2BIHA

Crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
453
structure length
453
Chain Sequence
PFPVRQDSPLTEVLPTDLKTKDNFVARDPDLLRLTGSHPFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
total genus 137
structure length 453
sequence length 453
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bihA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2bihA01
2C9XA 2CA3A 3HBQA 2A9AA 2BPBA 2XTSA 2A9BA 2A9CA 3HBPA 1OGPA 2CA4A 2A99A 2BLFA 1XDQA 3R18A 4PW3A 2A9DA 2BIIA 3R19A 1XDYA 3HBGA 4PW9A 3HC2A 2BIHA 1SOXA
chains in the Genus database with same CATH superfamily
5DEGB 4NPKA 5F3FA 4A6YH 5DI8B 1WITA 2JSFA 5GZNA 2DEWX 1RIHH 4LSSL 2FWSA 3U9PH 1SLWA 3ZSSA 4Y4FA 3LNEA 1BGXH 4ELDA 3O2VH 1KGYE 3F7YA 4D9QD 5I5MA 3DGGB 1B2YA 2V33A 2G0KA 3KYKL 4HH8A 4QWWD 1CC3A 1MFCH 4JUTA 4MX7A 1LILA 3QDGE 4G9DA 2EJ1A 1L5GA 3UIZA 2KZ1B 5ID0A 3SQBA 5EUOB 1K5NB 2CIKB 3BC9A 3RWFB 1XGPB 5KN5A 3PV6A 5TQ0H 3GXIA 2HN7A 1VZHA 1XF5B 2A6KB 4PBWD 5EUKA 2ARJB 2FJHB 3KYMA 3BUBA 2DIAA 3AT0A 3GSNB 4JGUA 3IJ9A 3G9VA 3DURA 3AAZA 5A1AA 1UWYA 4AYBA 2P8MA 4Y9GA 1T03L 1OAUL 3FU7B 4UV4H 4X6FB 2ADJB 2OKMA 4X4XA 3U0TB 4Q9RH 3FQWA 3O9WA 4KX7A 1KJ2B 2R59A 4GNKB 1TVHA 2AKRA 3CDGA 4YC2C 4UTAA 2NYYC 3KEHA 5HHME 3HVDA 1NOFA 4YO0A 2DPKA 2PPAA 4K3EL 3HG0A 3VGDA 4X5XA 1MI5A 1QNZL 2NZ9C 1INEL 3PNWB 3NZUA 3L45A 2AP2A 3P4OA 1N6UA 4KDTA 4XP6L 4CRPA 1X5GA 1KJ2L 4QHUB 2BSRA 4X99B 3HW7A 2OAAA 3GSVA 1K4DA 2HFEA 2IPUG 3Q0HA 1N68A 4Z23A 1EGJA 2YAFA 4LRNH 4MSWB 3ARBC 2X4PB 4PWIA 3PWPE 4OJDH 4Z7VB 3HR6A 3W0WB 2GUYA 3QWRA 2N0MA 4YE4L 2R0KL 3D69A 4ZUVB 3WNPA 4NFBA 4G42B 2OSYA 2CDFA 3IRZA 3K5SA 3BIKB 4GSRA 2EH8H 2UY7B 1X4YA 5L0QB 4QHKJ 3EXJA 1DUZA 3ES6B 5GGVH 2QELA 2E9GA 4LB8A 4B3VA 1R6VA 2GUOA 4ZOAA 1BYOA 4HKBA 3K2UH 4NGHL 3S8WA 2HRLA 1JGUL 4UU9A 4JY5L 3QG7L 3RHWK 2CAKA 3CN1A 3AS1A 1H8SA 2ZG3A 3EZ8A 4R8WH 5E0FA 3MRFA 4IDJH 2H6PB 4B0MB 3D85A 2WZ6A 4DGVH 1TNNA 3OVUB 1YJDC 5E8DL 5K5YA 1UKSA 3NABL 4NOFA 4P46B 1UT2A 3VI3A 2E9WA 1SLUA 2YGNA 1XL4A 3H8NA 6FABL 3GDCA 3MCLH 2P52A 3G5VB 3POCA 4HC1L 1BQHA 3W38A 1GSKA 4QMEA 1HAWA 4LU5L 5DT1H 3WNOA 4IIZA 5CAYB 1NBYA 2OCFD 3UEQA 4XP4L 2E9BA 3WJMB 1G4MA 3ETBF 3AACA 1SUHA 2PWEA 5F3BB 2OR8A 4NDMA 5HHPB 1MXDA 2Q3XA 4GMTH 4JHWL 5DJDA 3BVWA 1O0VA 3KXFE 1ZVHA 1OF2B 3FW6A 4U1LA 3UJTL 4ZX6A 1IBZA 4ISVB 2CCLA 3S3BB 1WWBX 5EOQH 5F96H 1DQJB 2IDCA 2DQJH 1A1OA 2Z31B 5ENWA 2MQ0A 3D39A 3GJFK 1WYJA 3O11A 4AIEA 4V2CB 4RCAA 1OK0A 4F8OA 5BRZE 2O6EA 4KKBD 1M6UA 1FNGA 4KX9A 4ONGH 4UT9A 4Z7OF 5IUSA 5D71L 3ORJA 5C6TH 1AANA 1WTLA 1N59A 3UTSD 1AZVA 1E4JA 1P7BA 1MREL 1RPUA 4DFHA 2V9RA 1F56A 5FKPB 4ZW5A 2YD2A 4JAMA 4PRBA 3WFDH 1AO7D 3JWNE 3BUQA 3ZE1E 1QFPA 2BVOB 2QPSA 4QHLB 4FKKA 4MGXA 2ORBH 3MNWA 4R4NC 3ZZQA 1UUNA 3QCUL 4Z7NF 5KVFH 2HFFB 4XN4A 3G04B 1EJ6A 4LAQH 4YEEA 4Y5VC 1IM9D 1VF5C 2G3MA 2D31A 2WNWA 3KPNB 4PJ5D 1UCTA 4XBPB 3F84A 4FKHA 2WO2B 4LHUB 4N2GA 2EC9U 1M05A 4N0UE 4BZYA 1YPZE 5FB8A 4U7KA 2XZAL 4TV3A 2CUIA 1NC4B 5EO0A 4WW2C 3TV3L 4G8FA 3QIWC 1KENH 4DVBB 1U2HA 4KXAA 2YPVA 5SWZA 3EO1A 2GTWB 4NQDA 4HIXL 3KLSA 2AQSA 4GKZB 1JHLL 1DDTA 2JH2A 2DDQH 1D5MB 5CEZE 5E6YA 5FCSH 2ZWYA 3MO1B 5TPWH 3MXVL 5DD1L 4LVEA 5TFSH 3SDDB 2OW7A 1F41A 2CBPA 4KKBC 2YZ1A 2QJDA 5AW1B 3VD1A 5FYKD 1UZGA 1KUMA 1MY5A 4G71B 2VSCA 3MBEB 2J8OA 5D5MA 1GGUA 1YY9D 4B9IA 1J1XL 1ORQA 5DMKA 3SYOA 1XT5A 3GI8L 3LOWA 1C1EL 3NP4A 3EOBB 1F5WA 1SYVB 2WLLA 2W91A 3OKEB 3EYOB 4OFYA 4P9HC 2H0JA 2EIMB 4H20L 3JV6B 3FB8A 1X9QA 3A24A 3NSCA 4FCHA 3ZYZA 2FWOA 4ZFZB 5IKCB 1BCIA 3RAJL 1UFUA 5I1AA 1KIRB 2P5ED 4OB5H 4F57H 3QRGH 3DOIA 3Q01A 4APQC 1HOEA 4TYUA 4XC1H 2NW3A 3HVNA 4GRLD 4I3RL 4DP0X 2WO3B 4W4OC 2EVHA 4JCMA 1S7QB 2PCFB 4R7LA 3GBMH 1WV7T 3VUAA 1HAUA 4JDZA 5BV7H 1EFQA 5E2UH 2ZOTA 3OXSA 1IQDA 2EDEA 4P23D 4AVIA 2EECA 3D12B 2FNWA 3LH2H 1LJMA 4LQFL 4XCNB 1DO6A 2ADGA 2NX5E 4OD1L 2JI2A 1W0WA 4KTEH 3I6LE 1L7IL 5FGCE 4I1PA 3X1GA 3IDGA 1S4IA 1RULL 3X12A 3HTLX 5HDBB 5AW0B 3EDJA 2V3EA 1CF8L 1DYZA 4GKOA 5AW8B 4CC0A 1JK9B 2EDYA 4PJ7A 4RISH 5AOKA 3TBSB 4YVNA 1RV6X 1P9MC 2YK1L 5B1BB 1BMZA 4YHMH 4ZBJA 3OHXC 3ZTEA 2VM9A 5KSVB 1OAKL 3PYCA 1I7UA 5I19L 1DUYB 3N91A 2CPCA 3IB4A 1G7MB 3FNKA 3TJHD 3WUWA 5I6KA 3MLWH 1A2YB 1QFWM 5D1ZB 2OTWB 2FX9H 3IMRA 2F0CA 1MRFL 3O8XD 2HTKD 4HLZH 4JDVA 5I1IL 4Y8AA 2QVMA 4IGBD 3TF4A 1WFNA 1KIPB 3J07A 4LCWE 3S88H 4JFFA 5CD5D 4KJYA 3KWUA 2D7QA 2WSPA 4NQEE 5E1IA 2JF1A 3J27A 1IT9L 3PXHA 2IBZX 1RI8A 5HDQL 2IDUA 5I1JL 1HHHB 5BQDA 2C1PA 1GCFA 2AANA 2HLEB 5E08L 2X6AA 4QXUL 3VFOA 2KKQA 1W91A 1TO4A 5C0BD 2FSEA 3QA3B 2F08A 3DUUB 1H6UA 3L95A 3ZDXE 4XH2A 1FIGH 4HHAA 5DEFA 2DM7A 5I30H 1TZGL 4ANXA 4I87A 3BUDA 2FH6A 4LCYB 2YWYA 2AK4E 4QCIB 4NQSA 5C7ZA 1K2DB 4JFQB 4PP1C 4Y89A 3X1NA 2PWHA 1W80A 4Z7NB 1HSAA 2G9HB 2WO4A 3NJGA 1INDL 1N4XH 3JZYA 4L9DA 5TE7H 4MB4A 3K81A 1KC5L 2OXGB 3QORD 1VA9A 4JHBA 1UQSB 5I15L 1KXVC 1UYWL 2CM6A 4JUSA 4L3AA 1ZDSA 1S9WA 3RIAK 1H9VA 3GRBA 4OIBA 2VDMH 3Q6GL 4Y9BA 3O8XC 3U30B 1YYLL 4K7PY 3AB0B 3BZ5A 4ZFFB 1KCRH 1O7DC 3CU7A 3IK2A 5CGMA 1MEXH 4M5SA 5E2VL 2V37A 2KYIA 2YKKA 3OKNB 4J27A 3L3GA 3IETA 3M1CA 