2BIHA

Crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
453
structure length
453
Chain Sequence
PFPVRQDSPLTEVLPTDLKTKDNFVARDPDLLRLTGSHPFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
molecule keywords NITRATE REDUCTASE [NADPH]
total genus 137
structure length 453
sequence length 453
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bihA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2bihA01
2BIIA 2A9BA 1OGPA 2A9AA 2CA4A 1XDQA 2C9XA 4PW9A 2BIHA 2A9CA 1XDYA 2CA3A 1SOXA 2XTSA 3R18A 3HBPA 2BPBA 3HC2A 4PW3A 3HBGA 2A99A 2A9DA 3HBQA 3R19A 2BLFA
chains in the Genus database with same CATH superfamily
4NQTA 3U9UB 3SSGA 4ZUWB 3IE9A 5F7DA 3HUJE 4YIQA 1O5PA 2A9NL 3ARGD 4IGBB 4OLVH 1YC8A 4ZPVA 4AYEC 4DFIA 1FYHB 5JXEC 4Q58C 4HUVB 3R18A 3IGKA 1A22B 1A3LL 1KCVH 3OAYK 3DGDA 4ICXA 2IGLA 1D6VH 3RL1B 1VADB 2EJ1A 4DCQA 4XZUA 1GC1H 5HHVL 3BKCH 3S5LA 5FR3A 1PTZA 3ULVC 3SE9H 3RURA 4W9EC 5A3ID 3NT0A 3RI5F 2EDYA 5IGXH 5ISZA 1HH6B 5I66A 5MEPA 3WTXA 3PUUA 1SPDA 3TT3H 2JI2A 1UZ8A 3TNMB 3WGVB 3CVIH 3HZVA 3X1EA 2JQZA 4MNHB 2IGFL 4ETQB 2R69H 4KVNL 5B7EA 1S5IL 2XSKA 5C7XH 4KTEH 4ENZA 4L4TA 1LO5A 3K80A 4KTDH 3VFWA 4HXBL 2CHZA 1RZ8B 2FX8H 1AGCA 1AD9B 1EUTA 3BUYB 4BV1A 4NPYA 4L37B 4KX8A 4LSSL 3RIKA 3ABZA 1F0LA 1T7YA 1UQSA 2AEPH 2EIKB 1X9UA 2X4NB 5JUEH 4M8UA 1GZHC 4POZD 2NY3B 3INUH 2IQ9L 5C0JA 5I74B 1TVBA 5SX4H 3V0GA 4F8LA 2E86A 3CVIL 1WGOA 4Q74A 3DOIA 4WTQA 3MAWA 2F19L 2J88H 1PJ9A 2JJVA 2DQEL 3NJMA 1TUPA 4MFHA 3MREA 1O5DT 3Q8CA 1Q1JL 3K2UH 3SYOA 2GW5A 2RCSL 5EZJB 1S7TA 5GS0L 1G9ML 4W68A 2ICWA 1HCFX 4G8GD 4KY1H 4C83A 5IMMB 4KZEH 1UYWL 2A0LC 3ZMNA 2WGNB 4UZSA 5K9OB 1IAOA 4LHUB 1LO4L 5LBSA 4J4PD 4LGRB 1JNHA 1QRNB 3U9WA 3RZCB 4L3CA 3PP3H 2HLAA 4JJOA 3L9BA 3OR6B 1UH4A 2FTAA 4AQEA 4PJ9B 4M7LH 1JZFA 5T8IA 2X6UA 2FWSA 5E1AB 4MAUH 1MCSA 5IW3A 3U4AA 3IDGB 5HHMD 1LEKB 3P77B 1ZLSH 1G7QA 1MLCA 4RA0C 4H25B 1JI2A 2Z93B 1N0XL 2Z8SA 3CSTA 4Z3JA 1ACXA 4HBCL 1TYRA 3VFGL 5IESL 3LN9A 5ENWA 4G5ZH 1RIVL 2JE8A 3VD7A 4C56A 1NGPL 2JQAA 4J27A 1OW0C 2DJSA 2VSMB 1O7DE 3MRQA 2ZWLT 1TMCB 3QDJE 3JYCA 4HAFA 3D50A 4JRXE 1QSED 4J12A 4U6HA 1KV7A 3ZR5A 3G6JF 2E6QA 1DVFD 2NQ3A 1FO0L 3BZFB 4NCC1 4ZFGH 4R5XA 3SDDD 5B38A 3HC0B 2WM0A 4UT6L 5DMJB 3TT1L 5C2UB 1YC7A 4YEEA 1WEJH 1EZUA 3K1KC 4F2ME 1R9FA 5D9SA 3EDEA 3O2DL 2Q3XA 4ZFZA 4LHUD 1N0XH 2EVIA 5KYXA 3EGXA 5AW7B 3KDMB 4JFFA 3ARGA 1JMZA 3QZLA 1UOVA 4WTZG 2F53B 5ACZB 2DTSA 4HHWA 4ALAH 4X4MA 4L9LB 1OHQA 4IBYA 2ITCA 1XGRA 1P4UA 3ROLB 1JZ7A 2WLKA 1UM6L 4UZUA 1I1FB 5I1KH 3QXVA 1RZKC 4EQ2A 1PVHA 2PPCA 1SQMA 3NA9L 2JF1A 1UYWH 3NIFB 5D70L 4N0UE 1CYGA 4MMYA 4MZIA 1PIFA 2FH6A 2Z91A 1I3UA 4N0YH 2W94A 3A5VA 1H3TA 1O75A 4JFXB 3VGAB 1NCAL 3GMPB 5CIPB 4OD3L 4L2LA 1NBQA 2AXWA 2B4CH 3MGAA 4R2GD 5D6CB 5AVTB 3BVVA 2FJHA 4YSPA 1BX2B 3FO1B 3AAZA 2EYSB 1FNGB 1DJHA 1PY9A 3VMOA 2KLRA 3ESNA 4AKOA 4BQ6A 4WGKA 3PWNA 5EUOF 3F7VB 1O6VA 3OZ9H 1SLVA 4XOCA 5F9WB 5C0EB 2CCVA 2Y2WA 4M8QA 2J12B 4IU3B 4YOKA 3FB8B 4RWHA 4WW2B 5I9QB 3UG3A 2I25N 4P9HC 4GLRH 1CCZA 4N3UA 5IBLC 3QEQB 4PJ8C 3K8LA 4XAKD 1BXVA 3L4XA 4YDKL 3EOTL 1MFUA 1U8NA 5EU6B 4ISVB 1N5AA 1MRFH 3JWOC 2FSEA 2Q7YB 2FLRT 2XWEA 3G08B 4W9FC 5DVMA 2MEJB 1RZ7L 1OP9A 3RHWK 3EYQD 5FYKE 3N06B 4OGXH 5J6SA 3MJWA 4B7LA 2XTLA 3B56A 4B41A 3IDMA 4MJ6A 4M8QB 1OAXH 3VMNA 2A99A 1MJ8H 3IXAB 1OT4A 4Z0XA 5FHBH 1I8LA 2WBWB 5IJDC 3VCLA 2GIYA 4PW4A 5MP6H 1CMOA 4WTWA 2C7UA 1YNLH 2YXWA 1H3UA 1T04A 2M8XA 1HZLA 4WFHD 1C08B 4TVPD 3WEBA 3KD4A 1JZ5A 4FQXB 4CN1A 5D5MA 1IEHA 3RWDA 4LBAA 4MD4B 1MI5A 4F2MB 1USZA 4I0PD 4C56B 5LCVH 4I18C 1XX9C 2DWXA 4PRPD 4QJ5B 2ZYSA 4N5EC 5DD3H 2YUXA 4LPYA 2UX7A 2CDEA 5MI0B 3J8F7 4FFYH 4GI8A 3UTSE 1X3DA 4QXTA 4J4PC 3QARA 4PJIE 2PWFA 1X4YA 4UILH 1JXKA 4OQ1A 3IAGC 3MCKB 3DX9B 3LD8C 3GHBH 1XSJA 2EH8H 4FNPA 5AB0A 4HOMA 1J1XL 1M05A 5JOPD 4PV1C 1PG7W 4AEFA 4A55A 4P5KB 1T0OA 1JERA 3PY9A 4HUUA 1HQ4B 1ZAGA 1DUYB 2I07A 2YD4A 4FNSA 1KCWA 5IROC 1ZDSA 2J72A 1WQVT 3MV7E 2AXGB 2LU5A 3IGFA 5D2NE 2JB5L 3SE3C 4HJIA 1QA9A 4WCYH 3WMPA 1U58A 4JKPH 4ADJA 4ONHB 5C0BA 1A14H 4OGXL 5KWYC 3HAEB 1NMCC 4XBMA 2X70A 3EG9B 3HC3L 4X6DA 2FUTA 3QNYB 2CMRH 4M6NL 3GMQB 3ARPA 4L8SA 5GSRA 3GTTA 3OJMB 4OSUH 5FO7A 1NDTA 1FPTL 3K5RA 4BZ1H 2ESVE 2DY2A 4LMQI 1PIGA 1I7ZB 2JKNA 5CZXD 2Y7OA 3AU1B 5G55A 2R15A 2W0KA 1C5CH 1DQDH 3VACA 2IOIA 1R46A 2EEAA 3DBXA 4UOW1 4K8RH 3I2CL 4HFWB 3VW3H 1CD1A 4TOYH 