXB 4JE4B 3BEVA 4AIEA 1KLUA 4G9DB 4XC3H 4FDWA 1ETJA 4DFIA 3ALXA 1OZTG 3MPCA 5EN2A 3C6SA 3FT9A 3QDJE 1C5CL 3BUPA 2O4EA 2VXUH 4XCCL 4H1LG 3ZTJH 1MWOA 5KVDL 1YY9C 2NY4C 5DUBB 5IVXA 5K1NA 3R1GL 1YEDA 3FB6A 4HAGA 5L7XL 5ALCH 3TN0C 4WAFA 4XCEB 4JDZA 2P8MA 1AO7E 4DPCX 4R7DB 2KDGA 4QYAA 1ZPUA 4OIAA 3LEVH 4G8FB 3REWB 3PDGA 3UC2A 5CGMA 4L0YA 2HT2C 4XMLH 3MYZA 1QR4A 2CR0A 3IJHA 3V7AG 4C83A 4DKDC 3TBSA 3X1BA 1R5VB 2MRYA 1RJZA 1MJJA 1AGBA 1AANA 2XN2A 4NFDA 1U8IA 3QPXH 1PL3A 4A2GA 1R24A 3O8XA 4OF3A 1HHJA 5AEAA 4H0HB 1YPZB 1U3NA 1N2RB 3FTYA 2X7LA 4M29A 3MRFA 3VSUA 5D7HA 5I15H 1IJNA 4MJ2A 4P3CH 3PJNA 1OT4A 2QPDB 5TQ0L 4YZFE 4HSCX 4NI6A 5JIHA 3GJFA 3DOIA 3K72A 4LLMB 5AUMA 3WEXA 4BSVB 4EDXB 2VMCA 4Q8BA 1E4XI 3F7VB 5FO2A 1AGCA 2OYLA 3VXPB 1PMYA 4KJPD 2BIIA 4Q74A 2CR6A 1NFDA 1P69B 4ZOCA 3QIUC 4JFDB 2KMWA 4QXVA 4BE6A 5GS0C 3MI6A 3B2VH 2IQ9H 3SE9L 1H3WM 2IPKB 3NP4A 4JHWH 2LW3A 3I9GL 5BCAA 4BV1A 3G6AB 3OWRA 4CN1A 4I48A 1BOYA 2HJKA 4MCZA 3ULUE 1KJ3H 4POZD 1XVSA 4F7CB 1QASA 3ROLB 4GBXD 4N0CC 1ZK9A 2YHGA 5DHMC 4B3VA 1LYQA 4K8RD 2JQAA 1NCHA 1NDGA 1JVKA 4AYEC 2IBGA 4PRHB 2O6PA 3ALWA 3EHBB 3Q8BA 5KVEL 1NLBL 5T33L 2WC7A 3QI9A 4FQPA 5E8EB 3WO3B 2AW2A 3K6SA 4G6JL 4ECNA 5E6IB 1DBMH 1CLZH 4XPBL 3BHBA 4FNTA 3WIFB 4HDIA 3SJVE 2PO6C 3QXVA 1V7NL 1OAJA 5FS5A 1YY8B 3MA9L 1VSCA 4X9YA 3S5LA 4DP1X 2Q8BL 2XY2A 4PGZA 2YQ3A 4UDUA 4YNYA 5AFAA 4Y4FB 1N68A 3FBQA 4DSYA 1KPRA 4L3CB 3U0PA 2FR4B 3HZVB 3FN0L 3KHQA 1YUKB 4YHMH 2ADIB 3F65A 3I74A 4ZUUB 5A3IC 2E8YA 4MQ7A 5EBWB 4XPFL 5I6NA 2XIDA 4L8CA 5C0AE 2EDOA 1MJUL 1W80A 5IF0A 5T1MB 2O5ZL 1U93B 4FQIH 1NMBH 3IFNL 2ZTBA 4UT6L 3UPRA 3QUMB 4LPWA 4G1EB 1LE9B 