3HLAB 5AZ2L 1V7ML 3BKCH 4JG1H 5DC0A 1KIUA 3K6NA 4G82A 2GJ6D 3WKNA 2I07A 1CBVH 3F12B 1VFAA 3QXDA 3BCFA 4HALA 5HGGS 2DWTA 3RA7L 1AKJB 4M5YH 5E6SB 1OD9A 2WXMA 2Y0SA 3KLDA 5F1OB 4JFYA 2DD8H 1UWFA 2RD0A 3T4AC 4LDLB 2VDKH 4J5VA 1U8LA 3TBYA 2P26A 1SBSL 4AMKH 2I85A 2NOYA 2HT2C 3MV9B 4XNDA 4MKTA 1ADQA 5I1KH 2XIIA 5L6YH 5CWSB 3NCJL 1NIDA 3WJLC 3I2CH 5DS1A 1NAMA 3RTQA 4A7UA 2XV2A 1JF1B 1HSBA 2CG9X 3MJ8A 1F3JB 5I8EA 3QORC 4I77L 2V3FA 1GAFL 4WW2F 1CGXA 1YMMA 3BWAB 1RFDH 5D6CB 1D5XA 4DTGH 3JUZA 3PL6D 5KTEL 2WLYA 4R5XA 2PR9A 5FFOA 1R4XA 1IGFH 4KKQA 2CHDA 1W72H 1AGFB 2PO6C 3QQXA 4PLKD 4QUOA 3H9SB 2Q10A 2OQJA 5KSBF 3O4LD 4GBXA 1YNLH 2X09A 3BD5A 4LSDA 5ALBH 3R7QA 4Q7DA 5DQDH 1R3IH 3VM7A 2SEBB 3CQQA 3HC2A 5EN3A 2WKGA 2R4SL 3MOBH 3FBKA 5AVRB 1SY6L 5T3ZD 3ZJAA 4XCCL 2W0LA 4AL8C 4M9PA 4X6BA 1BBJB 2OK0L 3RWGA 3GS4A 2JVUA 1WQVT 3TPKA 3H7BB 1ZDQA 1ZHLB 3OF6A 3CZEA 4OAWA 3HB3B 5F1NA 3I9GL 4UQ3B 2VC2B 2ZT9C 2ZCZA 4G6MH 2R2BB 4X8XA 4RFOH 3FHAA 4DUVA 3EFOB 3MLRL 3P2BA 2DQTL 4G5AA 4AITA 1GS8A 3LQZA 4PP2B 4GO8A 1IEBB 3NA9L 2YMXH 3HZKB 4E42A 2H32B 3ARBB 3EKCA 2LQRA 3BAIA 3LRMA 4JFVA 4N5EC 4PTTA 5IZ7A 1ZKAA 2X38A 4RMRA 5L2KB 2VDOL 2QEJA 3OZ9H 3QI9A 1RZ8A 3EOAA 3QIUA 5CN2A 1XEDA 3CE1A 4S1QL 3V5DA 3IKKA 2VLKD 4ZMLA 3E6FB 3S48A 3QNZA 3T3PE 1ZANL 5G5DB 3SDCB 1LQSR 3K1KC 1K3IA 1BHGA 3CAFA 4BH8A 3SB3A 4N9GB 4LLDB 4E36A 5GJSH 2BSBA 1S7WB 4LFHD 4GSDH 4K3GA 4KV5E 4QTIH 3MUY1 4XPBL 3K5RA 4PQXA 4QTHA 2WYIA 1QSFE 3U7YH 5FGRA 1J5HA 3JWDC 4LVNB 1OD7A 1GPOL 1MCKA 4HMEA 1P1ZA 4GAJH 1UXSA 5HGBA 3AXIA 3BDXA 3ZR5A 3ATFA 4EUPH 3BP4B 4YSQA 3ARFA 3OJDB 3D1MC 5TF1L 2X9XA 2F19L 3OKLB 4Q4EA 4BKLB 4NWTH 5I5RA 1ACZA 1IC7L 1ZLDA 2B3IA 1ZT4B 1T2JA 2VZOA 4F91B 2GAZB 1P5UB 3ZT5A 4OLYH 1ZV5A 1XQ4A 3FUDA 5I23A 3MRNA 4HC1A 3BDYL 5I6NA 1SOQA 4YPGB 2DQCL 2NQCA 3EJYD 3ULAB 3FUIA 3I74A 4LPYA 5DZNA 1W6WA 3UACA 4P2QD 1DZ0A 1VGKA 4OIIL 3WAKA 1WBZB 5DK0B 1LO2H 1YEEL 1CU4L 1PLAA 1YMHB 4MMYA 3C6LC 1MNUL 2AABH 3DX9A 1UD6A 4XRCB 4U0RB 3P11H 4EOWL 3N9GL 1HH6A 3Q5TA 2PYFB 4I2XE 2FX8L 3GYRA 5ESAB 2DLFH 4KI5C 2GPZA 3OM3B 3JZ7A 2P5WB 2BINA 4YLQT 3O6LL 4M6ML 2UV3A 2Y69B 1YLBB 4DCQB 5BUPA 4GLRH 3KPOB 3D4CA 3EJRA 4L29A 2XWBA 3NYKA 3BHBA 4OZGF 4HWNA 3VX1A 1L0PA 2FLMA 3IFNL 3KYAA 1A0QL 4GP8B 2VXSL 2X3AA 4QXTA 4PRDB 2V7NA 3ECBB 2X1XR 3TU6A 3WIFA 5EU4A 4FXTA 4MQXD 3S5LB 1Q72H 4Z7WE 3LH9A 5F70A 3BVTA 4Z3IA 1IGML 3LKPA 3JV5A 3NFPB 4U7SA 2RJMA 1NTDA 2P8LA 3C12A 2QDVA 5GGQH 2PNDA 5J1AA 4HOXA 2GK0B 1XSIA 2X9YA 3HAEB 4OZFA 1CTNA 3SDYH 3BP6A 2DQGL 1Q90A 4GUQA 1MFVA 3N85L 4Q0XL 3UJIL 1OE3A 3SZKC 1TXKA 1JHKH 2GBTA 1O6TA 4JO5A 4YLBA 5LO7A 1B4RA 3NIDE 2BNUB 3JTSA 4KROC 5KSBB 3QIBC 5F7MC 3FU6A 4QXGH 4PBDA 1NIAA 4HSAC 3V4UH 1MH5A 1KN2L 4ODHH 5HVGB 2BX5A 2IGFL 3QJVB 4NUJB 5INCA 1WAAF 3FU3A 2NY4C 3LEYH 4LCIL 2JJTA 4P2RA 1AR1C 1K8DA 1MLBB 4DP6X 2F74B 2QR0A 2C9XA 2VJ0A 4HETA 2VMFA 4AJWA 1AY1L 2EH7L 2R29H 3GBEA 3CBJB 2ED6A 4ETQA 2CNZA 3BVXA 4XOAA 1ADWA 3QSKB 4BQ9A 2K8QA 4MMXA 4HISA 1P0SE 4XZ4A 3VXSE 1JV5A 2JKSA 3MRJA 5EBLB 1IGYA 2R51A 3EGXA 3WE1A 3CXHK 1GOFA 1NZRA 5ALCH 3V7AG 1JG9A 4XMTA 3C08H 4NNPL 1LO4L 4HJ0D 5DFWH 3MRHB 1TETL 1NCAH 4O4YL 4CVXA 2JELL 9PCYA 1KXTB 2MNWA 5HJBA 3O3BA 2EO1A 2P45B 5B8CC 2VLLB 1H8LA 2C4FU 2WLIA 5BOZG 1QHPA 2BVQB 2DMCA 4UM9A 3OAUL 1MQKH 2ROYA 4NXKA 5D1QB 3UYOD 2BSTA 4DEWA 4Z76B 2C3VA 3MBWA 3SQRA 1N70A 4V1DB 1R9FA 3DPBA 4XBGB 2NTFB 5J0BA 1ESOA 1MWOA 4OLXL 4FXKB 4P5MA 2IALB 1HN1A 2EIJB 2ZAIA 2VAJA 3REVB 4PJDA 2WWOA 3GMPB 3R7RA 1U8HB 1OGAB 1GGIL 1WA2X 3DTXA 3HNTH 3NCYS 4PIRF 3ZXAC 2RIKA 2GW5A 1OAYH 4PJCA 4WDIA 1I8MA 2WXKA 3SDAC 5FECB 1MIML 3AXLA 1ZGLP 3GS7A 1KIQB 2VDLL 1E5UI 5D1XD 2P46B 3DX8B 4ODVL 2VN4A 2YRZA 4KK5D 5IP4A 2QSCL 2GHZA 5J6HA 2IAND 5IOPB 3M46A 1OPGH 3QDJE 5CZXD 3GM0A 2DWDB 3ZRSA 3NFSH 4IIQA 3OGCB 4PREA 4W4NA 1TR7A 1WEJL 3VWJB 3TEYA 2DH2A 5JW3H 1E2ZA 3Q7JA 4HJ0C 3GGWB 5DWPA 2A1WH 5F1KC 4PY8I 5AAMC 5T1KD 4A2FA 1I75A 3NPSB 4JGNA 4YSAA 4EN2A 1MWAH 3SE3C 2NY7L 3JT0A 2HG5A 1QAWA 4R26H 1V10A 2NYKA 3UO8B 4KKRA 1AJ7L 4Z3GA 1DLHA 2XETA 1EBAA 5D7SH 4PG9A 5KSAD 3G9AB 2AMGA 3LZOA 1Z9OA 4RAVB 3J2PA 1Y0LA 2B1HL 4Q14A 5B22A 5IEKB 1FO0H 1KEMH 4UZSA 5T1LD 3UTOA 4MD4B 1KELL 1RZFL 1TZOA 2BIHA 3RJOA 1MKFA 2YQGA 1ZLWH 5CF3A 3D2UD 2WWKO 1PD1A 4OZGB 5AWNL 5IGXL 3HHRB 2V2TA 3VH8G 1N64H 2YO3A 2VB5A 5KYNA 2DKMA 4WUKH 4A66A 1P7KA 3T1FA 4AQ8C 1CD1B 3VG0L 1DJWA 2YMTA 2EC8A 3LIZH 3SPHA 1X5XA 3HPLA 4KHTL 2I9TA 4G59C 5M7QA 1VEPA 3GMMB 4K8RD 1NGWA 1XGTA 1YHPA 4Y4HC 1CI5A 1I8KB 1NBVL 3NIFE 2IBGA 4PJBE 4PMEA 1D6EA 2VH5L 5AL8A 4IRSA 5IHUH 3VXMA 1S8DB 1OALA 5CSZB 5L4FA 3UTTE 3C87A 4FTVD 2KLTA 1E50A 3BWSA 3UAAA 1C5CH 1NCDH 1NLBH 3IDIA 5IV2B 4KI5F 2OXHB 5L4JA 4KZEL 2E9JA 2CMRL 1GJWA 4F5CE 4JFPB 1FFNA 2A6JB 1HI6B 3DSNA 3MLSL 3PE9A 4D0BA 3GNML 1V7NH 2F8VA 2FIKB 1XD1A 3MLZL 3T4AB 3T9WA 3FCSA 4GUCA 1WC7B 3EJCA 1QTYT 2FLBT 5E6IC 4JRXE 1R19A 2J6EH 2Y2TA 4X0KA 3V4PH 2ESVE 2BVUA 1QW9A 2ZUYA 4QRRE 1JYNA 1BD2A 1LNUA 4KUCD 4PJFE 5F7FA 4I7ZC 4P59H 4CVUA 4PW4A 3ULUD 3R8QA 1MFDL 2BMKB 2VN6A 1CD0A 3D0LA 1FYHB 1PCSA 3LS4H 3P4MA 1TITA 