1INQA 2DJUA 2E47A 4WWKB 3DMMD 2VR7A 5SX5H 4AUJA 3B8YA 3KS0H 4XB3A 4E42B 2P26A 2FO1A 2LHAA 3MV7A 1RZ8A 5T1LD 1D5XB 5EUOE 1MVUB 3QUYD 5A3IC 3A67H 2VCOA 3DOSA 4DWHA 3S3DB 3JTTA 1W8OA 4OD3H 5CJXA 3W57A 1OOAA 1JV5A 2W88A 1U8QA 1MJUL 2Z92A 3CSYB 3HLKA 5F1NA 2PWDA 5BMFL 2QVIA 4P9ML 3KWTA 1MY7A 4PWHA 4B9GA 4TSAH 1VAHA 2XN1A 2E5EA 3UABA 3LNEA 4XP4H 2XIBA 2VYRE 2NY0D 4K5PA 4PJDB 3S34L 3BH8B 1SJHA 4NC2B 2K4WA 4KI5D 4O00A 2BRRL 1IFRA 3ULUC 5F6HJ 2K9UA 3P69A 2V3EA 4JFDE 1S7TB 1MXGA 4O9HL 1BQHA 3RUGB 4CSSA 4L5FE 5K39B 3MRCA 5A2IH 2YD6A 5GJTH 3QUMA 4YX2H 5EOQH 4GO9A 1GGBH 4KNSA 4ZPVB 3WDHA 4UM9A 4KI5F 43CAB 3QXAA 4JFQB 2MHAB 3VXMB 4RAVB 4U1HB 4N2LA 4YR6B 4CGUB 3CLFL 3MRLB 4OGAD 3T65A 4YHZL 2ZXCA 4WHTB 5D4IA 4FOMA 3RVWD 3AREB 2DQDH 2OMNA 3O8XD 4PFEA 1CK0L 1J5OH 1KV3A 4XMKL 4XO5A 3RYMA 3AB0C 2EILB 2FJFA 4MA7L 4G9DA 2WXGA 1FE8H 1R3IH 3TA3D 4AIXA 4YFLI 1JGDA 1MKFA 4X5XB 2ENYA 3ES6A 3K2KA 3AABA 2X4RB 2OYKA 5ADOH 2QV2A 3VE0B 1ONQA 1N5YH 3EG9A 1BP3B 3JV4A 4X6DB 5IVZA 1P4IL 2XXGA 2FHFA 1OW0A 1WFNA 2UXFA 3ALPA 3P0GB 2IANA 4ZTOL 3APFA 4GKNB 4Y2OA 4E41A 4PRPA 1KLGB 2AJYL 4YDLC 2EVHA 1YN7B 3SKNB 3VTMA 4X8JB 3MCLH 3OVUB 4QRTA 1OPGL 1U8MA 1FUNA 2H8PA 4P5KA 5HY9B 3QUKB 4Y19E 3RL2A 4JM2C 4EVNA 1J8RA 2PCYA 1OGSA 2KLTA 3NCCB 1GAFL 2XTJC 1H9DA 3NGBC 3SDAB 1CXKA 2NNRA 2XQYG 3DECA 5EOTB 4AIZA 2NY5C 4GYBA 5I1LB 3BPLC 4H26B 1MRDL 4XBGB 5HGGS 5T1DH 4M5ZL 1FLTX 5TF0A 3GI9H 3I6GA 1TENA 1QASA 2ITDB 3L9RB 4JMNA 4WFGE 4UAOB 4KZDH 5B3JF 3BP5B 1HFUA 2CH8A 2WQAA 3D30A 4ZO8A 1KNOB 3CZFA 5I1CH 3OB8A 3KYKH 3D9AH 1L7TL 3CFCL 2FEDD 3RA7L 4FLQA 1V3MA 3MLWH 3WIFB 3L3DA 5SX5K 2VXTH 2H32B 4X99B 4W9ZA 2OKMA 3MA9L 3LS4L 5L6YH 3ARBD 1E9OB 2CK2A 2GCYB 3CH1A 4ZG1A 1KGIA 1FGNH 4PD4J 3LQAH 4JGMA 2GJ6A 2HSIA 3I3BA 2BVTA 3RGBA 1TZHA 2ZWYA 4WW1B 3SDCC 5F6HI 3RNKB 1R5WA 1WITA 2QHRH 3FQ1A 2QTEA 2VLRE 2WP3O 5SWSD 3HN8A 4GKZB 1OAQH 4N2OA 3EOAB 1OPOA 4IM8A 1HKLH 1ID5I 5T1LA 2VW4A 4B9ZA 3OKOB 1ETZB 2K9FB 3IJYA 3IPBA 5IF0A 1D3CA 4LLQA 1IGMH 2FD6L 3VSUA 1FLRH 2WYIA 3RX5A 1SM3H 4EBQH 1AO7B 3IGLA 3FB6A 5E03A 1MNUH 3WN5B 1JUFB 3D08A 3WFBH 2MH4A 5GGRA 2N1KA 4PJ8D 3WTVA 4IRJC 5KVGE 3GKWL 4K94H 2XACC 3V9CA 3DX6B 1JG9A 2BVYA 4JY4A 5EIQA 1NANI 2FJHB 5F3HA 4P4KB 4R3SA 4ZNEE 1A0QH 2VRKA 4RFNB 4OZ4A 2ZZUT 1TNNA 2O61B 3BP7A 3OMZA 2VZSA 4X7FC 4B27A 3FT2B 2ORBL 3LKSB 5D7JC 3C6SB 3CZSA 1QSFB 3A6OA 4AZUA 4ZNCD 5IQ9A 4MJIA 3WKNA 4IKNA 2VXTL 3PGCB 4FZ8L 3FW6A 3T2PA 4PGZA 2NNAA 2QQNH 1U92B 3HCVA 3PGFH 3U7WL 1MCPH 2YPLE 1F4AA 3U0TB 5AW0B 5A1AA 2YUVA 4GBXA 1SN5A 5I1CL 3EBHA 5JYLA 1Q0YH 4NKQB 2BHZA 3WXWL 4N0CC 4ORGB 3QDJD 2H4EA 4LBEA 5J9PB 4KU1A 4X50A 1N0LB 2AK4E 4QXVA 4JFVA 1BF5A 3T08A 4B53A 2HVJA 4MXWH 4OCXH 4PGBB 3KYNB 5IJKC 4NX0A 1MFCL 1P5UC 2ZF8A 3OQ3B 1YLBB 3P0VL 5IHZB 5LBSH 3R8QA 2EYRA 5ISZD 4ODUB 1MW0A 4FAAB 1A1MA 4OF8A 1DE4A 3TV3H 5I17A 4OCNC 3UBHA 3MLSH 4WFED 5B4MC 2EIZB 5I18L 3DURB 1H6FA 1VACB 1IGIL 4FMKA 1B6DA 1JWSA 2R29H 1SYSB 5FWQA 2GEEA 5DJDA 3A6CH 4A37A 4AQ1C 4XMXA 1DJGA 4WTZA 3WG7B 3MV11 3O41A 2AJ3B 1SOSA 3RI5K 3S35H 4C4KO 4JRLA 4AE1A 2XN9E 4YDMA 3RB7A 5EZOH 3SGDH 1E2VA 2C34A 3WBDA 3ZT5A 5JHMA 2HN7B 1TJMA 2PWEA 5KVFL 4UU9B 1AJ7H 4D8PA 5BOJA 1E4KA 5CJQH 2DF3A 2GI0A 3PL6A 1WAAA 4XWGH 3O9WB 3H9SE 2NY4C 4D0DB 2CUAA 3UBXI 2VZ1A 4S1QH 3ZY7A 5KSBA 3O0RL 4TQPA 1TQCC 3VG9B 2IWKA 3EJPA 2E4FA 3S8GB 5EBLB 1TEYA 2Y6TE 3JSSA 5FO9B 2NNXA 3IFNL 4OD1L 3VXQA 5E6YA 3PJSB 1VJSA 4E36A 4LSTL 3QDHA 1JNHB 2CDFB 2AI0L 3LN5B 4ZQKB 4I1RA 5DRZA 2R0LH 3F3HA 3J27A 3U30C 4AH2B 5DMYA 4P23B 1N67A 4PJ7B 1NL0H 4PHZA 1L7IL 4F7KA 4N24A 1AHKA 5KW9L 2P45B 4QY8A 3RWEA 3T8XA 4OAWA 4KPHH 1EJ6A 5L88L 2FB4H 3ZTNL 4XVTH 1A7RL 1D6EB 3GEWB 1K4DB 4KNTA 4XN2A 4YHPA 4IJ3B 1SF3A 5CU5A 4X6DE 3ZPDA 3OXRB 4GAJL 2X1WL 2MPAL 4BFEA 5KVGH 5CBEA 4I0KA 4YZFE 4FFYA 2I9TB 1YEDA 4L9LC 2EE0A 4JFOB 4DEWA 4KQ0A 3GZQA 2H1XA 4Q6IB 1NZRA 4KQ3H 2WN3A 3BVDB 2IBZX 2HFGH 3D48R 4FQIH 5CP7B 3NFSL 4XPTL 2CUIA 3BH8A 2KLSA 1E3FA 1WD8A 3E2HC 2X1QA 1RAMA 3FH5A 3VI3F 1CBJA 1DVZA 3GGWA 3DO7B 2BERA 3APCA 4XN4A 5D96C 4GRWB 4QRQB 2HRGA 2FZ3A 2N7AA 3AT8A 5D6DA 3MNWA 4G6AD 5GQBA 5KBNC 2C1PA 1AGFA 3WEXB 5DVNA 1BZDA 4X7CC 3WSQL 1KTKE 1IL1B 3WHE0 1VFUA 3OF6D 2XTJD 5DF0A 5FM8A 4JM2D 4PJDE 4U4BA 4PLKC 9PCYA 4GBXD 2FX9L 3FYIB 2RTTA 3P30H 2PCPA 5C92A 4H4NA 1AXSB 3WHXA 1AIFA 5HJGA 4Z7NB 4OFKA 2M2DA 4UTAA 1ZANH 5EF2A 1FORH 2AQQA 1R5IB 