1TLMA 3NSFA 3QZOA 4ANKA 1ED3B 2ZE0A 4OQTH 3B1UA 4CVXA 3LB6C 2NNRA 4UQAA 2W88A 5IEHB 1X7TA 2OMVB 2ZWYA 4MNQE 4Z7WF 6PCYA 4HIIA 3L95B 2NYZA 3D2UD 4M4RB 1N19A 5LUMA 4ZXBD 2X4SB 2VN4A 4DP0X 4Z77A 5C0JA 5JXAL 4TNVK 4L4TB 1ADWA 3CFJA 3NT0A 1Z66A 2A9BA 4PRDA 3GKZA 1XF1A 3NTCL 5MHSD 1MFAL 4KRPD 2O5XL 4L4VB 1MPAL 4KTYA 1CFQA 3UAJA 5L8JB 3DIVA 3LXUX 1JZ6A 4GPVA 1WA0X 3APNA 4P07A 5GJSH 4OFKA 4QXGH 1LO5B 2IALA 2W07A 2AEQL 3DECA 3O11A 3LS4L 4DHLA 4XO4A 2BNRD 2V2WB 1EZLA 2VDNB 3JWOL 3EAKA 1A0QL 3FW6A 1ML0A 1G9NL 4H88H 3DX0A 3EDJA 4HUWA 4PWKA 4YHYC 2ZWNA 2XVLA 1NAMA 4YFLF 4C58B 5JZ7D 3P9WB 5GRUL 1NMAL 2W60A 4KKCC 3VD7A 1R33A 2ATKB 2CGYA 3DX8B 5C9JB 5JORB 1N8OE 3S0PA 5PCYA 4A2EA 1DQML 1RUPH 2WGNB 4E9SA 5BZDB 5I8OH 5JPMA 1VZHA 1B2WL 1FLRL 3NABH 3LQAH 4L29B 3WELA 4P5TC 2MEJB 1EXGA 2IPUK 1L5GA 3G6JF 2EXYD 3U7WL 3VXNB 3SBRA 3IJEB 2RGSA 1Z3GH 3CHXA 1NCGA 2NY1C 3IJ9A 4PJ8A 4BDVB 1KOAA 1RZPA 1E5ZA 3LDBC 3QUKB 4KZ0A 4NB7A 2Y0SA 2IMMA 1UA3A 1KENL 2M26A 2DQGH 2DWDB 1ID5I 3R19A 3BMWA 2AQPA 5C92A 4W6XB 2B20A 4QRFA 5ECGA 3EUDA 4OLXH 3QH3B 2HAZA 1F56A 1U91A 1DHKA 2BNQB 4GW1B 4JMXA 4KKPA 1A4AA 4R2GC 2Y69B 5AOZA 4IQHA 5EH1A 3HE6C 1A8ZA 1SXCA 1QSEA 3ZDXB 4GAGL 3B37A 3S4SA 1M3JA 5BPPA 4MDJA 1Y07A 2XPYA 2QL1A 3L4TA 5I75B 1GPOL 1NWPA 4LP8A 1MRFL 4OIFA 1F6AA 3T77A 1A66A 2ZCZA 1ND0A 4LOEA 4ODUB 5CILH 6FABL 3RVXC 2PR4H 4AITA 2Y3NA 3C5ZD 1IMHC 1ORQB 2CRYA 3ARGC 1DQIA 2ERJC 4LLVA 5FA3A 2O93L 4NCDA 2J73A 2F5BL 2NY5C 1X9LA 3ABMB 2HFTA 4G43B 5LBGA 1KPUB 2Z7WA 3QC5X 4OD2B 3ZT5A 3TFKD 2PWDA 2EDJA 2ZUQC 4N8VB 1BX2B 1QHQA 3CFKB 1FUNA 5KVGL 3FU7B 4XZUA 4P4KC 5C09E 2ZIDA 3PPSA 5F9AC 2VDOL 1K5WA 1OWWA 