2O5YL 3PP4L 1X5ZA 4HIQA 2F15A 2WTOA 3MFGB 4JFOB 3RUGA 2C1OA 3HMXL 4LMQI 2XWDA 3N06B 1DJZA 3GZKA 5I1LB 2OMZB 4R0LA 1FG9C 2A9ML 5E03A 1C7SA 1E9QB 2NY6C 4K8RC 1ITBB 3NAAL 4RWYH 4EN3D 2PO6B 3NBNA 4KMTL 4Y2DB 5JOFA 3TT1L 1DBJL 3UTQB 5D7JD 2F7IA 5BPPA 4WU5A 4H8HA 2RBLA 1QLEH 2VAAB 1NGZB 3FTGB 4N85A 1A1MA 3L3DB 3HNVL 1MCFA 3W81A 1BIIB 4OZ4B 3G5YB 5EUOE 3AG2B 3VDCA 3ZX1A 1Q8MA 4R3SB 5ID1B 1F6LL 3RVVD 1X4XA 4XPHL 4M9OA 4JHUA 4KUZH 4RRPM 4G7YH 2Y2WA 5IW6B 1MAMH 4YZWA 1J88A 3FTXA 3QVAA 1JHTA 1SY6A 2YRBA 4NYLA 1EHXA 1RMFH 5FHBL 4BE6A 4RLDA 4ZUTA 1UZ6E 4BUQA 4IQHA 3LIUA 1WTGT 4A6YB 3H4HA 1KT2B 3VG9B 4IMKA 3VFTA 5JR1L 2OP4H 3GFUA 2IWKA 3PREA 4PYGA 5JHDB 1JPFB 1HEZB 3CTTA 2V2WA 2P9RA 4WFED 1HYRC 5AZUA 3MRRB 1L7TH 4A04A 1ZLSL 3CZKA 2VE6A 4U6HB 4YMPA 1IGIH 2FSDA 5TE4H 4LPXA 1IBFA 1AD0B 3V0GA 3UCQA 1K4CA 3QDGA 1EAPA 1BEXA 5CP3A 1U8PA 2BS71 2HVKB 4OCNC 5HHOD 4BIKA 3FMGH 5CILL 5D4IA 3D25B 3SYCA 4ENZA 2EVGA 4ACPA 4GG6F 1YVLA 4FHKA 2J5LB 3VXUE 2O5XH 4B60A 4LSPH 1H3WM 1XCTB 4Z7VE 6PCYA 2IXQB 3ZDYB 1DJYA 3W0WE 4NUGH 3W37A 3TBBA 5CCKH 3CG8A 4P2YA 2RQ8A 2VDRH 4OF5A 3PGFH 5CS7A 3WENA 3ML8A 2CJSA 4HT1H 3A23A 3SD5A 3L7EA 2IH3B 3IDYC 4MS6A 1ONQA 2XG5A 2CKBH 3LB6C 3L5HA 1LDPL 2BNRE 5TGBA 4YSCA 1N7MH 2VSMB 1MZZA 2Y07H 3LZFL 5J9PB 5LDSA 4K23H 2NY1C 1OM3H 4W9FC 3UMNA 2WVTA 5IMOB 1T4WA 1YA5A 2Q9OA 4JO4H 4QHNA 3B6SB 5CZVH 3ESMA 2ALAA 4P06A 5E4AA 3FO2A 4W6WB 4I48B 4Q9RL 4FA6A 1RUML 4Y9FA 1T22A 2DQFA 2CJTA 2CO6A 1E90A 3CLWA 4JX0A 4ZXBD 1N6QH 2IV8A 5JHLH 5MHSE 2LU7A 4E9VA 4X9BA 3QJRB 5E8PB 1VFMA 3B8YA 5DYOA 1L6XA 2L04A 4NWUH 5EIQA 3T0BA 4DEUA 2EZ0C 5JMRA 5LGJB 3B1UA 2XI9A 3C6LB 5FW7A 5FX3A 5F7EH 2FO4B 3LJ3A 4HJGB 1E3FA 2C9AA 2DTMH 4LRNL 3D3VD 4E9RA 3HMWH 4JFZH 2XTLA 2CRYA 2Q2LA 4HIIA 2WVSA 4Q6KA 5FDYA 2OCCB 2V9TA 5C08D 2JCCF 1MVUA 35C8L 3CZJA 1CDJA 1XGUA 1XTLA 2Y3NA 5CJXA 2EH8L 3RL2B 2D7NA 3QS3A 5C0EA 2Z91A 1Q1PA 3MA7B 3VACA 3KM2A 4AC4A 1CWVA 3B9VA 4RIRA 5HI3C 1HWWA 3OSVA 1CFNA 1RERA 4F8QA 3K2UL 4L1HA 4LLQA 4BFFA 4NZJA 4G1MB 1FGVH 4MD0A 3MRQB 2G30A 1QHQA 1G7LB 2VLJB 4R8WL 4ERSH 4H25B 2A74A 2IWFA 2ZE0A 4DO5A 4NKMB 4GP5B 4H1LH 5JW5A 1F45A 2ZUQC 3JWOC 1BECA 4DGVL 5F7UA 1BW8A 2C9VA 3WE6B 5GS1A 3B9DA 4UUJA 1RK1B 5F3HA 5C9KA 4GAAA 4MNHA 2IAMA 1RZJH 3SE8H 1MJUH 4NKDA 4PG2C 25C8H 3L4TA 4EVNA 5CCGE 2TSBA 4JFEB 2Z0UA 1J8SA 1T2QL 1ZXQA 3KXFA 1I3RA 3FSOA 1EX0A 2FO8A 4KROB 1NWOA 2OI9C 3QIBB 2WUCH 4JM2B 3AGWA 3KWTA 1JNHA 1LO0L 1ZOXA 1OT2A 2F53A 4LSTL 1A5FH 1THCA 2ZXGA 2VXTL 2ZUVA 4JDEA 5TF0A 5CLYA 1Q4NX 1ZK5A 3RBSA 4TTGA 3HPJA 3WEXA 4BRVA 1GYCA 4GMTL 4RAHA 4O2EA 4ZTOH 2NY4B 1KDIA 3P2TA 3ZIMA 1F4WH 2PP7A 1PF3A 5EOQL 5F96L 3NGBB 5GSRA 2BFVH 3SGKC 1S7UA 2G60L 4L8CA 2WQUA 3VFRB 3FRPG 2EYSA 4G2AA 3BZFB 1L0YA 1CVRA 4DWHA 2LV4A 1HQ4B 5DJ2B 4WW1B 1S3KH 1HHGA 5KVDL 1JNLL 1JE6A 4G83A 3E6HA 3FN3A 5C6TL 1AXIB 1RK0B 3L13A 5JZ7C 4FJZA 1LEIA 4YHPA 1CGYA 1N8ZB 2P49B 3LHAA 4YDLC 1UXMA 5GXBB 2R23B 3EYQC 3OAYK 4JK0D 4M93C 4B50A 4B0MM 4N2MA 3WFDL 1U42A 1KLGA 2XA8H 1KGWA 1YPZA 2DLEA 2XYCA 3IJHA 2ZXEB 5KVEH 1SHMA 4Y4FD 1F2XK 5D72H 3CFUA 4PGCB 1I8IA 2ORBL 5B8CB 5KVFL 4LAQL 1EZVY 4C56D 4IOFD 1UD8A 3ROOB 2UY6B 3FT4A 1LHZA 4ZOCA 1UACH 3FQRB 1IEAB 3US1A 3U6RA 3X3GH 1CZ8H 2I26N 5FGBA 5DVLA 5DWUH 3FH7A 3VNZA 4BEIA 1WWCA 4QNPF 2BFGA 5HDLA 2JB6B 4HLEA 1T1ZA 4ZTPL 1NCWH 3BPOB 2AQ3A 5CJOH 1KBVA 3HHMA 2WNXA 5L8KB 2WVVA 2FGZA 3AREA 3BP7B 4HFUH 4PJ9B 2DDQL 3SDAB 2AZUA 5CMAA 2V5RA 4JMNA 3B37A 2DQEH 3ETTA 2B59B 5TFSL 3EFFB 1E2VA 4GYBA 3O9WD 1N67A 3P0GB 4ONHA 1ZLUK 4ELMF 3M6DA 1EEZA 1FNEB 1G7PA 1CXLA 3VWKD 4JHAL 1UXWB 2V0AA 3TBTA 1LQBC 1JDAA 3OR7A 5FO7B 5GGUB 5HDBE 4AMWA 5CM1A 3A6BH 4B6ZA 4N1HB 3C60D 1E9OA 4EAEA 4F8PA 1MI5D 2CU9A 2EDQA 1EPFA 4NRYA 4Y4KA 4D0DB 2XBZA 3O6KH 3JBG7 3NCCB 1DQDL 4A68A 1HL8A 3CN2A 3G6JA 3VO0A 5IIEA 4ICXA 5AW2B 2N56A 3IS0X 2ITCB 3VD5A 1XF2A 4BFIB 4G1EA 4FNPA 4P3WA 4Q74A 2HJKA 3MCG1 3CZSA 1R5IB 4F57L 2PR4H 1PMYA 1DBKH 3QRGL 1V54B 4J3BA 5BV7B 4YLCA 2XY1A 1EEYA 1RZKC 4IEFA 4XC1L 3SYQA 4GAYB 5IVNA 1OHZA 5DJ8A 1YYMH 3HE6A 3KJ4C 3VCLA 4H2AA 5B38G 2WAHA 1N0XH 1WAEA 4XPGH 3S3CB 2W65A 2ZUWA 3FUNA 4FQJL 3GBML 4LEXL 3OKDA 4ZUUB 5BV7L 2NTSP 1ZPUA 5KAQG 4CSTA 2IPUK 3EDKA 2DQDL 4YHZH 2Y7LA 3TA3D 1UM5H 2GI0A 2H8PA 4ZX4A 4W9LC 4Z7OE 1UT9A 3ARDC 2K9UA 1J1PL 3LX9A 5K33A 4IBLT 4K73A 1IGTB 3ULVD 5AW6B 4RMVA 3RY6C 3F65A 3KGRA 1KB5A 3VWKC 3IXAA 4GAGL 1SXCA 3JV4B 4FFTA 3ZY7A 3C60C 4O2CB 4OZHF 4OFQA 4RISL 5B39G 3SGDH 4RZKA 2IPKB 3PP3H 4FE9A 3CC5A 2X0UA 1A7OL 3QNYA 3OKMB 4Z7NE 4X6DF 3MUUA 4KVPA 2PLTA 1U93B 1IIKA 2NXZC 2XFGB 2KPNA 1VPOL 2YAEA 1C5BH 3KPRB 1FPTH 4UOZA 4CN6A 1A3RL 3BQUC 4XVSL 5K39A 2AQQA 1E42A 4ZPVB 4NQEA 2YC1B 4IKKA 3MLWL 4L8BA 4ZUWA 4EBQL 2P24A 2X70A 2FX9L 3AZUA 2ZUTA 1HU8A 1BFVH 3FOLB 2YXVA 4OI9A 1RHHB 5KSUB 3S88L 3WNIA 4CVWA 4Y19A 3D39D 4UDUB 2IAAC 4QHPA 5F9OL 1TU2B 4XNXL 4JFSA 5E6IB 4C4KT 1XCWA 4M56A 5HGAB 3BE1L 2NDGA 2O4EA 2DI8A 1IQWL 3A4DA 4DPRA 1MHPH 1FAIL 3TA3C 5AW3B 3CV5A 1I9JL 1YNKH 4JE0A 2H2SC 4G6JL 4NFDA 5EOCH 2GC4C 3QHFL 4WRLA 5KYXB 3FBQA 4KBPA 1S7RB 4LNRA 1JD7A 2YFOA 2WLNA 