1RIUH 3DBXB 1NWOA 4G43B 3ZHDA 3OXSB 3LMJL 3M07A 4YAQB 5GZNC 1RZIB 4WFFE 2LLNA 2WQWA 3NN8B 3ZTEA 3AACA 3QFGA 4MNQA 3S37X 1LK3L 2GJZB 3BH9A 6PAZA 2A9DA 4IGBA 4QRPE 1ZV5A 5DJDB 4WK0B 3OLDA 3LNDA 3TZVD 2K1MA 4ZUWA 1RURL 3CBRA 2DQUL 4F37K 4ANUA 5HYJE 2MCG1 1VACA 5K1VA 1II4E 3NRFA 3TN0C 5HTSA 3TF4A 4NZUH 5GRJL 5H4YA 3JVGA 5FKPA 3APNA 3PWJB 4E9RA 2PF6A 5FW7A 3RVUC 1A65A 5I8KL 1A5FH 1PY0A 3G7TA 1SOQA 4XCYB 3ZSSA 4EOWL 4YHLH 3PQYB 4XP5L 1JGVL 3WNPA 4QNPE 1E30A 1Q9OB 2E4TA 5C07E 2C9PA 4ZFQA 2LU3A 3KHQA 4LK4A 1UOWA 3IE4A 5FHBL 3ZKNC 3ZHKA 4MA8H 4F80A 1DTUA 1E5BA 3QWRA 1WSST 4KXBA 3H9HA 4GAGL 3P11H 4G9FD 4JO1H 5CD3A 2P8MB 5E8NB 2GY7B 5F3FA 5C0DA 4JW3A 3SKOA 3UYOD 1RK0B 1KPVB 1KEML 1YQVH 1EFXB 2GABA 1HOCA 4I7ZC 4GEJA 4FL4C 3K1DA 1MI5B 2EE2A 3SDYL 1IM3A 5D7LD 2BP3A 5I1DA 1E28B 1T0MB 2J6WA 4LLMA 5IB1B 4N5UA 4M00A 4JVPA 1ZS2A 5IW6B 2YGPA 1Y18A 3DO4A 1FVEB 5KG9B 1HHKA 4PRAA 1AOZA 4YSQA 4WY7L 2C7UB 4PJFB 5TDNB 3VFOB 2QR0B 2OMVA 2XBDA 3FRPG 3ZLQC 3IXAA 4Z0XB 2D03L 3NK4A 1PZUB 3DTDA 4MDRA 3RGHA 1C5CL 1TSHA 2DD8L 3KPSA 5GRWA 3V8CA 1QBBA 4W9KC 5EC1A 1PGRB 3TCXA 5CZXC 3DX1A 2DQMA 4FZEH 1Z66A 3QIUB 4UUJA 2NPLX 3EOAA 2KYIA 4HV8A 1F2XK 4U6VH 2IBGA 4PPTA 2BMKB 1S9WA 3VAEA 3WS3A 4X8GA 1WIOA 3DGGA 1TVHA 4GAGH 4PRDB 3Q5YA 3NJVA 1NDMB 2BNQE 1GGTA 2N0MA 5AYQA 5C0ND 2YAHA 3SDXB 4BFGA 1KZQA 5JPMA 1FG2B 3BSGA 5AALA 4R83A 4XBEH 1LMKA 5C8JA 1DANU 2B5IC 2M26A 2FECI 1E9OA 3CH1B 3V0DA 3IFOB 5ABZA 5L0QB 3D3VA 5CGMA 5I1IL 4NN5B 5C6TL 4GQRA 1AXIB 4F33B 3WIFA 2D7TH 5F7AA 4U1IA 1F86A 2PP8A 4KDTA 5I5IA 3O4LB 2GT9B 4R3SB 1QHOA 4GG8A 4NZJA 1FF5A 2F7OA 2ZOLB 4R7LA 3X3FL 4L4VB 3QH3B 1A9BB 4PJEF 4MVBC 5GGRB 3HN5A 4N90D 2A6JA 4P5TC 4Y19D 3ORJA 3BAWA 3BVNA 1P1ZA 4MQXC 5FOBA 5T3ZD 5J7CC 1EEUA 4H1LB 3N1GC 2BVQA 2XTSA 3JV6A 1NEZA 4I0PC 4G3YH 1AKJA 4HF5L 3SGDI 1HT6A 1LK3H 3VXRE 4B9FA 1UVQA 1T5XA 1H3GA 4LSRL 3TESA 1R47A 3CVHB 3GS0A 3OMAB 1ZEAL 2YLHA 3OKOA 4GW4A 2WXJA 3US9A 1JHLL 4K55A 1J8HB 3CGTA 4NQQA 1BAFH 3TCTA 1DQJB 2Z7ZA 1CLVA 1JWUB 1ZVSA 3D3VE 3M1CA 4NQVB 3NCXA 4XB8A 2AKRB 4EKJA 5I0VA 4EPSA 4FFZL 3U9PL 1J0YA 2ZXQA 3WFHA 1YNTF 4FJ6A 2ZXEB 4PM1A 3PREA 2AXHA 1E5UI 2YC1A 4HPYH 3EGDA 4XXWC 1EK3A 4JM4H 2E0PA 2L3BA 3TYFA 2QPDB 3ULVD 4Q6YA 4EAEA 4B5ZA 2QELA 4PD4K 5L4IA 4TQ8A 5CF3A 3BOVA 2YD3A 1ZLDA 2ILLA 3N42B 3AS0A 4KZEL 1X5ZA 1YEWA 4XPTH 2Y07L 5DUBA 2H2SC 4OJDH 4P48A 1QI4A 5EA0L 2HTLD 3WELA 2BRQA 4H20L 2BVPB 3DOHA 1CXIA 4HLJA 5DVPA 4PSRA 1RZIA 3K2UL 3EFFB 4F1SA 2H5UA 3L4UA 4HWZB 2HCZX 3HE7C 2QKSA 3MROA 5DHXB 5EU5A 3N1FC 4HJGA 1T89A 2WLMA 2YARA 1P84J 2VDPL 2MPAH 4TQHA 4WU7B 5TDOB 4E9LA 2H8PB 3VDBA 1N6QL 4Z7NF 3V8OA 3BGFB 4BELD 2B39A 3BSZL 4OT1H 3MRNA 4XNUL 3FU7A 3LS5H 3NSFA 2BSTA 5K9JH 3ABGA 5I1KL 1U8QB 2Z92B 1JTTA 1CGSL 2E9JA 3BQVA 5F1NB 4A7TA 3QNXA 2JXMB 4W70A 1OAZH 2CSPA 3B7RL 1R34A 3CN4A 3CPLB 1IX2A 3G5YB 1N6VA 3KPNB 2HUEA 4FG6C 4OFPA 2RJMA 5E5LA 3L4YA 2X2JA 1E5AA 4PY7A 2Z9TA 3BAKA 5SWZB 4Q6IA 4KK9D 1RP9A 5DJAB 1KGYE 3LX9A 4GAAA 2X4NA 2W9LA 4FQLL 3O2DH 3DKHA 4IOSA 3I3EA 2V2WA 3TJHD 3KLKA 5AZEH 1S7SB 1OAZL 1AJ7L 3DJZA 2QPFA 4WZ9A 5IOPB 4I77H 4KHXH 3OKNA 5ISZE 3GRGA 1L6XA 3SKMB 2EDDA 3LYRA 1QW8A 1LE9B 3F65A 4MNHA 5HVHC 2PPEA 4QUOA 4G6AC 4K7FA 3RWJB 3EYUH 3WL9B 4X9BA 5C0CE 1J9SA 2R1XB 2VXQA 4L1HA 5I66B 1PLCA 1KMGA 1JV2A 3CZLA 3GBDA 1F58H 4HBCH 4NQDE 4XRCA 3HB3D 4J3SA 3LN5A 4X9HA 3X14A 2WXRA 3TO4C 3T4YA 2A4ZA 4GKOA 4LRNL 2YKLL 4B9PA 4C8XA 4IRSC 4RNRB 4W9IC 1T20B 1T83C 3WIIH 1E2WA 5IJCC 4DW2L 3JTTB 4RDBA 4L8BA 2HFFA 4LKCA 3VXNA 5E08L 1MPAL 5LXGH 4GQZA 3SOTA 3ABMB 3QQNA 2DS4A 4FNQA 3FKUS 3BC9A 1ZT1B 5ANMA 2R2BA 4OI7A 4UOW0 1BOYA 1LXMA 2VDRL 4DVBB 2H7WA 1I8IA 1NWPA 5FIEA 1CICB 2CXGA 4U1KB 2AABH 1CICD 2EINB 1WTLA 5CLZA 5EPMB 1UD5A 3JZ7A 3PWLB 3U7WH 5JOFB 3PV6B 3K91A 2XI9A 4FZ8H 4NSKB 1EO8H 3U36A 4K73A 4K3HA 1R3LB 2X7LB 1TDQA 2FT7A 4JHWH 4LCUB 4YJZL 4DEUA 2QZ5A 3QT2A 4WJ5B 4GPVA 5DD1L 5E2WH 5I71C 4KX9A 3MNMA 4Z7OE 3RZWA 1BAFL 3CCHB 3VMPA 1MHHA 3MOQA 2R2EA 4MKMA 2YKKA 4F57H 2YK1H 4XNMA 1MNUL 3QCTL 4XX5A 4RFOL 1L7IH 2FK9A 1KGWA 4HUUB 3MRPA 1WRFA 4DERA 4JM2A 1KJVB 4YMPA 2X4SB 1QW9A 3CVHA 1HWGB 1HESA 1KT2B 2DMGA 3FQXB 4HUKB 4PV8B 4BZ2L 4YQXL 2EACA 4OZIA 1DHKA 2UZIH 3BRDA 5CAYB 2F61A 3WTUA 4J6IA 2X4UA 4LP4A 4NGHH 4UM8A 3VA2C 3CXHK 2ESVB 1ZLWH 1ZLEA 4IU2A 4R0LA 4O4YL 4BSVA 1YAZA 1BVLA 4HG4J 4R6UA 1U92A 3HCVB 4GSQA 2FX7L 3HNSH 4HIPA 