3FOLB 5E0QA 2EDRA 3UXFA 1URLA 4K2UL 3QUXB 4G8IA 2Z0BA 2CHDA 2BY2A 2ZOLA 3QBTB 3ZHNA 4NO0A 4U6XA 5DRWB 4GQ9L 5KSAC 1TZGH 1F11A 4F58L 1NDMB 1KEMH 2CCLA 2F7QA 4XCNA 2V5RA 4DNLA 1A6WH 4ONFH 4MJ4A 1LDSA 5F1IB 2JVUA 2VXVL 4HZLA 1JK8A 1WFMA 1ZLEA 3A0OA 3PJLA 5JHDE 4TVPL 3ARPA 3K3QA 4ZO8A 2VQUA 3OM3B 5EZLB 1T1XA 2IF7A 3MFGB 4ZNEE 4RWYL 2X3CA 3GINA 3QFGA 1RK1A 3JV0A 4NZUL 1AD9A 5EUOF 5ITFA 2NY0D 2E6PA 2MCMA 2Z8WC 4JN1L 4FHJA 1OHZA 3SQOL 4HLZG 2EYRB 4FG0A 4GAAA 1NBVL 3INUH 3LXBA 4HJGA 4J4PA 4WEBL 5DHXB 5T1KB 3KNBB 3UG3A 3HS9A 1R3JB 1IKNA 5GJTH 3PP3K 3MBWA 2MNJB 1MHCB 3QJVB 2AEIT 2ITDB 4LOUC 5E00A 3TCTA 1O5DT 4HPHA 1NCUA 5ICZA 1XIWD 1I3GL 3JV6A 5ELIA 3Q8EA 4X8JA 2DYPA 1I4FB 4YWGL 3DX6B 4YHLH 1YEHH 4Z23A 3E6FB 5E5MB 5CKAA 5I82A 3WLWD 3DC0A 2NRDA 3B9KC 3U4AA 4TVPD 3RWJB 1K9TA 1A9BA 1OK8A 3H9SA 1MRCL 3RNQB 4ZD3H 5E95B 5IQ9B 1A5FL 3HB3C 1G7QA 4CADA 4KQ0A 2YPLD 1GZQB 1LM8V 4KHTH 5CP7B 1TO5A 3PY9A 5E9DB 3CG8A 4QCIA 4G8GA 4MKTA 2BHYA 3RI5K 5BO1L 4FNPA 1Q9KB 2CZNA 5B8CB 3QZWA 4WI0B 1EO5A 4E9WA 3KH4A 4K4KA 2IH3A 4BSWB 5BW7A 3GBML 4D0BA 4BFJA 43CAA 3QDMA 5JHAA 5DZVA 3U4EA 2EC9T 3SE6A 1S7UA 4FXLA 1F97A 3WDHA 4N0YL 2DDQH 5HJGA 3FO0L 5IIEB 1JHKH 5FYLL 4DQOH 4XN8A 2CKNA 3L7FA 4KK8D 4M03A 5DJAA 4P05A 3V4PH 4AMKH 1JXDA 2FZ3A 1D5RA 5FA4B 5GSRB 5KVDE 1KWGA 3BAWA 3LOWA 4PJ9C 2UZIL 2CJTA 4F57L 3OKLB 4M6OL 1YG9A 3AT0A 3FOMA 3K6DA 3MRNB 3TEXA 4C4KO 4ELKB 1U8QA 5J11B 3MKKA 4UILL 3T2QA 5EZJA 5DVKA 3FS9A 5D2LF 4I1NB 3NA9H 3O9WA 2SEBB 4MASA 3JYBA 3O4LA 2BOBB 4ES9A 5A2KH 3NESA 1I9RL 5KG9B 1DQKA 4KNQA 1HCYA 4MNGA 5ABAA 1WBZB 4YHZH 4FFTA 4PJFF 4QRTA 4WUKH 2CKBA 4PVBA 2ZPKL 3RKDD 4Z7UE 