1J5CA 1RUAH 1FYTB 2R9HC 4XPTH 4EXKA 1FIGL 4GLRI 5FA4B 5FM5O 5FOBA 3MV9E 3O3DA 3LN5A 2O6DA 3MAWA 2VDMB 5HYIA 2F1EA 5B3SB 2WUBH 4AYEC 2DYSB 3VRJB 2Q6WB 3HZMA 4M7JL 3QZPA 3TNNB 2CA4A 4Z78A 2X44D 4XO8A 3G5XB 5TE7L 1PPIA 2GSIB 4JW3A 3MRMB 3RGBA 1YEDA 4PJHF 2FT7A 3CK0H 4H1LG 4MQ7A 5F97E 4BCZA 4B9KC 5D7IF 4ANVA 4KRLB 5SWZD 1EHAA 4NNXB 5EZJB 2A83B 5DCCA 1XCQB 2LHAA 4CC1A 4U6TA 3H9SE 2EDFA 3MJGX 4Y1TA 3EH2A 4FFVD 5GZOD 4GEIA 5GS0H 3PHQA 1T7XA 3V9FA 5GRVK 3U82B 3BKCL 3DROB 2VDKB 3AS2A 3QPQD 4MHHI 1E4WH 3VB8A 3ZT7A 1CBVL 2FUTA 1T1WB 4QDGA 1V05A 2YQ2A 3DJZA 4LCUA 1KB9J 1Q9KA 1UH2A 4M5YL 4ELMB 3DNKA 2VZUA 5JW4M 3QUGA 5EWIL 3RLSA 1ZGLA 3VSUA 2DD8L 4Z7AA 3KAAA 2WBJA 2B8OT 1JWUA 1XH0A 4Z3EA 3LKNB 3DVNA 3CX2A 4GW5B 5EZIL 5HVFB 5I16A 1B3IA 2HRHA 2K78A 4NHCL 5EIIA 4MJJA 3B34A 4M6OL 5L6YL 2BNQB 3P3SA 3IGLA 3QHZH 4EI0A 1NBZB 4LDOB 4NQCB 2H1LM 3FQ4A 2JTDA 1W72B 3X1FA 4ODXA 5KZCB 4XO9A 4XX1G 5L2KE 2ENSA 1TENA 4KZDH 1MFMA 1FG2B 1JGEA 2W07B 1RFDL 4DTGL 2BIOA 5AYQA 3ZSTA 1NBCA 3WO3B 2FGWH 2ZWSA 1G5AA 5LNDA 1IGFL 1IL1A 2CO7A 3PQYB 3QG6A 1JZFA 1KTLA 4K5LA 4UM8A 4WK4B 5FYLH 1TJIH 3CJJA 3B2PA 4ZMPA 4KK8C 2Z0BA 2NMSA 1M7DB 1YNTF 2N4IA 1QA9B 2IH8A 2QVFB 5C0RH 5B1CA 4XMLH 3F00A 1UM6H 3N2JA 3WU1A 5I1CH 4WTXA 5DQDL 3X13A 1DANT 3V0VB 1KGCD 2ZSWB 3IU3A 5HHVL 2NLJA 2AZAA 2B7DT 3GSRA 5FUOL 3SQOH 3D33A 5DO2D 3PHOA 2MQCA 4LEOB 1AXTL 1A66A 4N4YB 2YA2A 1XSOA 1CICD 3BZEB 4H0GA 2VZ1A 1NSNL 4KTYA 4IU3B 2EACA 5KJRH 2IADA 2ZYSA 4OZHB 4G6ML 4TVPD 3K74B 4Y2OA 1S9VA 3MJ7B 2LU5A 3FF7A 4X6DB 4JM4H 4LARL 4ZYKA 5ERWA 3P9LB 1XMEB 3X11A 4JRYB 4W81A 4XXDA 3VVWA 4XO3A 2H3NA 4PGDA 3BGMB 1ETZB 3KS0J 2IO5A 3Q5OA 4N2CA 5LXGL 1IBDA 3MBXL 5C0DB 3D30A 2XN9A 3GM8A 1X5FA 5GGSA 3QZWG 4YSDA 4N2LA 3K6FA 4OBSA 4AMXA 1NUDA 5F0JB 1IEHA 4AVKA 1QSFA 3GJFA 4PRHA 1A4AA 2PXYA 3W82A 3TOPA 2NSQA 2Q7NA 2M8XA 1TQBB 2Z8RA 3O3EA 4EUPB 4X5QA 1AFVL 1DBBH 3NN8B 2HA1A 2JXMB 3FAXA 1PKQA 5IVXB 2MEJB 2ILLA 2VQ1A 3RDTB 3U7YL 4I5BA 5E00A 4N28A 3IAGC 3C75A 4JGMA 2YAOA 4UOW0 5DO2C 4J3WA 3T0EC 4Q56A 1GGTA 4A7TA 3NACL 2W95A 3DRQB 4UTBH 5I8KL 1KGUA 3IMUA 3TO4B 1J86A 4IBYA 1IAIM 1TZHB 4NWTL 4JFUA 3MTXA 1U3HA 4N3TA 4WVRA 4L3CA 1EANA 4M43H 4FQ2H 2LFEA 2J1KA 3T1WA 1MRCL 4OUOA 5C92A 2H1XA 1EFXD 2X3CA 2OI9B 1JBJA 5C0CA 2Y6SC 2X5PA 3HG2A 4PRPA 2PYEE 4X8CA 3UJJH 4ECNA 3IE9A 4YFLF 4X2UA 3WFZA 1N6VA 2XNAB 2KZWA 3TT3H 2VZ3A 1KPUA 1SF3A 3R18A 1LE9A 3QJTB 1ETB1 1KCUH 4I2XA 5ICYA 1AQMA 3E8UL 4F9LA 3L2LA 3RX9A 2AF2A 2A73A 5IB4A 3LHPH 1JTTA 2ICWI 4PJEB 3E9UA 4PU2A 2AABL 4HZLA 4S11A 3P11L 5KSBE 3U48A 1MCLA 1GRWA 4D8OA 3GB7A 2OMVB 5DK3A 3QB7C 2SODB 4PVNA 2DLFL 2ZJSL 3G5ZA 4AIXA 1P4IL 5GGTA 3ULVF 2IFFH 2E27L 3OAZK 4YXHL 1I8LA 2ADFL 3F05A 2HH0L 3TVMC 1JFQH 1FL5A 2AJUH 3NJNA 4M93B 4UINH 5F0MB 5CSGA 5TH2B 1Q0XL 2AK1L 5IHBA 3OB0K 1ACYH 3QDHA 1J10A 4PRAB 4R7DA 3NH7H 1JZ4A 1Q9LB 5AB0A 2WP3O 4JKPL 4NJAH 1Q72L 1YMMD 4JCLA 4R4BB 5DJ0B 2AMUA 2Y23A 3U0PA 1BFSA 2D3JA 5A43C 1COBA 4FQXC 4U1MB 1GXEA 1JJUA 3DXAB 3NSDA 4KPHH 4JREB 1F6AA 2OJ1A 1FGNH 5SWQB 3SDYL 1GCYA 5GIRB 4EIUA 4L4VA 3TCLA 2XWZA 2AQTA 1DLFL 1FN4B 5I9QC 5D1QE 4X7TB 1JGDB 2HT4C 2IOIA 4HMDA 2VDNH 1AI1L 1R3HA 3E8VA 4KOCA 3ZPDA 1U8OA 2X0VA 3PAVA 5HGHB 3HS0A 1A6TB 4RBPH 3UAJD 2AEQH 2WXIA 3DDGA 2P8PA 3CFJB 5ISZB 4AGNA 1OGAE 1QABA 3OF6D 3O6MH 3WNKA 2FR4A 1RL1A 3APCA 3ISYA 3V55A 3TN0C 4L9LB 5F6HJ 5DJYB 1WHPA 3HZ3A 2B0SH 2R29L 4J4PA 5BXFB 2HLAB 5HTSA 1JCVA 1BZQK 4QYOA 1A4KB 2D2OA 2KLSA 4IM8A 2BZDA 2UVEA 3QI9D 5SWSB 1YAIA 4YXKH 4Z3HA 5FW6A 1I85A 1VDGA 3C08L 5HGDA 3RPIB 4R4FH 3KJ4B 2C9SA 5HYJB 3F58L 3M8OL 3NSJA 1ZT7A 4OD2B 1E6OH 2Z92B 3MGOB 4LK4A 1INQB 3EJZD 4LCCA 2NUTA 4WFHD 5JA8B 5E8EA 4K9EH 3MLTB 1BJMA 1TQCB 1ZS8B 5EBGA 1IM3A 1X6NA 2MRYA 4PRIB 3FFDA 3WLWD 1G1CA 3ARDB 3CPLB 4U1JA 2VLRA 4KJQD 1BVOA 2A6DA 1KTJA 1NOAA 2OYKA 5HI5C 3BKJH 3O6FC 2L0DA 3ARFD 1XGQA 1QMUA 2KZBA 1T1YB 3UAFA 3NQKA 4E2OA 4F8TA 4FEIA 4HWEL 4E41B 2Y36H 3CQFA 3IRCA 1MVFA 1WS8A 1OAYL 5CSBA 2AXWA 4BK5C 4NQXB 4OZGE 4PHZA 1KG0A 4PS3A 4X5WB 4Y16A 4N2DA 5DZOA 2NXZB 4FLOA 4HW6A 5KAQF 4K3DH 3C6SA 2QV4A 1H19A 1OPGL 3UBXI 3FT1A 1D5IH 5DHVH 1MWAB 3QUZB 1G5GA 4JKNA 4WI4A 3MV7D 2R8SH 1XGRB 5JW3L 4P49A 1O7DE 2YFNA 3BP5B 3DJSA 4GKNA 1CFVH 2Z1PA 3MRDB 1T66C 4KO5A 3T5WA 2J2ZB 5I1GH 2W94A 2N1KA 1CLVA 1D6VL 2JLPA 4R97C 3OAWA 2FHFA 4WV1A 5F1IB 3WKPA 4EI5B 4UQ2A 5C71A 4FYSA 5TQ2L 1FO0B 4R26L 2WXNA 1Q9OA 1NFDB 4P05A 3MLVH 5MERB 3VJ6B 4KITB 4OGAD 1YC7A 1IC1A 3EIFA 3QEQA 3AADB 3O45B 2WMPA 4S0SD 5D2LA 5EZLA 2EDKA 1RSFA 3BAEH 1WAAE 2JKNA 4WI9A 2F1BA 3ZYIA 3RIKA 3NJLA 3IGAA 5LCVH 7CGTA 3S37X 4CGTA 4E5XA 4X9YA 4XOEA 2OTUB 3A3YB 4GQPH 3U0WL 5IHZB 2J44A 5F8QC 4HA1A 1SVBA 1P7QA 3S0PA 2FBOJ 4AW4A 3B2XA 3EJTA 1TNMA 4L8SA 3GMQA 3WY1A 2LU3A 3A4FA 1WZ1H 1N64L 2EE6A 3PGCB 4M3KB 5C07E 3CZLA 2AV1A 3NCXA 1RIUH 1AZBA 3FRPB 2EYRA 3KPSD 4P07A 1YQVL 4MFHA 4WK2B 1W2KT 3C5XA 2YPKB 4ZQTA 3EDDA 3IFLH 2YPLB 1KEGL 3RFZC 2Q7YB 3MJ9L 5FKAB 4AYSA 3CMOH 3MMEA 2ATKB 2XQYK 1SYSA 4QF1B 4NPYA 5EO1A 2PTVA 2BHFA 2F9BT 2OZ4L 5IHUL 4Q6IB 1JGIA 1ZXKA 2FYYA 3IKCB 1XF3B 4J3TA 1FLRH 