1MEXL 4F2MA 3LSOA 1MAKA 1KGJA 2IDFA 3GSNL 3PWVA 3QUXB 4XTRC 3GMPA 2YQBA 4L2YA 2QLVB 1UWEL 1KTDA 5DFVC 5IEHB 3FO0H 4KFMA 1FJ1A 1H5BB 1Y7VA 2YN3A 2BXYA 1G0YR 1V3KA 3V6OE 3STZA 2XTJE 3QUZB 2ZONA 3MRMA 4P46C 4A7GF 5CSZB 3S96B 4GSXA 5KBMA 3WJLC 3HZYB 4Z7IA 4Q4EA 4QYAA 4M6MH 4XPBL 3WXVH 4WI4A 1IV8A 2WLIA 3Q5OA 1WT5C 1JDAA 3DGGB 4K8RC 1WWWX 5DZAA 3OWRA 3PP4L 5TE4H 3UIZA 3ZKXB 1UEYA 4N26A 5F0PB 1MDAA 3A0OA 3IJ9A 1IGIH 4IOSD 4OGZA 3ET9F 3D2TA 4HETA 1N3NB 4WFFD 5BZDB 2BDNH 1KYOK 1G6RH 5MEQB 3QUYB 3GTVA 4S1RL 4D2NA 1MIML 2C9AA 5I1HH 3PDGA 3HG4A 4W6WB 4OCWH 5IFHH 2QMJA 3LZQA 4Y5YC 1CE1H 5I76B 1ZXKA 3DMMB 2A74B 3OHXA 3IFLH 3KDPB 1NEUA 4IOFC 4O5LL 2KPWA 1KXVC 3AU0A 3TVMC 3E8VA 3TONA 3W81A 5KN5B 2K0RA 1I8LC 2CG9X 4O2FA 4N22A 1CLYL 5FS5A 3VSQA 3PP4H 2E6JA 1CFQB 4M56A 1NGQL 5HJBA 4IRJD 4KKRA 5KUKA 2KH2B 5CILH 2WZ6A 4M7KH 2LE9A 4FTVD 2FRGP 1LDSA 3O6LL 1BZ9B 3WD5L 1B0WA 1KEMH 3OAUH 3C5JA 1XGZA 5DRXB 5C0IB 5ACMA 3P9MA 4KI5E 3S4SB 1LP9B 3O3DB 4KXZI 1KPVA 1X5HA 1CBVH 3BPCA 1B0GB 3ULUE 1BJ8A 2H26B 1QFPA 2YPKA 2ZYIA 2BS8A 4YHNB 3LH9A 4NQEA 1IM9D 5F9DC 4NBZB 4I1PA 3FB7B 2HLAB 4UNVA 1KBVA 1K6QL 3V4PH 2VLJE 1I1RA 1K8DA 4GSRA 3S6CA 5F7FA 4XCCL 4XWOD 1PD1A 3IGUA 5EBMB 5FYJL 2O6CA 5IOKA 3IEAA 4I48A 5IFJA 3SE3A 1YJDL 3L4CA 1CI3M 1CR9L 5D1QC 2WNWA 1IT9H 2F8XC 3CN1A 2VABA 2NXYD 4GKNA 4UDTB 1LHZA 1MI5E 4DIXA 2WZ0A 3PFUA 4NP4L 1ZV9A 3IMSA 3CU7A 4R4NC 1SUHA 1W8NA 8PAZA 1FFNA 3CFKB 1FYTD 5C71A 3KYMA 4AGOA 2EADA 4JY5H 2F7QA 3P4MA 4OLUH 4Y5VB 1GSMA 1FORL 2HYMA 1JJUA 2XA8H 2H0EA 4G9FA 1KCRH 4PH8A 3VFPB 1Q9KB 2Q6WA 1JPEA 3KNBB 3C6LA 4DO5A 3MLWL 2ERJC 5L8JB 4AQAA 5T3XH 4WHTA 1UQSB 1SLUA 1VGEH 1IM3D 4MS8D 5D7JA 1MLCB 2A9ML 1DSWA 1PZAA 3P77A 4LSPH 1LEKA 2R29A 3CPLA 3VFWB 5IM7B 2AJVH 3W38A 3S3SA 2AF2A 4DTGH 1EIBA 3AUWB 1H8SA 5HDQL 3BI9X 5C0BE 1MWAB 2WNXA 4M5ZH 1Y0LA 1MUJB 4P2OB 2M83A 3QWOB 4DTGL 4RNRA 5D2LA 2H0FA 4QRRA 4F7PA 4OD2B 3VJ6A 4KJWD 2AJSH 3WIIL 5IREA 4X98B 3GXMA 3LRSB 3H85A 3PJNA 1P7QA 1KXTB 4ZW6A 2GK2A 2CCLA 5T3XL 7TAAA 4NC1C 4C83B 4KV5E 5CP7A 5I0YA 4DCQB 2VJ0A 5T1KD 3F7YB 3LNIA 5DJ8A 5F7WC 2OS7A 5EZJA 1I1AA 3GSQA 4KVCL 5KANG 4LKXA 1YEDB 4YSEA 3IJ7A 1HSAB 1BQRA 1A9EA 1BDYA 1EHNA 1LWHA 4XMPH 1P4IH 2VLKD 1FC2D 1M7IA 2QSVA 3IMVA 2BVPA 1CL7L 3QO0A 3VNYA 3GBNL 1DCEA 1V05A 5EUOA 4LO9A 4KGJA 1WBXB 4KPHL 4MS8C 5C0FB 1INQB 1UJ3A 2WWNA 3ZO9A 1DBML 4ABVA 3LKQB 1DVXA 3HPLB 3IMUA 3RWEB 3DPBB 3U83A 4FXKA 3LXCA 5JHLH 1BEYH 5CM1A 2NY0C 2LGNA 4QOKD 3QQ9C 4PJGA 5TGBB 4GUPA 5L2KD 1BWMA 2F1BA 2GTWB 2KQNA 4OV6F 4PYGA 4G6KH 1KJ3L 5MERA 2CDFA 3FN9A 1IBGL 3L48A 5IBUG 4PEEA 5TQ0H 4RMBA 2WXHA 4JFDA 4K2UH 5CSBA 3ZQ9A 1NMAL 4OB5L 1NBVH 3FMGH 4P04A 3L3OA 1IEAA 2WK2A 3FQUA 4QRUA 4A2DA 1HH6A 2PXYC 2SEBB 5MEPB 2CRMA 3FU7B 4FYRA 2AXGA 1JRHI 3P4LA 1YEGH 3IVKB 3GINA 2F74A 1T1WB 2VDOB 1W6LA 2WGXA 1NGXA 2Y7LA 3ULVF 4K07A 2HVKB 4ZFFA 3BIBX 3HE6D 4Y2DC 2X41A 2YPLD 4HEPG 4IMLB 5G4MA 3S35L 1KEGH 4GP8B 1IC7H 5CP3H 4F8TA 5CKGA 2FYYA 3MV9D 3OHXC 4K9JA 2FQFA 4HFUL 4FQQA 1AGBB 1UB6B 2D7QA 3OC5A 2WKLA 4H20H 1W9XA 3VI4B 4AUYA 2VMFA 5LN4A 3B2PA 3N1MC 1MCLA 5E4OA 3SKJH 3RHWF 2HRLA 4AM0B 5EEWA 1E8WA 2N01B 4HUWB 3FT1A 5CN2A 2P80D 5HI4D 3SE4A 1JE6A 3E0GA 3MTRA 1VEPA 1CT8B 3VFVB 3BUQA 3EZ8A 2Y7NA 3F7PC 1FBIL 4MJID 2N56A 2ZKXA 3J2PA 2LVCA 4UBDD 1OM3L 2BIHA 5C7ZA 4IDLA 4HWBL 1HI6A 2K6WA 3RWHB 4PRIB 5D1XB 5E6IC 4DK5A 5ICZB 3D4YA 3IJ8A 2B9AA 2XN9D 4YHIA 2VDMH 4LFHG 1IGFL 1GGCH 2DQFB 5FYKU 4JDTL 3RVXC 4UT9L 3OAZH 4UMSA 2A2QT 5GS0C 2Y0SA 3K6DA 5C0AA 2CJUL 4AY0A 4NO0A 3VI3A 4OB5H 4L8DA 3ZDYE 2L7EA 1KC5L 2OMWA 2ROYA 2HJLB 5D1QA 3GKWH 5C0CD 3VFTB 1BGXL 4HQQL 4PWKA 3MJ9L 3KLAB 1J0IA 4TNWF 4P46D 2DI8A 3CDZA 5J8OA 2GHZA 2IOMA 3VXOB 1Q90A 1QZNA 1ZGLA 2VM9A 4AT6A 4ZFGL 4PREA 4W9HC 2OYPA 1IM3B 3RPIB 1CZ8L 2NY4B 3VI3B 2VL5B 3GBNH 3IJYB 1X5IA 2N3JA 3QPXH 3THML 1RCYA 4A6YA 4AVJA 2Q2EB 5C0DB 1ILUA 3CFUA 2YK1L 4AKQA 1EAPA 3KJ4C 5MP6L 3H9HB 3I6LD 4S1SL 5LG1A 4G8FA 5JZ7C 2Y4SA 5LKNA 1A6UH 1PJWA 5ICYB 1M57B 4ZD3H 2Z8WC 2H6UA 3EDJA 4KTYA 1TTBA 3ROLA 5IEKB 3WLWC 2ZCHH 2P4AB 4M3HA 1UA6H 2B0SH 1UFUA 4QOKA 4W81A 1XO8A 3BJLA 5BRPA 2OXHA 1E4KC 1T4KB 2A9BA 2BFVH 3ARGB 3E7JA 1R3JA 3MNZA 4IGBD 2ZTBA 4JLRA 3IKKA 2WN2A 3H42L 4U1LA 1CU4H 5JPNC 4I18A 5HHOD 1L9OA 3R4RA 4ELMA 4CW1B 4KKBD 4KKQA 4CGTA 1KTJA 3BQUD 5JHDA 2R0ZH 1K3IA 1CIDA 4WK4B 1J10A 3EOBA 4WHYG 5TDNA 3VFOA 5HVHB 4G1MB 5I6LA 