4Z8FL 2FX8L 1EHLL 1BGXL 4UV7L 3M7OA 3R0MA 5IHLB 5F1OB 5F88A 1T4KB 5BV7H 4NZDA 4H0IA 1E4JA 1B2YA 2WOYA 4N4YB 2ZKMX 2VZUA 4Z7WA 3UO1H 4R4BB 2CHXA 3AQDA 4P2QD 3CJJA 5A2JH 5DWUH 1DO6A 3MTRA 3EOBA 1X7QB 3P2DA 2NUPA 3V0WL 4YDLC 5I6KA 3IFPA 1SVZA 2ZKXA 4QXUL 1I9EA 3S37X 4LHUA 4JY5L 3W11C 4RESB 2UZYA 4FQCL 1K8DB 5HY9A 1NOLA 4IHOA 4ZTOL 2WVVA 3HZKA 5J06A 2C4FT 1T6BX 4LAJH 1HINL 1RAMA 3L3HB 3QEHB 2J57A 1CXLA 2EIDA 3QPQC 5TDNB 4Q97A 3QXAA 2PWEA 1HXYA 3FRUA 1PTZA 4XP6L 3UJJH 3Q6GL 1BQHB 3HIZA 5HHQA 3CXFA 1LVEA 1PZBA 2YWYA 1DSFH 4WSJA 5KVEE 4KNTA 4FLHA 2J1KA 4UQDA 4HIPA 4NWUH 2ZKYA 3OHXB 2XLLA 3C5XA 3AT8A 1RPKA 2EYTA 1UT1A 2WIIA 1JNLH 2CK0H 4RGOL 4WUUA 3KPSB 2OMZB 5MHSE 2LU4A 1PY0A 5C3IA 4TSCH 2H0JA 4QD2E 1EWHA 2Y5TB 2ZWKA 3HS0C 5DD5L 3GJEB 4MAZA 1F4HA 2JIXA 4N0UB 5JW4N 4J3OG 2YAPA 2OK0L 1ZSDB 1CICC 2Z91A 5D1XA 4F8TA 1QACA 2BNRE 3FRPG 4BKTC 3G6JA 2CO6B 2ZKWA 2OSLB 5HYSA 1E8ZA 4K3EH 1J5IA 4ZODA 3ZRSA 1K8IA 1R3KB 4O4YH 1NBQA 2QZ5A 3QDHA 2QLVB 3Q2CA 4HJSA 2DIEA 1UA7A 4DCQB 1ZS2A 3PWNB 1AXTL 5AW1B 2VQ4A 5MEND 2HX9A 1ROCA 4NM8L 1WICA 2LE9A 3PRZA 4OBRA 4UDTB 1TTCA 3HKFA 1TTUA 4X4ME 4PWGA 5FYKH 1CFNA 3LRLA 4FC3E 2CA4A 5E7BA 5B38A 5AVUB 2IH8A 2O5YL 5ERWB 5BRZD 4CVZB 4KUCF 5A6LA 1TNNA 2CLRA 3PQYB 1T5WB 5JQ6H 1A14H 2V5TA 4TNWF 1EZVY 3TASA 2E7CA 2EE0A 3KPNA 2J1ZA 3VG0H 1LEGB 4R8WL 3ZKMD 4WEMB 4YDVA 1DLHA 2VDQB 3AS1A 4U1LB 1IBBA 2G60H 2EIJB 2H9GA 3LZFH 5ADOL 4BZYA 1A4KA 1WK0A 1A25A 4MMZC 1B4JH 1HQRA 3NSXA 1OK0A 2FIKA 2FYYA 1GZPA 4X4XA 4FTVE 3CSPA 1T1YA 2FT6A 3BEVB 5F7YC 4R5TA 1AJ7L 1KLUB 5BQ7A 1CZ8H 4OLYL 1NIEA 4H8QA 1RIUH 3CVHA 3C6SB 3FUDA 3N1MC 3WIHL 2A0LD 3HNVL 4OH2A 3GI9H 