3V2AR 2X1QA 3ULUH 4HWUA 1N0LA 3DRTB 2YIHA 4IBZA 1NLBL 3NSFA 4BKSC 3VW3H 3CFCH 3RZCD 4R5TA 1TZAA 2A9NL 3MROB 4ODUB 1FH5H 1QQDB 1T7ZA 2KBGA 4GB9A 1X7TA 2Y7QB 3ESVF 4KQ3H 3DLQR 4MAYD 2HX7A 2ESVA 3NQIA 4P2RD 3V4PB 2DM2A 5E9DE 1XL6A 4XB3A 5C09D 3CH1B 1T04A 4WI8A 1BQLH 4JJ5A 3T77B 3GXPA 2ZOLB 3KEDA 2QHLA 1J8HB 1KCSH 4GSQA 3G08A 2QZQA 4YSSA 1TVBB 1ND0B 3RKDC 1IGCH 2J6EL 3P73B 1D7FA 4QHMB 5IBLD 2XPYA 1EDYA 4H2CA 4HIEA 3BXNB 1H5BC 5JHDE 3SE4A 1N2RB 5FAAA 3LS4L 3KD4A 4DK6A 3GMLA 4RH4A 5B7FA 3DVGB 4FYQA 4F33B 3PABB 4XCYA 1EXHA 5J1SC 1SOKA 4ESKA 1KWKA 1ODAA 1DQQA 1B9KA 3E9TA 3VFGH 3V8OA 1E4KA 3GI9L 2X4RB 3KG5A 2OMXB 2FQDA 3CHPA 4IKJA 4WY7H 5EU5A 3VFVA 4UM9D 1MDTA 4RWYL 4JFTA 1JMXA 2YJLA 2ICEA 2OMWA 4ORGB 3VRIB 4FFWD 5IB3A 4KHXH 1B2WH 2OSLA 3ZDYE 4KOBA 1C12B 2FJHA 1QLEL 2YS4A 4XNMA 1JZ2A 3TEWA 1FFOA 4R6UA 4FQ1L 3V0FA 5GS0C 4P4RA 1R3KB 2Z8VC 4KKLC 4FCAA 4NBZB 3RZCC 1FVCB 2IDFA 2O72A 5IMKB 5CN1A 2ED8A 3GMRA 3Q48A 2RCSH 2XWXA 3TURA 2KC0A 3DKHA 1JZ8A 5SX4H 4MA7L 3DV4B 5D7KE 4G7YL 4J28A 3H2PA 2YQ3A 2YGOA 3D2TA 2CDGA 4J12A 5DTFA 3IFOA 5C0AB 4HUXA 4XP9H 4FOMA 3QUYC 3EOTH 5B38B 2XWTB 4YHIA 3QR0A 5J6GB 5DGQA 2ID5A 3LQAC 4DN4L 15C8H 2KERA 3MV11 1DL7L 5IBLC 4A2LA 1GMIA 1QR1A 1OZTG 4ANUA 4M5ZH 3L9BA 4N0CC 4NC1C 4AI7A 4L0YA 4CU8A 2QFPA 3EJUA 4X99A 1E8ZA 4JKLA 4ZX3A 1NGYB 1L7TL 3P77A 1SFHA 3VXUA 1EXUA 3DMMB 5LNEA 2YOCA 1IGIL 2XXGA 2QZ5A 2BP8B 5INDB 1YN6B 1YZZA 3HUJB 5MEOA 3QNXA 1EUUA 4H88L 1PX8A 4JFXB 4ENEC 2VDRB 3FAWA 4BWTA 1HL9A 3UZQA 1NL0H 3VTAA 5FK9B 3RGVA 3WY4A 3QYMA 1NPUA 3GHEL 5IMMB 2ZXBA 5EC2B 2CKBB 2O5XL 4LSPL 2BNRA 4KDVA 3LEXB 3L1OL 2FJFB 1WCBA 4ES9A 1RVFH 4KI5E 3HS9A 2R69H 4WI7A 4MNQA 2VDRL 2VWEC 4HOMA 2MCAA 3QYCA 4UNIA 2XXFA 3IS1X 3Q2VA 4ZUSB 3TZVA 5CEYB 5MP6H 5IB1B 5E8NB 4OLZH 1XF4B 5K9KA 1W16A 5FW8A 1XIWC 2AXJA 2VABA 2Y07L 2VUKA 1YQ2A 2VTFA 4D9LH 5K93A 4K23L 4FGMA 4OCRH 2DBLL 2WZ0A 3C5ZC 4WEEA 4PD4J 5CZVL 5LVEA 3G5VA 2VLJE 2MH4A 2AJXH 5KYUA 4JQIH 3T0AA 5AQ0A 5T1JA 1TEYA 3M07A 2VISA 3SKUD 1N6QL 3LEVH 4AQ1C 4AG4L 2WZAA 1TLKA 3Q6FB 3I6KA 4H26B 3CFTA 3O41A 3WFEL 2CUMA 4LSRH 4NWUL 3PJLA 2WQXA 3CHOA 4JFEE 3CFKB 3SGDI 3QEUB 4HPHA 1OF2A 5EA0H 5K9JH 2JIXA 4I9WD 5J7CC 4NO5B 2CDEB 4RMTA 3ZGHA 3BYTA 4KAQL 2ZYHA 3PWLB 4LSVH 3DO3A 5SX5H 1EAQA 3WFCH 3HMWL 1MFAL 4ZMAT 4NHUB 1Z9PA 3GSWB 4N2NA 1PEZA 3HR5A 1DQLL 1XO8A 2IBZY 3R19A 4NAMA 7PCYA 3Q2CA 4JFWA 1GZHA 1XH3A 3GZOA 3TVMB 1U30A 4XXWA 1IC0A 2XTJC 3I9PA 3BUYB 4X42A 4UMSA 4H1LB 3VU1A 4ABVA 1BD2D 4C8XA 1UJ3C 4HCRH 1F1AA 4M5TA 4JB9H 1C08B 4YHKL 2HMIC 4N8VG 3CLEL 3PNRB 1T0OA 4M8QB 4X9HA 5I2IA 2LGNA 1AIFB 1P4LA 4JANB 5A6IA 5JLZB 4JE4B 2ZCHH 4ERSL 1HJCA 1YSOA 3ELAT 1E4XI 4XHQA 1A6WL 4KKCD 4AUUA 4FQPA 3KPLB 1A7RL 2ZXDA 1HKLH 4OF0A 3SIKA 1RJLB 3BH8A 1VFBB 3GHBL 4GY4A 4FQXB 3ARXA 3NZSA 4LP4A 1JVOA 3MRGB 4X50A 4Z7UB 5DLMH 4L1SA 3R06B 1LO5B 25C8L 4FLRA 3MRIB 3Q2WA 4Z7IA 1T4KB 2X4QA 4J3SA 4MJ6A 4OCMC 1SF5A 4FXGB 4XNUH 1WVZA 5LJYH 2W0FA 2WUCL 1I3GH 1ED3A 3UAEA 1A14L 3V4LA 1RSYA 4S1DD 1KJVB 3C8KA 4ZTOL 1WP6A 2DKSA 4FHJA 1QLRA 2ZD0A 1KJMB 1UJTA 3IDJA 4OCXH 2D7OA 1ZWIB 2WIIA 1J05B 1AGCB 4KY1L 3TN0B 1FNLA 2YUZA 2XFXB 4GI9A 1S7VA 1SYVA 1MCOL 3U1SH 4QKTA 1P84K 3QEHB 4XN9A 1TQTA 8FABA 5BZWB 4I18B 4KKCC 3ASOB 2OL3A 5JXAH 3L1GA 1WGVA 2NNAA 3UIYA 2ETWA 3K0YA 3N5AA 3QDGD 4M1DL 4MAZA 2XA8L 5KVEL 2ZOKA 1PZSA 5HHNA 3X14B 2IDTA 1N10A 4U6VH 1ORSA 2O1AA 3ZHDA 7FABH 1O7VA 3DWTA 3V4VL 4OLWL 1BMGA 1Z5LA 3KYNA 4WUUE 4AYDC 5KS9A 1XR9B 2COQA 5HJ3B 1T1XA 4HV8B 4X9IA 5FYKL 1H6TA 2BC4B 1NLDL 3BPCA 1CZ8L 5DWUL 4ZS6C 5FYKU 3N42B 4B9GA 4KK6C 4UTAH 2Q0ZX 1B0GB 3HE7A 2CLRB 3D5OF 3WKQA 4JLRB 4RGNC 3QJFB 2CGYA 3O6FB 4XCNA 5HHXH 1KJ3L 2PWDA 1R3JB 3MCKA 4GRLB 5HHMD 1DVYA 3KLQA 1U4FA 3WFHA 1OXYA 2Y1ZA 1F97A 3QZWB 1FZOA 4KRPD 2BH0A 43CAB 5DVOA 5TDNB 3S96A 2AJ3B 5E1AA 3CGTA 1FVEA 4C58B 1BLNB 3HRPA 1DVFD 3H9YA 1ACXA 5ECGA 1PS3A 3W39A 1DBMH 1D9KD 2CLVB 4L2YA 3VI4F 4Y1AA 3PWPD 3T4YB 2JKRM 3HI1B 3A6BL 3GMNB 4PI2A 5C2BL 4WI6A 5E9NA 3WN5C 2GEQA 3WNNA 5LHDA 5KJ7E 1MSPA 4QRQB 3NCMA 4F3FA 4NM8H 1Z2KA 4GP4B 4H5SB 3OMAB 2K1MA 3KPRE 5CUSH 4R97B 3GBDA 3HG3A 4XVUD 4LRIC 2AEPL 3P9MB 3PRZA 5GGRB 2JWYA 1DBKL 4JQVA 1IFRA 1H3PL 5CP7B 4J3OH 1A6VH 1U8MA 3HI5H 1M7XA 5L9DH 4OQTL 3GQFA 4OCSH 5HXMA 4XN7A 3US9A 1YYML 4Y5YB 5KJ4A 5J12C 1OANA 2DIEA 3GK8L 1ZA6B 2FZ3B 4MD5A 4DIXA 4XMPL 1ZTXH 2EDRA 4XPGL 4JZJA 1T20A 4WAFA 2R2CA 1FL6A 3OKYA 2GQHA 3QA3A 5DVKA 1K6QH 2J6WA 2ZONA 1JWMB 3L3OA 3UL4A 1X9UA 4FC3E 4G80B 5I26A 3CC1A 2Y22A 2YA1A 4WU7B 2X4TB 4ODTL 3LNGA 4UF7C 4FA7B 3QYNA 1HH9B 4F2MB 1BBDH 4WGKA 5ECJE 4HX1B 3PHAA 3S6CA 3U6XS 4HEPG 1HTYA 4LVHB 2FATL 4I0CC 1AQKH 2TRYA 5I82A 2NQ3A 3ME0B 3ESOA 4NFCA 4QRPB 4K7PX 3BAKA 2IAMD 5F6IC 2B4CC 5JPNC 4O5LL 1UB5A 2XV0A 4UIKL 1XH1A 3KXFD 4F7EB 2VOTA 4XVJL 4UT9H 4K3JH 5IESH 2K0RA 2W9EH 2LE9A 4YBHA 3MJ9A 1OP3H 3ALPA 1AGEA 2DV6A 1BF8A 2YAHA 3D0VB 2ICWA 5BRZD 5I76B 5A2CA 1IFGA 1BVLB 3P02A 2OZ4A 4QNPE 1NCUA 5I1HH 3DGDA 2F5BL 4PJ8B 4RMBA 5CKAA 2V2XA 3AU1A 1IKFH 4P2OC 3RURA 4X5RA 3V7AE 3V79C 5F9JB 1VFOA 1BYNA 3ZTDC 4JZOA 2QKIA 3POHA 5AG8A 2F8IA 