1IBDA 2CKBH 4FXGA 3EXJA 3V4VL 2IALB 3C08H 3HI1A 5B21A 4WY7H 1PNDA 4XBGA 3DUUB 3OJDA 4DZBA 4IMLA 3UTTE 3KVQA 1MY5A 4ZMVA 4K7PL 4HU8A 1IBFA 5C0AB 3ZDZF 3DHUA 2VZ3A 4F92B 3I9AA 3NIGE 4MRBA 5GSVA 3UAFA 1OSZB 2F58H 3MODL 5B39B 2ZUQB 5KSAA 4FLOA 5L88H 1GJIA 5E1AA 1OP5H 1QAWA 2IV9A 3B37A 2YAPA 3WE1A 3M6DA 2NY7H 4U0RC 2A83A 3MYJB 4A6YH 4R5TA 1FSKB 3C5XA 3GSUB 3SDDA 1CLOL 4LCIL 1INDH 2E76C 3FT3A 4GW1A 1ET8A 4QRQA 3OMIB 2UUDK 5EMYA 3MGOA 4M1GH 2YMXH 3K81A 3L5XH 3DSFH 5D71L 3QIBB 4EKXA 5K9OA 2Q3ZA 3C5ZA 3BYTA 1B2WL 3IS1X 1NICA 4UQDA 2G5BA 3UZEA 1SGKA 5M7QA 1Z9NA 4ZD3L 3PWPA 4I87A 4ANXA 5I5MA 5EOCJ 3QJOA 1A6UL 3LRGA 4NP9A 4ZS6C 5HHVH 4U3XA 2CLRA 5KSBE 3SDCB 3NJNA 4ATWA 3CDGB 4KMLB 3BXNA 1ZVNA 4NQCD 1YNTB 1T5WB 3HMWL 2FJGB 2NT1A 5IBTL 1J8KA 2C26A 4O9HH 4P5MB 5HI3D 1VPOH 4X6FB 3FTGB 2OSLA 5SV4A 3MRGA 1TZOA 4P8QA 3UMTA 4UIKL 4U6XA 4HJ0D 1AXSA 3WHXB 2P5EA 3PAZA 1RZPA 1G0XA 5T33L 4M29A 3B2DC 4X80L 1XH3A 2EEFA 1UWXK 1RU9L 2R59A 1U8IB 2WWMD 3MNWB 3VWKD 2HT4D 4BH7B 1YPZE 1VIWA 3QDGE 1MWAA 4U31A 3EO0A 1QX1A 1N2RA 4MQTB 5ADPL 1AACA 3QXWA 1MVUA 1TXKA 4JANA 4TQEH 3HRZC 5IHUH 1DJZA 5HGHB 2P5EB 5D7JB 3HHSB 3WXWH 4YE0A 5DRWB 3LKQA 2YRPA 4HFWA 5F6IB 1T83A 2D9CA 2F5AH 3FT0A 4WO0A 3UZVB 4UT7H 4WSKA 2W9EL 3RNQB 3HEIB 2VE6A 5F7NC 3TFKC 3VFUB 2RCSH 2Q9OA 3NQKA 4LOFA 4OW6A 4WKZA 3U0WL 3FUMA 1KY7A 4L8SB 5GSRB 2H1PL 1LEIA 4JDEA 3NRPA 1UWGH 3QJZA 2EH7H 4Y4FC 3ZDYF 4APQB 1U8LB 3B8SA 1OAUL 3WEOA 5JIKA 3L2LA 2AERT 3AGWA 5DU7A 5JHDD 4Y16A 3BFOA 3FU5A 3N41F 2Z31B 2DH3A 1IILE 4M02A 1YMHB 3ARDA 5E6IB 1P7QB 5EZIL 3UO8B 4LVHC 2I07B 2VDLL 4HLZG 3CDYA 4LEEA 2VR8A 3NCEB 4NCDA 1MCWW 4F7PB 2BY2A 2KDGA 4HS6B 3RFRA 2EDRA 3S5ZA 2DYPD 3WOVA 2PO6D 1LGVA 3UC2A 4OLZH 4I3SL 4MXQD 2AXFB 2EIMB 3OR7A 3TT3L 2IH8A 1UM5H 1QNZH 3GSOB 1Z3GH 4N8VB 4YE4H 4YSUA 4OIBA 1OSZA 4WV1C 1CGVA 4G80A 5LAXA 4N8VG 1H19A 1KXHA 3VXRD 4JK0D 3MO1A 4OZFA 3AITA 1GOFA 4XO8A 3ZJAA 4MDJB 3O3EB 1V3JA 4FHKA 1S3RA 4NCC2 2L7UA 2Q7NA 3BD3A 4NZ8A 4X6BB 3D3VD 4FP8L 4QRSB 4UQBA 1E65A 4R7VA 4C58B 1EGJA 3KPRD 4ZXBD 3FN0H 4P5TD 3DIFB 1IGFH 1IC0A 3RTQD 4QJ4B 1BEYL 1GRWA 4L9DA 3NDZE 1CFQA 3C2SA 2IBBA 1RPQA 1TJIL 3ESUF 1WC7A 5EHFA 3QG6A 1RZ7H 1UFGA 1YEKL 4G7RB 1MWAL 5KN5A 4U6YB 1NCWL 1ORSB 1P7BA 4CSPA 3N6YA 3KPMB 4NQCA 2XFXB 4ZAKD 4GP4B 4MHHI 5ALBH 2KERA 5E9DD 4I1NB 1ZHLA 4TRPH 4MXQC 2WB1A 5IMLB 2NXZB 1Q38A 4U3HA 1T6VN 3U7AA 2A1WL 1DSYA 3ZE2E 1EEZB 4RMSA 3VWJB 3SEPA 1AYRA 4QTIH 3UJIL 5CGYD 1GYCA 3PWNB 3BP6A 3KYOB 4CUCA 1DQMH 1XGPA 1WAPA 4Z5RA 5CMAB 1B0GA 2FSDA 4OCSL 2E6PA 4RESB 4LOUD 2WCSA 3STZB 2BVOB 1EO7A 3T8VA 1FFTB 2OW6A 1W72H 3KPSE 1DL7H 1NFDB 3UP6A 2WSDA 4MD0A 1XR8B 2BX5A 4TMPA 3RTQB 3TCLB 1BVNT 3IFPB 3BZ4A 5AZEL 3JWDH 3VQ2C 3VGFA 4TLTA 4NKOB 3LZOA 3NEXA 1UM6H 4N2GA 3HE7B 2G75A 5I26A 4JRYD 5E5RB 4YFDB 5HVWA 4YHZH 4UTBL 3RIAK 2ATPB 4HKXB 1F3DJ 2BNQA 1MWOA 4JFWA 2DLEA 2WO2B 3QJVB 3KJ6L 1L4IA 4NO0B 1XGRB 4HHGA 4PJXB 4Z7VB 5JDSA 5I76A 1BG1A 1PL3A 1RLBA 1HAUA 5J1AA 5EDXA 5HY9A 4Y7MA 1ADQH 1NLBL 1S6NA 3RGVD 1JGEA 5JHLL 1FZKA 2WXKA 2BP8A 2XWJA 3KDMA 4MMZA 5L2KA 1G9EA 3Q43A 3ARYA 5EU4A 1IKOP 5B1JA 2KC0A 4DP5X 1LO2H 3CCHA 4ODVH 2OXGB 1CG9A 2Z64C 3S36X 3VO0A 5EO1A 2Y22A 3JWOL 1ORQA 2EC9U 3G6DL 1LWRA 5SWQA 1HH9A 2DLTA 2QDWA 1MIEH 2JJTA 5TK4A 1A3RH 4R4BB 4DVRH 3G5XA 4Y19B 3HLAB 4JFZL 5GRVK 4PS7A 1EZVX 1N59B 3QUZA 2F9BT 3V5KA 2AGJH 2BJMH 3KXFD 3ROOA 2IPTH 2YUZA 4G5ZL 4PJBF 4YPGA 3Q06A 2YGQA 3MA9H 3MRQB 1BLIA 1CFMA 1YZZA 4OF3A 4ODSH 4UQCA 5DUPH 4ELME 3O3EA 3BLBA 2P3YA 3DRQB 4WDIB 1BAWA 4M5SA 2HKHH 2YGOA 4IJTA 3MV9A 3TL5A 4ZMOA 1DDTA 4FQHB 4B9IA 4P2QD 4JX0A 3RZCC 2HG5B 3GJEA 1JVOA 3BUTA 3NJKA 2DYSB 1E90A 4F8QA 1VFBB 5HHQA 5ITFB 2VKXA 4N28A 2X4SA 2CMRL 3RWFB 4HKZB 3X14B 1NANH 2HKHL 4PSPA 2OJEB 5B3NA 1HDMB 1I9IH 3WTTA 2B1OA 4QHLA 4AC4A 5LLIC 2FL5B 2P52A 2W38A 3AT9A 2DQTL 3RKPA 4GIAA 4Z7UE 2JJWA 4OGYL 1HVXA 2IMNA 2XYBA 4HSQA 2NY6C 4JFDB 5LN8A 2CBOA 3KEHA 3VRIB 1Z9OA 2D7MA 3FHQA 4QAWA 4H8PA 4JGJA 4DGYL 4GUPB 1ZS8A 4JEGB 3I6LE 1ZD6A 5EZPA 1HL5A 3CJJA 1CDHA 3B7UX 1TFHA 3TF7C 1X5MA 5F7EL 5JOFA 3VQMA 1QEXA 3RJOA 3LRLA 4X0KA 5ESQB 4ZMZA 3V4VA 4KO6A 5I1GL 1CICA 4U1KA 1KYFA 1TJIH 3FOMA 4P2YA 2OP4L 2PPAA 3OG4B 5GZOA 3RDJA 1ZRUA 1S5IH 5EUOB 5C6PB 5DC0A 2WVVA 3NJJA 4NDMB 4UT9A 2WBJD 5E5MB 3B9DA 2B1AL 4Y7OC 1CDIA 3S3PA 1JPST 1WJ3A 2X70B 1ZTXL 1A7PL 4LSVL 3HAEA 1AH1A 2Z31C 2PCFA 1GGIL 1OALA 1QKZL 