3EFFA 1SLXA 4OZIF 3RVUD 4C4KT 4TSBH 1A02N 5IVXB 4CVUA 1UZ6E 1YEDB 3EJRA 1KIQA 3FB6B 2Y7LA 2QQLH 2G5UA 3IYLW 5FGBC 1OCWL 4JDZB 2W81C 4WKXA 3NFNA 3S37H 4ZQKA 3KD4A 2WB1A 4ZO7A 3S98A 3OTTA 3W9EA 2A3TA 5AVQB 1RD6A 1ULVA 2UWEF 5JW3L 2QVMA 4J2QA 5IW3A 1YEEL 3VWKC 2BP3A 1FFTB 2XBZA 3M7FB 4AKOA 3NFPA 3QNZA 1UOVA 4D9QD 2ZCHL 3IJHB 4MJIB 1BZQK 1SYSB 4C83B 3TBSB 1RJZB 5SX5H 1MJJB 4JL1A 1AGBB 5AWNH 1MIML 1U8IB 3WEBA 3LRHA 3A67L 1HHJB 4LARH 5L0QB 1CYXA 1N0LA 4B9CA 3RBSA 1L9MA 1E4HA 4BE5A 2X7LB 3MRFB 4JANA 3AZUA 3BH4A 2EZ0D 5HGDA 1DJYA 2WXKA 3TT1H 3OAYK 2FWUA 3GJFB 4AENA 3K72B 5AUMB 4ZS7H 1A7PH 3BCFA 4XNQA 1AGEA 2NY2D 1FFOA 1RUAL 2Q5BA 3CE1A 4FXKC 3K6IA 1Y1DA 3RP1A 1AGCB 3DVFA 4ODTH 4H5SA 1PVHA 1NFDB 3VRJA 5IMLA 1TEGA 4AKQA 5DA4A 5TQ2H 5DC2A 1UJ3A 1UVQA 2VR9A 4HSQA 5TD4A 4K94L 4UAOC 3TO4A 1DFBH 5IBTL 4BIKA 4MCZB 4ZFFB 2HJKB 5I30L 1OW0C 3VWJD 4JRWA 2VH5L 3BPNB 1NDGB 2E27L 4WI6A 1KEGL 4IGBC 4Z3IA 1KYOK 2NUTA 4F2ME 3VQ2C 3QI9B 4AH2A 5EU7E 1FNEA 4LVNB 3O6FD 4J27A 3WE1A 3K6SB 3TXAA 1IC7L 3BHBB 3DOSA 4ZFOB 3R8BB 5KVGE 3AS0A 4HDIB 4AIOA 3EJZD 3BZ4A 4XB8A 5GGUA 4BXSV 3RUGF 3S5LB 3JTBA 5I1HH 2DQFA 3GHBH 3TFBA 5I1JH 1T22A 1XCQA 4UDUB 2ZUXA 1AXSB 4YNYB 4JFED 1MJ8L 1E30A 1YNTF 2NX5D 1KPRB 2RQEA 4XN2A 3U0PB 3CWGA 3QR2A 4FQXA 2DI9A 1S78D 3S96A 1SM3H 4MQ7B 2P43B 4L5FE 3RILA 3ULVD 1AZNA 2X4QA 2HUEA 3CDGA 4L8CB 4TVPE 4BCXA 2BVOA 2A2QT 2Q2EB 1KLFB 4U2ZA 4BWUA 4S0HA 2AQ3A 1DVFA 4KTEL 1SN5A 1RI8A 1SEBA 3D3VA 4MJ5A 4RAHA 4URTB 5E23A 3RYMA 4U1KA 4UOZA 3WSQL 2YPLE 4AC2A 1FRGL 3OKEA 5CINL 4CVXB 2MOQA 4QLWA 5D71H 5L4IA 3EYQD 2VO8A 2Z34A 3TH4T 4HIIB 3N42F 4UB0H 2KZWA 5C97A 1CWVA 2BSCA 