2HTLC 1CR9H 3DI3B 3K1DA 5CGYC 4TQHA 1MHPL 3BJLA 1H5BB 3SE9L 3WTTA 3I75A 5CINH 1YNKL 1E4XL 3AMKA 2XKNA 4ZPTA 5FM8A 3KDMB 3UC0L 1PNCA 4ELME 3ILDA 2J6EA 3WXWL 2YPVH 2K70A 3S36X 2R1WB 4ZW6A 5A3ID 4FABL 1KMGA 4NN7B 3QO0B 1ES0B 4JFDA 1OVZA 5D4HA 3SBWC 4XNZC 3Q8EA 1IAKA 5BJTA 3H9HA 1CXIA 2BNQE 4LL1A 4TN9A 3K2MC 3FSZA 5DRXA 5FLUA 3WG7B 2DI9A 3F6LA 4NQCE 3FTZA 4U1NA 5CEZD 1OB1A 5ESQB 4LKXA 3L9RA 2XXMB 1UZ8A 3L81A 2JKXA 3QUML 5AUMA 3P30L 4OV6F 2P47B 4LDCA 4G11A 3S4SG 3IMTA 3LPPA 1BZ7B 4JS7A 4DAGL 5IEHA 5EBWB 3ARED 4JPVH 5C9JB 4MNGB 2EINB 3PQYE 5FHAH 2JLLA 4JDTH 2Y06L 3KZ8A 3IBEA 2I5YH 3ISWA 4ZAKC 4PJGB 1ZSDA 5DJXA 1YDPB 1UOWA 5B7EA 4MWFB 4G8IA 5HY9B 3X1EA 3LV3B 1T5XB 3FFCB 3SBRA 1AHWC 5GQBA 2HVBA 1TTGA 3JWNC 1VKXB 1E4WL 5CIPA 1J87A 1HDMB 2XBDA 4MDRA 4NIKB 1AMYA 4R90H 4TSAL 4GFTB 5T33L 4OI7A 1OQOA 4AQEB 1Q94B 1IBGH 1SHSA 4Y4KD 2OMTB 3VA6A 3CVHB 1BYPA 3QC5X 3BESR 4GRWF 4OZHE 1MCJA 3FO0L 4ETYA 3N44B 2OJZL 4UZUA 3C09B 5AYUH 3AWGA 4X6DE 4ZSOA 4HDIB 5AVYB 2PPEA 3BN9D 1G0XA 1U8JB 3QHZL 5G5DA 1GYUA 4JRYE 3RX8A 5CD3B 3JWDL 3U1PA 3DJ9A 5T3ZL 3BUIA 4KZDL 4BQBA 1KTDB 5KVGH 2NX5D 2EUWA 4ZQKB 2NY5H 3U9UB 1ZV9A 3DX7B 4EI6B 1HEHC 5C6PB 3QO1B 5FR3A 3MPCA 3RWCA 1QUNB 1XIWB 2CHXA 1PYWB 4AYFB 1C5DA 1WIUA 4G7VH 4G8GE 3THMH 4NNYA 1S9XB 5EEZA 1HXMA 1WK0A 3C5ZB 1F90H 4UDTB 3WHE0 5I1CL 1DJHA 5IVXE 1E30A 4IMLA 5DO8A 2G2PA 1BPLB 4N2FA 2O5ZH 4ZDHA 3IJYA 4BKLA 1HE8A 2QKSA 4FLHA 4R9HA 2PW1A 3DX6A 3NEEA 4G3YH 3SQOL 2JK5B 3FCGA 5I8CB 3L4UA 4OLVL 2O6FA 3QQ4B 1M9WA 2EYTB 4PGJA 1IC4H 3UBXA 3LZLA 3N50A 2E4TA 2DQHH 3QQ3B 5KJRL 2ADYA 4LLMA 2C9QA 1G9NC 2GIYA 4LCWD 3ASNB 4MA8H 1JXGA 1HILA 2CIIB 1T21A 2BWIA 1OARH 4NQED 4JM4L 1L6PA 4HJIA 1ZVNA 2X7LB 4K15A 2E8ZA 1NKRA 1NAKH 4J39A 2WQSA 3KE0A 5LWYL 2B9AA 1QVOA 4PJHE 4AEFA 3L3IA 1JERA 5BZZA 4DP7X 3L3JB 1GYVA 3II1A 5T3XH 1B6UA 1X7SA 2OMYB 4UI2A 3V0EA 1HXKA 4DK5A 3RY4A 2XTJB 1BEYH 4PJEE 3KPQA 2DYPB 3WSQH 4F7MA 4UQAA 1A6AA 4DHLA 2NY2C 1MCQA 4NXSA 2FQFA 3AGVA 1UJ3B 3FB6B 4DKEH 1S78D 1GJIA 5K9OB 1DBBL 1MDAA 3U2IA 3O2WH 3RWEB 1OTUC 2AK4D 5J06A 1AZCA 3JYBA 3RJQB 5IREA 4J3OG 2F7PA 1KCVH 3B9KC 4Y5VA 5DVNA 3SBPA 2OM5A 1ECYA 3ZOAA 3OMNB 4E9LA 1NEZB 3HBQA 1BQHG 2C7UA 5FUCE 2XWJB 2WAQA 2PYEA 4ZI8A 3NJXA 5MENB 1LEGA 1Z6JT 3LMJL 2CK0L 2JJSC 4WW2A 2B3RA 2B2XL 1XZ0B 2H26B 2VR8A 3QIWA 2G5BA 2CBTA 3U79A 1JZHA 2HWZH 4UOJA 5C0GB 3CVIH 2AAAA 4G9FB 4NKQB 5DU7A 5JORA 4IHOB 2LOEA 4GPVA 5CFAA 3M1BA 3TT3L 4RSVA 3INOA 1I1AC 1JUFA 3DXAE 1HWHB 2AXHA 1NWPA 1KCUL 1ZV2A 2H45A 2JJVA 3D06A 1G1OA 4AZ8B 3D52A 1JTPA 4NUJA 3TWCH 1QSEB 3LHPL 3UTSA 1ADQH 3BSGA 5IR1A 3TA4D 2LTQB 4J8RB 3D48R 4G8EB 4DEPC 2CO4A 1NAMH 4LLUA 4K7FB 2CO3A 3R0NA 1SJEB 4NQVB 4BFEA 3FO1B 5HYSG 3WLBA 2G4EA 3H3KA 5A6MA 1CDGA 1DR9A 1NC2D 5I1DB 1AO7A 2JJUA 1VEMA 2J8UF 1XR8A 1WZAA 3QUXD 2B08A 4P5TD 4L2LA 4BRJA 2P80D 2B16A 5ISZE 2NDFA 2VT0A 3S8GB 1BJ1J 2I9LB 3HC0B 1IM9A 4NENB 4PJ5A 3CSPA 1K85A 3KYKH 3APDA 1I7TA 4MCYA 2AJUL 3QPXL 2MHAA 2ENPA 4KJPC 4APQA 2GSGB 2Z4QA 3MACH 3V8CA 1QSVA 1M6OA 4ALAC 2BP0A 4LOEA 3SPVB 1MCSA 3L9YA 3QWNA 3APNA 3LTVA 1MCWM 1JP5A 4OIAA 4MVBC 4XNQA 2YEQA 5DQJB 3CCHB 4IS6B 5JNYB 5EC1A 3BFOA 2J5WA 1HNFA 4H4NA 5D93B 2QSQA 2ZSVA 5DRZA 4Z76A 5I73C 2XC8A 1OAUH 4BHUI 1T03H 3KLLA 2DB8A 4Y5XC 4PVBA 5HYJE 3HCVA 3V4VA 3ZU8A 5I1EL 2OFQA 4RGNB 4UQIM 2VDNB 2WC7A 4HWBL 1AE6L 1R0AH 1OV8A 1FGNL 4AM0Q 3RYMA 5J89A 2W88A 4PGZA 4OZIB 1WJ3A 4HP5A 4K3EH 2DMHA 1UD2A 4PRIE 4U7MA 3S34H 3ZE1F 4EIZC 1T0MA 3UROR 3VXTA 1P9MA 3MOAH 5DDHA 3OHXA 1FF5A 1F1GA 1SM3L 3SKMA 3T2PA 3QUXC 1GGYA 4HKXA 3FQNA 4E41E 3O6ML 1HHKB 1KPRB 1KWGA 2P5EA 2V6HA 4YE4H 2R0KH 2V5MA 3WN5B 4HSQA 4WJ5A 2XWRA 4FNUA 4L1TA 1GZPA 3RWDB 5EFIB 5LBSL 3SD2A 2B0SL 4U6YA 2UXVA 3OR6B 1LD9B 1U33A 2ED9A 4JY4A 4FJYA 32C2A 2ZCKL 5ITFA 4APXB 4BDVA 1C16A 4S0TD 1EZUA 1UA6H 4UYQA 5D1XB 1WUNT 2ZAHA 1BXXA 4JY5H 1X7QB 3QG7H 1URIA 3VFPB 1T83C 2IANB 4X80L 3ESUF 5EU3A 1QSFD 1M71B 2EIEA 2PXYD 4PR5A 1UA3A 4HXBL 5E8DH 5ACZA 1ZJBA 4WI2A 3NABH 5JIMA 4WWNA 1U21A 4OQTA 3T6XA 3L4XA 4K9EL 4PV9B 3U2SB 5IMLB 1M1XB 1MN4A 6FABH 5T1KB 4PM1A 4KDTC 1LVEA 4HC1H 1NFDE 1OEZW 1R5WA 1BG1A 3ABGA 2BY1A 1RUPH 1XHHA 4LU5H 5F93C 4OZGA 2ZWKA 5DJZB 2NR6C 3KL0A 3MRCB 1PG7W 2L3BA 3CDZA 4U3SA 4XP4H 5BNXD 3KPTA 2R0LH 2GCYA 4WWPA 4QOKB 5D7LB 4YIQB 3K2IA 4N2OA 2Y36L 1KXVA 5DHXB 2KDYA 1QRNB 5DHVB 12E8L 1ET7A 1MELA 3IMVA 5KSAB 5I6XB 3O8XA 4HUWB 4CU6A 3UJTH 2YQBA 2BVYA 4IGBA 1TCMA 3LRGA 5C0CD 3ECUA 4ORZC 1I8KA 1V3MA 5T1LB 3WUWG 2L4OA 5H4YA 5KG9A 4JN1L 5DJCB 4D9RE 3T09A 2OSXA 2A77L 3DARA 1H6FA 4N8VB 3IDMA 5CLXA 2YPLE 3ILQD 3FCTB 1CL7H 5D71H 1SDDA 2X4NB 2FJGB 4BZ1L 4J3OC 2JKTM 3DIFB 1QTSA 3SCMD 1HI6A 1CE6B 4P2OB 1MREH 3ARGB 3RL1B 3IXTA 2VYRE 3A6CH 4RZCA 5C0BA 2AXGB 2Y1YA 3ZKMD 3U46A 4DW2L 3T4AA 5JIKA 2F2HA 5J11B 5D2NE 1HEJC 3NSYA 3BEVB 3MLVL 4NZFA 2Q76B 1QRKA 3QFJE 3QCUH 1TF4A 3L6FA 1NJ9A 4M1CC 4TUJA 1TZ8A 1JN6A 4FP8L 1I82A 4KTDL 2FLRT 5HHQB 2J8UB 1J0ZA 4FTVB 3BT0A 4WWKD 2ZOUA 4OZFH 3WJLA 1JXDA 5M95B 2ITEA 5C07A 1J8HE 2NY0D 4K8RL 1KZYA 3PP3K 3QORA 2XZAH 2EP6A 4BZ2L 5LXVA 1XAKA 3BVNA 3LPWA 