1UZ8B 1NKOA 3EH3B 3FT4B 3OKEA 2DIAA 2ZT9C 3QZMA 2YD9A 3VFMA 5KTEL 3Q7JA 3WUZA 4YXHH 3E9TA 2FX7H 3R06A 3L3JB 1NEPA 4ONFL 2XY2A 3IU4L 4IBTA 3E80A 4I3RL 1YECH 3SPHA 3O6ML 4OCYL 4HT1H 5HHQB 2R1WA 3D05A 3I85A 1WFMA 2D7NA 1AR1C 2F08A 1ZSDB 3WFEH 2UZIL 3DX9A 4LPVA 3FTGA 4YL4A 5I0DA 1J8HD 1KTLB 4JPIB 3T6VA 5DURB 1JF5A 2WVVB 1IVTA 4Z7WA 3CDGA 1PFCA 2D7PA 4HSCX 3GTNA 3HVDA 3II3A 5E6RB 4YSSA 2DLGA 3V6FA 3KH4A 3SO3B 2B2XL 3JVGC 4MJ6B 2OMYA 3TV3L 3WJMA 2ZD0A 4XCNA 1VF5C 1E7VA 3EH5B 4ODWB 5CR8A 4UDUB 1B4LA 2VWEC 3AROA 3U30B 3MJ9A 3N85L 3W39B 2PPDA 3GMQA 2WZPA 4Y4FB 3O4LD 4BFIB 1FNLA 5MENA 4E5XG 3ASWA 3MBEA 4GW1B 2OLDA 3DHMA 5C0BB 3L3OC 4NAJA 4WO4C 5E2UH 4RGND 1Q8MA 2ARJQ 2R1YA 1FQ9C 2AABL 5F1SA 5CXPA 2AQRA 1TKWB 5EU7E 2NYYC 2DQ6A 1TFPA 2BP8B 2XWJB 4J8QA 4MMZB 1VFAB 4XO3A 1JGEB 1DUYA 2J73A 4ISVA 2QKIA 1HQRA 4TL5A 3ARXA 1QR4A 5C2BH 1R3HB 1M3IA 1JCKA 1OF0A 1UOLA 3FO0L 4HD9A 1M05B 5CS7A 5DC9B 3SBQA 3D07A 5KSAD 4I88A 4DK6A 2WQUA 1NEZB 1UWYA 3FTXA 2I32A 3PAYA 3MV8D 1RU9H 4QXTB 3I3DA 4MLSA 3ZSTA 2L7JA 4TXVB 1OTSD 4WI9A 3QORA 4HIEB 1TG8A 3GMRA 1ACCA 3DVGB 4G1EB 2C4FT 3HG1D 4R90L 3TH2T 3BUBA 5EV7A 2J1XA 4FI7A 3ZOAA 1KYDA 1NOLA 4ANWA 1A1OA 2ADFH 4BZ2H 2E7MA 1ROCA 1IQWL 2YSTA 5KUMA 4FEIA 1MI5D 1KLUB 1FG2A 1Y6MR 2R7EA 3VXUE 4NWUH 3S36L 4WI8A 1KN2H 2ADGA 4JKWA 1BIIA 3B34A 1CE6B 2JMRA 4YXHL 4X7TA 1CD8A 1P53A 4JPWL 1FYTE 5E2WL 5FB8B 5FO2A 7PCYA 1ZK5A 3WKQA 3TIEA 4WGWB 1B2WH 5KOMC 3D25A 5ANHA 2FUQA 1NC2A 3UCRA 4N20A 4AYMC 2G9HB 3D69B 3AG3B 3LNFA 4MRCA 4NZFA 5E99L 2HUHA 4GO6B 4R26H 4TTDC 4ZO7A 4PJXA 4X8CA 3KPSB 4FYSA 2ED9A 2LFEA 1F1GA 4WJKB 2VXVL 1YUHB 1JRHL 5JHDE 3STBA 1WC7B 1ZGLB 5DMGD 3FPYA 3FUNA 3HC0A 1RK7A 5CJOL 2W0FA 3MBWA 5C0BD 4D9RD 3ATBA 3TURA 2NY1D 2ZCKH 4L29B 3W2DH 1E0OB 5E7BA 2YFOA 3ARBC 3RTQA 1H5BA 1FVEA 2WP3T 3H53A 3C8DA 1FL5A 4P5RA 3EO1A 5AVYB 4U6TA 3QQ3B 1XH0A 2FAUA 2J88L 2D0FA 1UA7A 4LLYA 2Y5TB 5F89A 3OKLA 3N55A 4N1EA 4N2BA 43C9A 1KPRB 1U3YA 2VH5L 3EDDA 3V7AE 3MKKA 3UTZB 1N7ML 3NH7L 4LNRB 4GMTH 1DQKA 1PDKA 3Q3GA 2B77A 5HGBB 4BSVB 5IROA 3KYOA 2R4SH 4ZAKA 1EXUA 2W81C 4FQ2L 4HUMB 2DWEB 4YHYC 3NSDA 4J3OC 1P6AB 2EE6A 3PHQB 4BGLA 2ZJSH 3CD4A 4P2RD 1NL0L 3ZMEA 2BSED 1N5YL 4D7PA 2A5UA 4JR9H 3GLZA 4L9LA 2Z7UA 2PNDA 4UQ9A 4JZOA 5KSVB 3KBFA 2DMBA 1XL4A 2IGFH 3RPKA 5DJ6A 1SN2A 3S3JA 2IDSA 2FBJL 1JHKH 3NPSB 4TUJA 5GGUA 1EXHA 5IMMA 4U3SB 3MRBA 3U2SB 3Q44A 4BQBA 2IPUG 1TNMA 4KRPC 5CEZE 2IAMD 4XAWL 1C8PA 4JRFA 1BFOA 3SJVA 3UZEC 2ZWKA 3BKCL 3H54A 4IKJA 1OQXA 4MB4A 4YX2L 2ICWI 4XT1C 1CGSH 3FF8A 4OZFH 1L0XA 1X6NA 2DEYX 1A3RL 5F7MC 3RNQA 1NKGA 2VLLA 2OL3B 2X9ZA 2DI9A 1HZKA 5TFSH 2XWDA 4WEBH 5HYJB 5L0QC 1NCTA 4NRXB 4YXLH 2Z93A 2QBWA 1QFOA 5D7LA 3NCJL 3QORD 5DFTA 4AM0Q 1QWNA 4R90H 5HVFB 1AGDA 5A40E 3TBVB 2MOGA 2VZVA 5TF1L 3S0PA 3O11A 3KPRA 3MV9E 1YG9A 3FQUB 4NXKA 4HVBA 2PTTA 3H2PA 1HXYB 1XF5B 2CDGA 1DBAH 3K6FA 5FW8A 3X17A 1YPZA 3QDGA 3G3LA 5HDBF 2X5PA 1FG9C 3DNKA 1KC5H 4LLAA 3F6JA 3RIFF 5D1QD 2VISB 2IAND 2EE9A 4BE5A 2E8ZA 4ODTL 1L5GB 2QGCA 5JLZB 5EDSA 5FKPB 2CUMA 1BJ1J 1L0YA 4XPHH 3UOAB 2B16A 1LTXA 5D4HA 3F5WB 2AEQL 3TBYA 4HOWA 3IBEA 2XWBA 2UZXB 4NKIL 4XHQA 4PVNA 5I19H 5K5YA 4Z7UA 3FN3A 4JFOA 1DL7L 4P2AA 4RX4D 1FNSH 1TT6A 4RA3A 5I1AB 2Y7QB 4NQSA 1SLXA 5I1EL 4S11A 2DIEA 3C5SB 1VB9A 1QQDB 4JM4L 4O51A 2N59A 4BEIA 2DQEH 1XCXA 1T2QL 1G7HA 3K8KA 3KPQB 4QYOB 3CHSA 3G5ZA 3PRZA 1OD7A 1C5BL 2YBGA 1R19A 3UZVA 1K5WA 4EUPA 4A1RA 3BZEB 4JG5A 1JD7A 5I28A 4W6YB 3S97C 1S8DB 2JB5H 1G9MC 4PG2C 5IT2L 1H0DA 2DYPB 3F5WA 3TBYB 1E67A 1XXFC 4NRYB 4ODBD 1AY1H 2OX5B 1WICA 3UPRB 4EI5A 3NK3A 1PX3A 2HJFA 1QFHA 3NCMA 1C12B 1MHCB 2P44B 2A3TA 2EICA 4JQVA 4X98A 3BRFA 5GGQH 1G7JB 4IRSA 1U3HA 1GMEA 4HZLA 5BCAA 5IHBA 3MRKA 1P9MA 3STLB 3QAZB 5AVWB 4YXKH 3RY6C 5DYOB 2NX5B 4FG4A 5I30L 4EIBA 2VXQH 3NIFF 3OX8A 3Q8EA 3A4AA 4XH2A 4GRMA 5JQ6H 3NCJH 3FUJA 1A2YA 1ULVA 5IROD 4CVXB 3BKMH 5JNYA 3UPRA 4OLXH 5AW1B 4KI1A 4PJCB 1LD9A 1S7XB 5J57B 1D7BA 2VAJA 3RIAF 4BXSV 1U8PA 3SE9L 1U95B 3KWVA 4IBUA 3C6LB 2H0JA 2DBLH 4BFOA 4DP1X 3HTLX 5ESAA 1SXSA 2ZUVA 5KTEH 1D7CA 3FHEA 2I9TA 3DX7B 1M7DB 3ARED 2ODHA 1A6WL 3VH8A 1CO1A 2IALA 1SYVB 3HI1B 3OAYH 3FQWA 3LN4A 3UPAA 3UJTH 4EEEA 3VWJD 1EGJL 5EORL 4LIQH 2XY1A 3LKRA 4WUKH 1CWVA 3QQDB 1SYSA 4AJYV 2HMIC 2XXCB 1YEFH 3F84A 1HHJB 2EDOA 2XZQL 1GZPB 4WF7A 2HP4A 4XTRD 3KR3H 3CU1A 2WVSA 3KCPA 3R19A 3BAJA 2X53A 5I17B 3R7RA 