3HRZA 2IBBA 4Y1AA 4CVWA 2YA0A 3VFUA 4Z77B 5C0JB 3AQZA 1GHFL 2VJ0A 4OU3A 5F96L 1H5BC 3FUJA 5GGQH 4KX9A 4PRDB 2FATH 1JGVL 4X0KA 5IHZA 5D9SA 5J9PA 3CC5A 1CFQB 1U42A 1CBVL 4LSRH 2VLMD 4U7SA 2HVKA 1I53A 1LGVA 3TOPA 4CA4A 5D2LA 2W07B 5LKNA 1J0KA 3FSWA 3O11B 4W9CC 3FU9A 1K4DA 3VFMA 3RY6C 4QRSA 2VLLA 4Y4HC 4HUWB 3KDMA 1GOHA 4PJFA 1UD2A 1J0ZA 1EVTC 2FAUA 4GRWB 1NAMB 2WUCH 5EEXA 1TFPA 3CX5J 5K5YA 3PP3H 2ICWJ 2QBWA 2W60B 1JCKA 1PBYA 2VM4A 4XX1G 1OP4A 4WU7B 5IG7A 1TYJA 3CN3A 1HYSC 4IEFA 3OL2A 4WSGA 1WISA 3O4OC 3TYGH 4D9RD 1BEYL 2HG0A 5I17B 5JPMB 2GG1A 2OJ1A 3OKNA 1E2ZA 3IDJA 5KJRH 1F18A 3NSJA 4JM4H 4AJVA 2Q9OA 2L7QA 2YRLA 4PJBE 1FLTX 2IDQA 1ZV5A 4APQA 4JCMA 4PJIE 4QOKA 2NYKA 4QJ3B 4WLCA 2WSDA 5KTEL 3BAEL 3S3PA 1WA1X 3NEEA 4EN3D 2F2HA 5C0IA 4C56D 4P2QE 1N59A 4HKZA 2I60L 3D39A 4YVUA 1UWGL 2JE8A 2FQGA 3PHAA 3ARXA 4HHAA 1U91B 1TCRA 8FABA 2GIXA 1MH5A 1HEHC 1WCBA 1QHPA 2PWGA 1CVRA 4LU5L 4MA7L 1FGNL 5I6PA 1IM9A 1QSEB 4YDMA 3DA0A 3S4SB 4OZFH 4IOFD 4MDJB 4JFHD 2O30A 5TE4L 4G5ZL 1D9KA 2DQUL 4P2RA 4NNXA 1WWAX 2J8UE 4AY0A 1X4YA 4LSDA 2XZQH 1CIUA 1F6AB 1HCVA 4PAZA 5AZUA 3AWFA 3LSOA 3ZR6A 1ND0B 5FW7A 2GBUA 3HCVA 1FVCA 1HXKA 3JUYA 4XC3L 4KJYA 1Y0LA 3MV9D 5F1KC 5FA3B 4LLVB 4FZ8H 1DR9A 1DQLH 4AG4H 3EH1A 3DI3B 3LJ3A 3FSAA 4IU3A 1S7WA 5ALCL 1XMEB 2R27A 4DGVH 1P5UC 1UWYA 4XZUB 1OP3K 1ZANL 3UPCA 1NUDA 3LEVL 3HUJE 4GXVH 3O0RH 4AJYV 4IMKA 4X98A 3UTQB 4G8IB 4XMLL 2ZOLB 4NO0B 4U6XB 1DE4A 1MCJA 1N10A 3NZSA 4A2DA 5AL8A 3IDIA 2WO4A 1F11B 4AQOA 2J3SA 4TQEH 4XCNB 4ENZA 3QPXL 4AE0A 2WO3B 4N90D 1O75A 4YSEA 1DEEB 4KKLC 4WZ9A 1N4XL 5MENE 1SGKA 3ZYIA 4HZLB 2QGDA 1JK8B 4RIRA 5TF1H 5I15L 5KYUB 1MCDA 