3OKKB 4OU3A 4LIQL 2WD0A 4JMXA 2OMZA 1BX2A 1N5AB 2VL4A 3HOGA 4HIXH 2PO6A 4GUPB 1R3LA 2AJVL 4GXUM 1KTCA 4Y0GA 4Z8FL 1QFUH 2FX7H 4F7TB 3K6DA 3MXVH 1BXAA 2PKDA 5DD1H 4TTDC 1I7ZA 1OWWA 4I89A 2VAAA 1BJ1H 3LRLA 4WFGE 1UKQA 5J3HC 2EEBA 3VFSA 2GJ6A 1MG2C 1BIIA 1ZT1A 2P42B 4WUUA 2UUDH 4ZAKB 1CFQA 1OTSD 3E0GA 1LK2B 3QUMA 5E9DA 2ZTBA 1FFPA 3FPXA 3GI8H 1C1EH 1I31A 1GW0A 2HSIA 1FLRL 3ZKMC 4UCFA 1IGJB 1KN4L 3VW3L 4GW1B 4H20H 1TJHH 4FNTA 1FH5L 1T0NB 4P5KA 4D0CA 3HZYA 2J56A 3KNBA 4KQ3L 4XXCC 3PGDB 4MA3B 1HZLA 3BAWA 1RHFA 2R2HB 4YDNA 3RAJH 2CWRA 1SJHA 2EADA 4D9QE 4TQIA 4KVCL 2VW7A 5JW4R 1CFTB 1JPFA 1HEZA 2X4OA 3MRRA 4WHDA 4WO4C 5C0AE 3D08A 3MUGB 5CR1A 3AG4B 4OLUL 4N1CA 1IGCL 3QH3A 4ZFOB 4DOHB 2CM5A 1Y18A 4U1KA 2HJLA 5BZDB 1JVLA 1IKNA 3PL6A 4ZOBA 3ULSB 2E76C 5IVZB 4KJWD 1XEUA 2XTSA 4GMSL 3GEFA 3MNZB 2F54E 2LR4A 3VE0A 4PTUB 3VFNB 4FERA 4YVUA 2XG4B 3O4LA 2EILB 3HUJE 4N8UA 4CADB 2CCWA 1NDMB 3V0AC 4PGEB 4X4YB 1I9IH 1CGSH 2MKWA 4G43A 5EULV 4OJCA 1RULH 4WEUD 1KF9B 4PVMA 1IM3D 1J1OL 1XWVA 3KR3H 4FG6D 1KYAA 3OC8A 1CF8H 1B2WL 4XNYH 3ILPB 1G7IB 4MKMA 2YK1H 4QLWA 1GY1A 2J3SA 2O61A 1IC5L 4AT6A 4R2GD 5HHOB 1AQHA 2BIMA 5BRPA 4NERA 5I19H 2VIRA 1G7QA 3QDJD 4LPTA 3T0EE 3WTYA 1U8CB 2I32A 2UZYA 2RCSL 2GTQA 3RIFF 3FT3B 4IRJD 2QGEA 1UD5A 2NXYC 3BT2H 1MRFH 3FUMA 3V6FB 1DSFH 2XKSA 4ZO7A 4P3DB 3ZQ9A 5DUBA 5D8JH 5E8PA 1CDIA 4I0PD 4Y9EA 15C8L 3A4EA 4MMZC 2NCEA 5E6RB 1K8IB 3BH9A 1E67A 2VLKA 4WI0B 2WWNA 7PAZA 2QPFA 3C6LA 1IT9H 4FJ6A 1AZZC 1G4RA 2BVEA 1RP9A 2XIDA 4JPIB 1BREA 3DI2B 5DFVC 1NDGB 3NCBB 5E4EC 4AUJA 5E08H 1IAOB 4QXUH 4FYTA 3TEUA 5J6SA 4P4KD 1D2PA 1MHEA 1WFMA 4ZXBB 1HQRB 5IFAL 4DZBA 4NUPA 5GHWH 3RHWF 4N2HA 4NC2B 1SLXA 1HIML 4PY7B 3IPEA 1RVFL 2R69L 4N2IA 5CLTA 1BZ9A 4HUUA 3PJSB 1A7NL 3ZHNA 4LP8A 3B9KB 5MP6L 1GYWA 4OLZL 3D3VB 1KC5H 4K3HA 4L4TA 2ITDA 3D34A 5F0PB 5I15H 3X3FL 1UYWH 2AQRA 4GG8B 5T5NG 3EO9H 3KL5A 1G7JA 3A47A 4IRJC 4D9LL 1P7QD 3HNSL 4OCRL 4QTFA 3M7OA 4PJXB 1GOHA 4XZUB 3FDWA 2ZKYA 4X6EA 4CJ0A 3GINA 3T3PF 1FI8C 1LK3L 4P2QA 4I0PC 3FZUC 2AJXL 1RZPA 4JQIL 4K0OA 4XE0A 3B3IB 4POZC 3LAFA 5BS0E 3OKOA 3L5WB 4NO2A 3BIAX 4QRTA 3GKZA 2ZP8A 1I1AB 4XMZA 1SXSA 4J3OF 2Q8AH 4Z7UE 3SPCA 1H3GA 2NW2A 1PVHA 2OMUA 4LHJB 3VI3F 4LSRL 1GOGA 4XPFL 1XCXA 1I1CA 4P4KC 4DEPB 3SKNA 2GITB 2UWEB 5K9JL 1SHXA 2F68X 3A22A 4WSKA 4JRXD 1PQZA 5IM7A 1FE8L 1J9CT 2ESVD 5AVQB 4QRRD 2RACA 1IE4A 1PZBA 3FS9A 2I60L 1HXYA 1Z9SB 1B0IA 3MZTA 3NCJH 4GKLA 4NN5B 4NO0B 3C9NB 4XX1E 5BQ7A 4FS0A 4TSCH 1OLLA 5IW1A 3QRFM 3KLAB 4GRMA 3GSUB 1GAFH 3ZE2F 3S4SB 3GSOB 4IJTA 4WTZG 5KTEH 4HCRL 1EZVX 4JZNB 4Z0XA 1U8IA 3VD9A 4FNQA 5KANG 5LG1A 4PBXA 5AD0B 5TDOA 3BUPA 1KXQE 5B8CA 2ZCHL 1DJSA 4G6AD 4F7CB 4XMXA 3ROOA 3NMEA 1HKLL 4GS7C 3VD7A 5I73B 4GG6A 3JTTB 2J25A 4OZFG 2YOAA 4GO9A 2R4SH 4OGXH 2Z35A 4H0LC 4NAQA 5ICXA 1JYXA 1TFHA 3U7WL 3RWHB 5HI4C 4HEME 1RKRA 3SPJA 5D96C 2OK0H 3CFIC 2YKLH 3IGFA 2BSED 4HWBA 3O3UN 3B7SA 3EYUL 3SDAA 1I3GL 2H2PD 4Y4FB 5AB2A 1AYOA 1XSJA 5HYEA 4PB9H 1U9KA 2RR3A 3F7YB 3V6OE 1CXHA 1LDSA 4MBOA 2E7BA 2XUWA 4MJ5A 3UZEC 1ZJAA 4Z7WF 4MX7B 5CP3H 4AWJC 4G9DB 1L5GB 3D51A 3ZMEA 1ZIBA 3KPMA 5ID0B 3SQBB 2VDOH 2HVJA 1M42A 3QDMA 3UG3A 5KN5B 3KLHC 3UYPA 3CX5K 5EF1A 3PV6B 6CGTA 3MFFA 2HN7B 2JQZA 5GRUH 5AAMA 3KYMB 1ZANH 2X89A 4CW1A 4GBXC 5DZLA 3DURB 3AAZB 1OB0A 2P8MB 4NX0A 1KB9K 3MREA 3V0HA 3VGEA 3VXUD 3SE3A 1WBYA 4KXBA 1KULA 2LVCA 1MVYA 5LBSA 4X4XB 1SXZA 3P3UA 3W0WD 5JXAL 1TYEB 4GI6A 4H40A 4QPEA 3FQWB 3O9WB 4XPBH 3RVUD 4N0YH 4R96A 1X5JA 3GZPA 2EXSA 1TVHB 2YBRA 2AKRB 1GHFH 3C5JA 3CDGB 3WL9A 2BOCA 5C0ND 2J1WA 3MJWA 5L8JB 7FABL 4YO0B 2BNRD 1ZHBA 2JCCA 4NBYB 2ENQA 1T0PB 2PETA 2J73A 1DN0A 4X5XB 1MI5B 2XHNA 4HAFA 4JJOA 5TF1H 3AUWB 4MNQD 3MC0A 2KQMA 3NZHH 3U9WA 4BJLA 4RBPK 5D6DC 2BSRB 4YXLL 2QSTA 3GSVB 1K4DB 5B4MD 2HFEB 2MIZA 3P69A 2IH1A 3ASWA 4X7FC 4J8QA 2E8YA 2Z7ZA 4XC3L 1ASQA 3D69B 5CJQL 1KYUA 1OSZA 3NCFB 2X53A 4LASL 1SXNA 2CDFB 3WHXA 2Y72A 4UMGA 3FQXA 4AH2A 1DUZB 4OIIH 4R7NA 1RXLA 1IMHC 2Y25A 2GUOB 3LKQA 4F2ME 1IBHA 4Y4HA 1EEQA 3I3EA 4HKBB 2IPKA 4U1SA 3K72A 3N41F 4UU9B 1MUJA 4EOWH 1ZHNA 1DBML 1AXSA 4BKTC 4QRPE 3MJ6A 1CLZL 2FX8H 3D85B 4B9YA 3VD2A 2XQYA 1SVCP 4C57C 2J4WL 4Q9BA 3RVUC 2OX5A 2YD7A 4DO6A 1JYWA 4M7ZB 5CNHA 2GI7A 3IMSA 3VI3B 2GBUA 2JIXD 3O6LH 4M6MH 1MJJA 1RHHA 3FU8A 4XCEA 3WN6A 5T1DH 4DJMA 4JRWA 1W0VA 1OGTA 3TNMA 2Z31D 1NUGA 5CUSL 1BQHB 4D8PA 2COVD 4PLJC 3SDXF 3CXFA 4BZ1A 3TTSA 1TU2A 3MV8A 4IOSA 1NBYB 1U8NA 4OM0H 2E7LC 3ULVL 5BCAA 4WSGA 1WDAA 2VXSH 1XZWA 5DMIL 3D2UA 2VKXA 5B4MC 5HD8D 3VB9A 4OCSL 3X1BA 2F58L 2G0LA 3MRBA 4UQDA 1G9MH 2YD1A 3T8XA 5IROD 4NDMB 1F6FB 4FLQA 2HKFH 1QBBA 4I8DA 5DJDB 2EIBA 2Z93A 3LQMA 3ZE2B 4P46C 1K6QL 4JGJA 3GF8A 4U1LB 3ZIYA 2R7EA 2BXZA 3LPGA 4TL4A 1O75A 3LKOA 5I6LA 1A1OB 5ENWB 2CPUA 4MCZA 5AAPA 2DQGH 3D39B 2VN3A 3O11B 3N85H 4Q0XH 3UJIH 4BZ2A 1QYGH 2X41A 3IJSA 1FNGB 4LHUD 4MS8C 4XMVA 3TNNA 5AZEH 1N59B 2GT9A 1KN2H 4HD9A 1NC4D 3F85A 2CGZA 2IGFH 1KLFA 2BHYA 4N6QA 2LLLA 2NCMA 2QFRA 3MLYL 5ICUA 4FD0A 4ZMVA 4AV4A 4TQPA 3Q3GB 4JAMB 4PRBB 3ZHKA 5ADPH 1X5MA 4XAKE 3APMA 4YSPA 2HJFA 