4LCVA 5E7FA 5K9KA 4YDKH 3GI9L 3LKNB 2XV0A 1MCRA 1NCJA 5KBDA 2V7HB 3T2LA 3FT3B 5DUJA 1MFBH 5MENE 2RACA 3V5HB 2O5XH 3PWPD 4BFJA 2VJ8A 5FEBA 4YHNA 3BISA 4ZXBB 1RJLB 5IT2H 3CIAA 4Y5VC 2PXYB 5B39A 1J8HA 3CH8A 3KLHC 2MCPL 5C0RH 1FNAA 1NC4A 3PL6B 5FKAB 3D2UB 1MJ7H 3EXLA 4J3XA 3MDJA 4PR5A 2FYVA 4KK9C 2W0PA 3EO1B 3S4SG 4NN7B 5CLTA 5BS0D 1Z2KA 1FNEB 5HHOA 1QRKA 4ES9A 2YR3A 1HCYA 1Z5LA 1N10A 2VW6A 3L3GB 4AYSA 1BFOB 2COVD 3SJVB 5JTWA 1E8YA 1URIA 2CZNA 3BP4B 3KE0A 1EJOH 4TNVF 4GRLB 3BKYH 1H3VA 2GFBB 2XKUA 1DO6A 1U8JB 2AV7B 1BOGA 5CD5D 4LVOC 4MJJA 1DE4B 3O6KL 3LHAA 1CF8L 1S9XB 4N0FB 2DQJH 1TETH 3M8OH 3N1PC 3VXUA 5LVEA 1XGQA 5J13B 1SDYA 2GHWB 5ICYA 1QFUL 1XEDA 2JCCB 4N2FA 1MCBA 1SMAA 4YSAA 1JP5A 1CE6A 2PO6B 4QHUA 1AQMA 1QFUH 3IJSB 5E8EA 2X6CA 3GI8L 4UYPA 3DUSA 1BBDH 3DJTA 4NYLB 3Q3GB 2P24B 5HI5C 2Q76A 1CT8A 3QJHA 3T3PB 2ZG1A 4YGAB 3HMWH 3VFVA 3B9AA 4IDJL 4PGJA 2QSTA 3ZL4H 4L1DA 1RIVH 1OWWA 4ZOBA 4RGNE 1RQ5A 5DK3A 5HYQA 3JT0A 3W56A 2MTPA 4FI6A 4JY4B 4XCEB 1DVFC 1FRGH 2HFEA 2PUQT 2V7NA 4J1UA 3L9RA 4K3GA 4TOYL 3VWKB 4ZUSB 1DFBL 2W0FB 2YRLA 4WWKC 4EZLA 4R7NA 5FDWA 5KG9A 2WB7A 2GBAA 1X5LA 2X88A 2YZ8A 2C9SA 3LPWA 3B1TA 3INOA 4K9EH 4PRIE 1QATA 3ME0A 5D1XE 1ZA3A 4I4WB 1P4LA 5IVXF 3VU1A 3VI4F 3LPOA 3NJIA 4U3CA 5HDQH 4JB9L 5DQJB 5AW6B 5E8NA 3T3PE 4F7TA 1ITCA 5F1KC 3TWCH 3IVKA 5INCA 3RUGF 4DESA 4GT0A 4GKZA 2WMPA 2R2EB 1EBPA 5F88A 4IMKC 3T1FB 5DDHB 1QABA 2ZSWB 2IGTA 1N4XH 2EUXA 1QBAA 2XYCA 1I4FB 2JJTC 3LQMA 3L4TA 3MBED 1KB5B 3IS0X 3MGTA 3KG5A 1IBHA 1PZ3A 1T1ZB 2WBXA 4AG4H 2BOBA 1ONQB 2UWEE 4Y5XB 3F64A 1SDDB 2D3JA 2LABA 4PJCE 3W39A 1X4ZA 1EZVY 2FE0A 3H2QA 1HYSC 1YDPA 1RJCA 2BDNL 2TSAA 5E1IA 3W2DL 2FB4L 3GRWA 3WNJA 3ETTA 4OIIH 2NSMA 4OZGE 4M7LT 3OG6B 3HKFA 4J8RB 4W4OC 1NFIB 2YSSB 1KLFA 2NXZC 1YEKH 3IJHA 3PXJA 4LDEB 3BP5A 4ZOAA 1L0QA 3LKRB 3QAQA 2VXVH 1ICTA 3FHAA 4JFYA 3V0JA 5C0FA 5TQ2H 4N6QA 1EFXD 5C7XL 2L7QA 4P2RB 4RLDA 2J1KA 5HDLA 3NN8A 3FQNA 2YA1A 3VH8B 4JPIA 3LB6C 3FN0L 4H26A 2WQXA 3MRCB 2XWXA 2ED6A 2ORBH 1BQHB 4PJHB 3VG0H 4EVNB 3P40A 3HZKB 5J12B 3B5HA 4PJCF 4R4FH 3MLXH 3QIBD 4NKDB 3WLBB 4OM1L 5KVDE 5D7IA 1WDAA 2IAMB 5TE6L 3IRZA 4OTXL 4KO7A 2IVFC 2ZPKL 3DVFA 1OANA 3KPRE 4FFZA 4N2MA 3MXWL 3SO5A 4G11A 2PCFB 3FT4A 3NJHA 1UZ6E 2O4EA 2OK0H 2E7BA 4Y4FD 5IR1A 1SMDA 3T9WA 4EI0A 3IT8D 4TS6A 5HHXL 5MENB 4NN6C 2J56A 1MHCA 3EOTH 5C08E 1KBWA 4Z8FL 2EO9A 1T66C 3QC6X 5GGQL 3L4VA 4MJ4A 4PJGB 2E7LC 1NGQH 3MV7B 4PG9A 1FFPB 5EFIB 4GIPD 1EZLA 3EHBC 3QRGH 4JHVA 1IIKA 3MJ9H 4AQAB 3WO3B 5C9JB 5I18H 1BYNA 5F9WC 2AANA 5J6GA 4GS7C 4OLWL 1I3GH 4J3UA 2GBTA 1MSPA 3VFPA 5DTFB 3G5ZB 1WBZA 1CYWA 2GBUA 5LBSL 1O9WA 3I9IA 1FAIL 4LGSB 4Z7WB 5KYWA 1F90L 3B5GA 3LHPL 3WTSA 3WFCL 1J11A 4Z76A 3WNLA 3HHMA 5L6YL 2DQTH 3CXFA 3NQIA 2BIMA 5T1JA 1YY9D 4KC3B 4IRJA 2WYZA 1JFQL 2ADJB 2X0VA 4GRWE 2NY5H 4NUMA 2FL5A 1OQOA 4L1BA 2PN5A 4PI0A 4YVNA 2XPGA 3V0VA 4DKTA 4P23A 4PN6A 5HHNA 1ZE3H 2QQLL 2D3VA 1TMQA 2VDRH 1E2ZA 3KPSD 1V10A 4LMQE 5IFJB 2GG1A 5EB9A 5FFLA 5ILTH 3ELAT 4N0RA 4WU7A 4TNWK 4HJ0C 4KHTL 3VRLE 3MBEC 1BD2A 2BO0A 4PJHA 4LSDA 3WE6A 2O30A 5EBLA 1OCZB 2IPKA 5D1ZB 3DETC 3GSNH 5B1CA 3MROB 1GKEA 2FGZA 3MCKA 3FO9A 4HP5A 1M9SA 1DBAL 4EF3A 1O6SB 4JRYE 1ZA6A 2L8AA 3ZVVA 4DZ8A 1GA2A 2CGRH 8CGTA 4KY2A 4HK3J 3D0AA 5CWSB 4RDQG 3ECQA 1JGUL 1OARH 3BZDA 3D52A 1AZNA 2AJYH 5KZCB 2IPTL 3KNBA 4P2OC 2Q3AA 4MD4A 4Q6KA 3UYRL 3FOLA 5A2JH 3NMEA 5FM5M 3LPGA 2X9XA 1QFWI 1MF2H 4GFTB 1BZ9A 1MVYA 4CVUA 2AJXL 1AANA 3LIZA 4Y5VA 3SBWC 4XE5B 3QXTA 1U30A 1VPOL 3CFJB 3N04A 4N9GB 4PJ6A 2EUVA 4TUOB 4JL2A 4UQEA 1FA4A 3EGDB 5MHSE 3HG1B 4YSOA 3CDCA 3OPZL 1T89C 1U3NA 4KGLA 1XBRA 1FYTA 1S9KC 2DH2A 3QIWC 1GS7A 1WV7T 3WO4C 3VRJB 4JKNA 1L9SA 1QBLL 2EDEA 1BZ8A 4TL4A 1A7PH 4LSVH 4LP5A 1DSFL 3W11C 3TYGH 1PBYA 3OQRA 4JPSA 3N3EA 2NNFA 2FBJH 4KDWA 2VDOH 4O02L 2VAAA 5ID1B 5DK0B 5D8JL 3WNIA 3Q2NA 3SCMC 4AEIL 3US0A 1K5NB 3NEEA 1BFSA 2YO3A 1S7QA 5K9JL 1KPUB 1AXTH 5BRZB 1EXUB 2W9DL 3C5ZC 1UKSA 3D34A 4JN1L 1JVLA 5EUKB 5EBWB 2H26A 3QPQC 4F9PC 5AG8A 3VYNA 3CAFA 2DWDB 1PKQB 2F58L 5KVFE 2MQCA 1DVFB 5LXGL 2VDNH 3NH7H 3OKYA 4DGYH 5AUMA 4YC2B 4RH4A 1DQLL 5I0ZA 4KVCH 4KUZH 3QJSB 5KYUA 3NPZB 4JFXA 2NXYB 4OVVA 3DK0A 1CFNB 4RMUA 3LH2L 4BKLA 5CP3A 2R4RL 2IQ9H 3JXAA 3NG5A 4L5FL 2DZEA 2WIIB 5D4JA 5EBWA 1F58L 5B7FA 2R8SL 4LFHD 3NCFB 4PJFE 3CLEH 4D8OA 3TIDB 1L9PA 2JCCE 2X4UB 2NR6C 2V8MA 2K8MA 4F5CA 1H8OA 