4HFUH 4P3CL 2IBZX 4NAQA 3VXQA 4FF9A 1G1YA 3DX7A 1T1XB 5BZXA 4AM0Q 3X12A 2YD0A 4B27A 4K0OA 5BRZE 1PDKA 6PAZA 4GAJH 1RK1B 2AF2A 4K3GA 4OLWH 3FCTA 1AD9B 5ITFB 3WUWA 5DEJA 3B2VL 5T5NG 2APTA 3BPLB 1GCYA 4JHWL 4WJG3 3UP1A 4AYGA 4M3KB 4OZIA 1TF4A 4IOIA 3FU3A 3ENEA 1GSKA 1KJ3L 4HJGB 1IC0A 2BFVL 1QABA 3BPCA 4P49A 3O2WH 4NHUB 3IGUA 3NZUA 3GUFA 4WEEA 3AROA 2UWEA 3IRPX 4WDIA 2DKUA 3CSBA 2JB5H 3MBWB 4KNSA 2PKDA 3IVKA 4DVRL 1NCAH 4OCWH 1DBML 2BRRL 1CLZL 3CFNA 3E38A 3IE4A 5E00B 1BFTA 3VI3E 5ICZB 4LSTH 3AACA 3JV6B 3ZSTA 2YFOA 3GLAA 4KJWC 4X8JB 1IIIA 2DYPB 3D05A 4R7XA 4GW5A 4W9ZA 3X1EA 1SXAA 4NCC2 2AJ3A 1X5XA 2K3TA 2X1WL 1KTBA 1XGRA 3GYRA 5JLZA 1T2QH 5JOFA 1S7VB 1QWUA 4LCIH 4NIYE 1UFUA 1A9BB 1CFTA 4NKOA 3H9SB 3QJRB 4YHML 1N6UA 5CJ5A 2X4NB 4V1DB 5D7KD 5I16A 1Q0EA 1G7QB 3L08A 4BHUA 2FCBA 4ZAKB 4CADB 3GUTA 3AMKA 3D34A 1CGUA 3CBJB 3BUIA 3QAZC 4D9QE 4FQIL 4QCIB 4G8GB 1NMBL 2VERN 3CHRA 1D5ZA 2WTRA 3QZWB 1HNYA 3K4DA 5IJDC 5EC1A 1BIHA 1ZEAL 1ZS8A 2IH3B 1PPIA 4OQTL 2CDEA 4D0BB 43CAB 2X6CA 3CN2A 3QDMB 3VFNA 3NIFF 3ROOA 4GG6E 1PG7H 3U4EB 1S7SA 4U0RC 3IEAA 4Y2DD 1S7UB 2X9XA 4QHLA 3ZDYF 4TNFA 1G1OA 1DQQB 2A6JB 3P0YH 4KO9A 1QZNA 3AXIA 3WNOA 3WCYA 5DJAB 5I76A 1PS3A 2HZHA 2FZ3B 4CC0A 5EA0H 4QMEA 4WGVB 2W8CA 5ID0B 4WRLA 3RUGA 2EXWC 5GJSL 2VYRE 4PGDA 1J05A 4QXGL 4RGMB 3E1F1 4X8XA 4I5BA 3ARFC 4IRJC 1YQVH 4FCHA 4Y4KC 1REIA 3T8XB 2AK4D 3ZPDA 3ARDC 1YNTA 5AB9A 3ERXA 4JM0A 3FOMB 3X13A 4H88L 5HI4D 3D07A 2YC1A 3IAQA 5E8OA 1BQKA 2OMYA 1U8QB 4AWJC 1VB9A 5EZJB 1MCRA 1QI3A 1X5YA 3QWRD 2DLGA 3O9WB 3TZVC 3O4LB 1GKEA 3MQIA 5F1NA 4FL4B 5B3SB 2FL5A 1RUPL 1DLFH 2A38A 2ISDA 4QRTB 2CKBB 1U3YA 5I8OL <