4PB0L 1XCQA 3VXOA 2Z31C 3MNWB 3AABA 1AY1H 5CEXA 3BI9X 4PJAF 4KTGA 4BQCA 4LKCA 2D31B 1CTOA 1OP5K 4ABUA 4I13B 1JGLH 4MJIA 2UXTA 1BVKA 1BQKA 4MNGE 4XI5C 5HJDA 1M05B 1Y1DA 4S2SA 1P53A 1II4E 4LPCA 5I1HL 5FB8B 3MBED 1T5KA 5JW4N 4FMVA 3DO4A 2FECI 4LSQH 1OK8A 3IWUA 5EO0B 1TLMA 2BO0A 2XZQL 4G8FB 5B1AB 3DOHA 4NNPH 1FHNA 1LO4H 5EU7C 2DF3A 3AU0A 4IJ3B 5B1JA 3RU8L 1TETH 3EO1B 4NQDB 4O4YH 3MNMA 3FFCE 2JELH 5CR8A 2E0PA 2WPGA 4PJBF 5BVPL 2P28B 2P4AB 4JPKL 1OAXH 4EN3A 3OAUH 2BNQA 4ATWA 1L9OA 3KW8A 4TMPA 3RWIA 5C97A 5D7JA 4HJJL 4AVHA 2CD0A 5D5MB 3VQ2C 2J8HA 4U1HB 4OLXH 1ORQB 5DMKB 4LEEA 3BAYA 2QMJA 2W07A 5IJVA 3INUL 3L3HA 1OCRB 3GSQA 4GQQA 5EH1A 2WLLB 4X4ME 4C55A 5IOKA 1R46A 4O2FA 5FYLE 3ZR6A 2J1XA 2K3TA 3PWNB 3ZHLA 5LN8A 5LAXA 2WXHA 3EHBC 3BRFA 1M7DA 5HP5A 3T3MF 2VDLH 2QGBA 1DQML 3HE7D 4Z7QF 2FWOB 1HCVA 2VWEE 4ODVH 3VXQA 3ZO9A 5I1AB 5IF0A 4PJFF 2QSCH 5DD5L 3SDDC 5I71B 3FHEA 4JPVL 1GH7A 1PZAA 1U95A 1AACA 3J8F7 3P4LA 1J0JA 3B83A 2QLYA 1JAEA 2NW3B 3NJFA 5ICZA 2WXLA 2QADC 3GXUB 2NXYB 4JQXC 2X4SA 2HKHH 1WEJH 5I0WA 4LOUD 3UBGA 1HX0A 5CJ5A 3BZEA 2F61A 4JDZB 4Q2ZA 4AEHL 1OQXA 5EN2A 1FZJA 4X7EC 3OXSB 1IQDB 1NCOA 3NIGF 5GSVA 5CLZA 4R90L 4Y1AD 2NY7H 1L6ZA 1WZMA 4JKWA 1GSMA 2ADGB 3N41B 5C8JA 1A3QA 1W0WB 5D1ZD 2WJ7A 1TYRA 1S7TA 4XMKH 3X12B 5C0DA 5F1SA 2EE2A 1R17A 4PY8J 3D18A 3VH8A 1QNIA 4HS3A 2LU4A 4PJ7B 2B1HH 4ZMYA 1DEEA 4YHNA 1T7YA 1HT6A 1KELH 3KH4A 5ADOH 3TFKC 5FO9A 1I7UB 4G8GA 5AWNH 1UZ6F 1HE7A 5IGXH 1DJIA 4XT1C 1MFEL 5J8OA 1KB5H 4CA4A 5DMGC 4YBQD 5KVGL 5E5MA 1KYFA 3GKWH 3WUWB 5A16A 2XTJE 4ZMNA 4JDVB 1MW0A 1U4EA 3GXTA 4PJIF 4U1IA 5AB1A 1XH2A 1WIPA 2R69A 3VD4A 3RB7A 3THML 4TVPL 5AAWC 1KZQA 4JFFB 1CB4A 1S7SA 4KJYB 1F90L 3ZZSA 3UH8A 1I1FB 3RVXC 2IFGA 2YD8A 3BSZH 3A67H 1TZHA 4NT6A 4PG2A 5B3NA 4GH7B 1TCRA 2WZPD 2C1PB 5TDPA 4WWOA 5FO2A 1S46A 2WK2A 4Z7VF 2YD4A 1CK0H 1F02I 1LLAA 3EO0A 5K1NA 5MENE 4KZEH 3ECQA 2FSEB 3UZVB 2DQHL 2ARJQ 2FO1A 4PJHA 1KLUA 4GFXA 3MLSH 4K7PL 3GNMH 3L95B 4Q58C 4RDQG 4EIGB 4XH2B 5FV1L 5T5NF 2XRAL 4HS8L 1VADA 5D7IA 5DEFB 3KYOB 5C08A 3MLZH 4AIOA 4G9FE 2IF7A 1SNRA 4B7IA 3G5WA 4NQSB 3SGKA 5CGTA 1L9MA 1H8NA 2XX0A 3EG9A 4ZO8A 3DYPA 1NAKL 3APFA 1HSAB 5KYYB 4XBEL 3MN8A 1HHJA 1PZ5A 2NY3D 1RUKL 1GYAA 4W70A 1VGEL 4OJYA 1AKJD 1CL7I 4RMUA 1S9WB 1QSEE 2O5YH 1QEWA 3PP4H 4IU2A 1BEYL 2AERT 2NUPA 3W57A 4N8PA 2K3HA 3Q44A 5ANMA 2A9MH 3MV9D 5TH2A 3L3GB 3IETB 1LE5A 2BPBA 1FVDA 2K6ZA 4KMTH 5FYJE 4XX5A 3TT1H 5DZVA 2FEEI 1KIUB 4G7QB 1DBJH 4E0RA 1KCVL 4B9PA 2I07B 4LE8A 1JD9A 1VFAB 1W9XA 4HCRA 1XBDA 4WFFE 4LLWA 4RAUA 4YGVA 4NI3A 4JFYB 1F18A 4HCIA 1A65A 3QXAA 5C0IA 1U8LB 5D9SA 3UGUA 3RVTD 4B53A 4LLVA 3QZNA 2EDJA 3H9SD 5SX5K 2BSDA 6PAZA 3S5LG 3HA0A 5BOPA 1TTAA 1FN4A 5FHBH 1W6LA 1SXAA 3CBRA 4GSXA 1YNTA 3RTQB 1NAMB 1VJSA 3T3MB 4QI3A 1HSBB 4ILDA 3MJ8B 4RGNE 5DURB 3UO1L 1SEBA 4QT5A 5I8EB 3UG4A 2FECL 1IVLA 4C47A 2KLRA 5IFHL 3HAEG 1UGKA 1YMMB 1EZLA 2J55A 4XODA 1D5XB 5C7XL 2NYYD 4JO1H 1TOXA 1ZLSH 4OZIE 4R0LC 3E2HB 2CHNA 3VVVA 4N2KA 2BJML 3HB3D 3E1ZA 4TULH 2EVIA 5L2JB 2NZ9D 3K4ZA 2FHCA 2OQJB 2JKJA 4GBXB 5CILH 1FIEA 2Y3AA 1E43A 5FF6A 3NIGB 1V3JA 3ARBD 4KNSA 3SSGA 4O9HH 1JDCA 4HKZA 4C56A 5L2KD 2GC7C 2GK2A 4X6BB 3MACL 1GIGL 2A6IA 3EF4A 3RWGB 4N6RA 3LKSA 1VZIA 4OAWB 5F1NB 1LDPH 4ZFGL 4Z3TA 3LZFH 2YAQA 2Z92A 3RVTC 1CYWA 2ZXAA 2VZVA 1AGBA 1Q9WA 2G2RA 3LQZB 3MLTA 4IMKC 2WIMA 3COOA 2DICA 4E42B 4I1RA 3ZE0F 1JNNH 2X6CA 3H55A 2VMCA 4PTTB 1W0YT 5F7BA 3CPLA 3LVTA 1D5BA 3ABZA 1EDHA 1RUMH 1R0AL 4MCNA 1U91A 4F58L 1RZ8B 3EOAB 5DHDA 3QIUB 2Q8BL 3V5DB 4PJIB 1AIZA 2KH2B 2J57A 4LBEA 3RY6A 3VWKA 4E41A 3QNZB 1IBYA 2NQDA 3HB3C 2IOMA 3I9AA 3S34L 3RIFK 3C60A 4BH8B 2DZEA 3MOAL 3FN0L 1I1YA 4N9OB 3GPSA 2JFCA 3JV0A 4QOKE 5D7LE 4OM1H 2Y4SA 2LVEA 3BQUA 2PCYA 4QTHB 3WIAA 2R0ZL 4IBUA 4PJDF 3GJFH 3V9EA 5C0JB 5DD6A 1QRNE 5MEQA 3U25A 2ISDA 1FFTB 1IAMA 1P1ZB 5C70A 1UXSB 5HGBB 1V55B 5AFAA 3OC5A 35C8H 3KJ6L 3EGDA 4OH2A 3ARFB 3BP5A 3RZWA 3SDCC 1QTPA 1U8QA 3PIQA 4MB1A 1IFHL 1SEQL 3EYFA 2E46A 1E27A 1UA6L 2OMNA 4XB7A 3GXNA 3HZVA 2DQIL 5DHMC 3TA3A 4ANKA 5MERA 4LSUH 2O5NA 3UTZA 1FV1A 4L23A 5JMOC 3SBQA 1G0YR 1URLA 4LVNC 1NCIA 1WE5A 4MCMA 4YZFE 2EE9A 4UAHA 4Y7OC 5HDBF 3FYIB 1VGKB 5F21B 3AM8C 2QPUA 2P5PA 2Z7UA 3OX8A 5TE6L 4MMYB 4R4ND 3TIEA 3DX9B 4DGYL 1RUPL 5BZXA 5IHZA 3H2QA 1HH6B 4L5FL 2J8UE 1T2QH 5IJCC 5LKNA 1BFOB 1P5UC 2R0LL 1F58H 3ZTCC 2PYED 5AEAA 5CJ8A 2XQBH 1LO0H 4LSTH 5LG6A 3SPIA 2VXTH 3KM1A 1A1NA 3QIWD 4FZEL 1TTFA 3HN8A 4PD4K 3U4EA 3GT6A 3T2LA 2XIBA 1PG7X 3QULA 4MYPA 4OKDA 4F15B 5FA3A 1RAMA 2XWBB 3BHBB 2WWMC 4UANA 2G60H 5GGTH 4CNIA 4YDJA 3B2UC 4HUKB 1JCKA 4U0RC 4YDVA 4HPOL 1BLIA 2MQGA 3IKCA 4QXTB 2V7NB 3WIFB 1NCNA 5EU4B 1E7VA 4G8AC 3ETSA 3V5HA 3ULUE 2A74C 4E9YA 5KVDH 1JNLH 3LH8A 1CL7L 1TSHA 4Q9QL 1CDHA 1JPGB 3LKPB 4ZW3A 2P8LB 5GS1C 3QFJA 5J1AB 4C83A 1P69B 4DF9A 5F7NC 1S9KC 1NPNA 2BVPA 1CURA 4DQOH 3A6CL 2EKSA 4OZFB 1CFSA 3JTBA 2ZOLA 2EC9T 2EICA 4XB8A 3BP6B 3RFRA 4AOFA 1J8HA 3L8QA 1OAJA 3WO4C 4HU8A 4G5ZH 3S2AA 1S7XA 4MZ2A 5LGHL 2FEEL 3JTSB 1HNGA 1YY8B 4MDIA 1N2RA 5ANHA 1DE4A 1EVUA 4APQD 4JKMA 2DWSA <