1A7NL 2ZYHA 4X83A 1JPFA 1PSKL 2FX8L 1RJYB 4GW5B 5DHDA 1IAIH 2P8PA 4KTEL 3DVIA 1J9TA 4H8UA 3WY4A 4XHJD 1UTDA 2CJTA 1D7DA 3CC5A 2VERA 2ZX9A 1V8HA 4JQIA 1R4XA 5CEXB 3HC3H 1LEGA 3QUHA 3K4AA 4PGCB 3E8UL 2YAQA 1DDHA 2VERN 4GNKB 5HYSA 1ZKAA 3SJVE 1EGJH 1TZHB 3H3PL 5B38B 1ZWIB 3X1NA 2XETA 4BKLB 2J8OA 3AAZB 2C9QA 3S36H 1BX2A 3HS0C 2IWFA 2XBTA 3FFOA 1D6VL 3UROR 4CAGA 4W9CC 1Y18B 3L9EA 1QOKA 3BPOC 5AAMA 1ZLWK 5MEOB 3KPTA 1KOAA 3GHBL 1BBDL 3MA7A 4LLMB 4ZQTA 3NTCL 5AW4B 1KNOA 1OGPA 3CZFB 4N86A 5ENWB 1J48A 4KJYB 2GTQA 5LAXB 4ODVL 1YJDC 2ITDA 4PJBA 2UXGA 1X5GA 3V0FA 2CO3A 1YJDH 3UDWC 2R2BB 4U2YA 4TSAL 1JK9B 2I69A 1A47A 4NZTH 5DHYB 3S2AA 1V5JA 5FYLE 1JGLL 1B0RB 3L5JA 1BREA 1S7VB 5C6TH 4UBDC 3G6AB 2VAAB 2BP0A 3VM5A 1CTMA 3OJ2C 5ID1A 2OV0A 4XCYA 5IJVB 1WS8A 1AZUA 2XTJB 1WF5A 4FQPA 4NNYB 4JDTH 5E6IA 1AQKL 4MAYB 1CYXA 2XPGB 3V0VB 1RIHL 3NABL 4M43L 1RUQH 3U4EA 4U6YA 2WNGA 3UO1H 1KELH 2WWKT 4Y16B 3P9LB 3WL9A 1J05A 4NQXA 4PJAA 1YAIA 1I1AC 1XMEB 2EIDA 4G6FD 4QWWD 4YEFA 2J4WL 3WUWB 2WLNA 5DA0B 2PLTA 3LVEA 1ZHKA 4P4KD 2UWEA 3TASA 4Q0XL 3ZZ1A 5E8OB 2HAZA 4X5XA 1OAYL 4V1DD 4QXGL 4LEXH 7PAZA 1KCSH 4JKPL 4FQJL 2Y3AA 1IEBB 4GAYA 4M43H 4N1HB 4V2BA 1U8PB 3GHEL 2D03H 2LV4A 3RDTD 3GPEA 1KIPB 5EFIA 4DVBA 2MHAA 4L37A 3L7FB 2EIEA 4O2EA 1NCIA 4L1TA 4A2HA 5HDRA 2XG4A 4I5BA 4CC1A 1JI1A 4XPFL 5ALBL 2XQBL 2ENPA 4ETQA 1OP4A 1CB4A 1PF3A 2ALWA 3CFQA 3BGMA 3REWA 5I8CB 3FONA 1FNFA 1U8IA 2R56H 5BPPA 1TQWA 3BVXA 3M1BB 4FFYL 4F3FB 1U2YA 3T4YB 1SJHB 5ISZB 1R3KB 2Y5EA 3QZBA 3D12B 4B9YA 2CLVB 4JJ5B 2RR3A 4RMWA 5FYKD 3DHPA 2R1XA 4UIKH 1FGVL 3LOWA 5DHVH 3HZMA 2OMTA 4Z23A 2ICWB 2R23B 1Q72H 3WIHH 3GBML 5EWIL 2P8LA 1DN2A 3U46A 25C8L 1UWEH 1KF9B 2CCWA 3HAEG 5E5MA 5CJ5A 2ZOWA 3WTYA 1WHOA 1XIWA 1HTYA 1KJ3H 1S7SA 4AIOA 3Q8BA 4YIQB 2CLRB 2LVEA 2EDKA 2Z65C 2LW3A 1S78D 4ODHL 4Y1SA 2EVJA 3IJHB 5KYNA 1EXGA 5DWUH 5GRUL 4XN5A 2PTUA 1SXBA 4HKJA 2XWBB 3CK0L 2G5BB 4Z77A 4ABWA 2F68X 1YDPB 3UTSD 3VFRA 1G4RA 4G71B 2AQ3A 4GG6E 4AI7A 1N18A 4X6CB 1PSKH 2BOBB 1X5JA 1ZLUH 1V27A 1WZKA 2X4OA 5C08B 4BH7A 2X6BA 2DQIH 5DZNA 3B7TA 3MLTA 3QUGA 4F57L 5JOPE 3MYJA 1T7XA 3BAYA 15C8H 3CVHL 4QNPF 5IESH 2IAMA 3KPRB 5CR1A 1DJSA 2DIJA 1IJNA 4JO2L 2Q8AH 1WAEA 2VXUH 1GS8A 3MVSA 5KSBB 1XB8A 3MLRL 4LRIC 2WCPA 3KS0J 5IY5B 5J5EA 4A04A 4LLDA 4D0BA 1HHGB 1VFBA 3AQYA 2AJSL 3IBOA 4IIQC 5HDWA 2UUDH 4H1LA 3O8XB 5EN2A 1MHPH 3BEVB 3WY3A 4FQHA 4F2FA 2EYTB 1FVCA 4OVUA 4O2CA 4R7NB 3O41B 4JHUA 2B5IB 2VDLB 1LVEA 4BFKA 5CJOH 4ZMXA 3GFUA 1KELL 4M03A 1NKRA 1EUUA 2FT8A 3BDYH 4TQEL 5IWLC 1JWSB 4KQ3L 1A66A 3SCMD 3A21A 3MRDA 2XVKA 2FEDC 2VMEA 1CFVH 1UB5A 5AAWC 4I18B 1B88A 2HWZL 3B9KB 3W11D 2B59B 2XICA 3DTUB 3LXAA 5IW1B 2P24A 2ZCHL 3O6FD 2VN7A 5CEZD 3GSWA 3MCG1 4GAJH 2B15A 4AGNA 1F42A 5DA4A 4C4BA 4EUPG 2Q7AA 3QEGL 1BCIA 1I4FA 3NCYS 1CVRA 1RZGA 2CRYA 3MFFA 1A21A 4R9HA 1Y1UA 1IQDB 4LRIA 1NINA 4TTDD 4MNGB 3FRPA 5DLLA 1KENH 4R7DA 1MCWM 5GSVB 9CGTA 2GI7A 2MTAA 2MOQA 1HEHC 5AKSA 2RGSA 1QUNB 1RZJL 3ETBJ 4YDNA 1AKJB 3ZDXB 4WW2A 5AG9A 4R97C 4DZBB 3C6SA 4EN3D 2DICA 3KVPA 2JH2A 1JPSH 3ESMA 2ADIB 4FABH 1I85A 4AT6B 2VT0A 2X42A 3I6KA 4OUOA 3BVNB 1X6LA 5LQBH 3ASOB 1P2CB 1EHKB 1YPZF 1HNYA 2KHAA 1EZSA 2WIIA 4LDLB 5ITBL 4H5SA 4EN2A 1ZLSL 4L29A 4FXGC 1PLGH 3BZ4B 1CFNA 1A4CA 1M71A 3BPOB 2E46A 3E6HA 3IETA 2E7HA 5KYUB 5HHOB 2EDJA 4JHAL 3QZOA 2WLHA 4M5TA 4LXFA 5T1MA 4LL9A 3ARWA 4ELDA 2FWOB 3EDFA 3D87B 1MCIA 4FNLH 3GPSA 3WY2A 1L6ZA 4ZW8A 1BVKB 2J7LA 3QR0A 2XVLA 4LP8A 1QTPA 2OXHB 2DV6A 1S4IA 4X5RA 4KAQL 4M62H 1NBYA 4KY1L 2BP5M 3POHA 5JMRA 1G9MH 3Q8AA 3MFFB 2PR4L 4GQ9H 4XX1E 5EH1A 2MJWA 3VXUB 1OAKL 4BE6A 2EE3A 3GSWB 1HINL 3UDWA 4GP5B 3ULSA 5MHSD 1B9ZA 3QDAA 2W80C 1PZSA 2NDGA 3I74A 1NPNA 1XF3A 1YCSA 4MSWA 4Y4KA 4OZGA 4GQQA 4PW3A 1AQDA 4HOZA 3SYPA 1T22B 3EHBD 1AQ8A 4AMKL 1X4XA 2ZXBA 3VXOA 4HIIA 4HUXA 4BD4A 1AXTL 3K6OA 1A02N 3F7QA 4HOXA 4HGMA 2OA9A 2R0WL 2X4TB 4LSUH 3T2QA 3CX2A 4QLWA 3DIFA 2E56A 3Q48A 1IC7L 4TLSA 1BZ7A 3BGAA 4O2CB 1VFMA 3FQWB 3LN4B 3DMMC 3IWVA 5DUMH 2FNWA 3GBLA 4HPYL 4MAYD 4G43A 2G2RB 4R8WH 4JG1H 5CUSH 3FU0A 3ZE0F 5I75B 3L95A 32C2B 4HS3A 1BMGA 1I1CA 1NCNA 3IAQA 4EO5A 1PZ2A 4BWTA 1A0QL 3RL2B 1P6FA 5D7IE 3U1QA 1NOAA 1LMIA 1MEXH 4ADIA 4DZ8B 2NNCA 4WENB 5E94A 1MHEB 3TU6A 3VU2A 1CXLA 2GSGB 3WTWA 1N19A 3OPZH 3CVCA 1HHHA 3FSVA 1JHLH 4HK0A 4Y2NA 5AVVB 2VLRD 2ZUQC 5ESVB 4ZXBA 3CXDL 1TVDA 4PJ9A 3H6AA 4PJEE 2CO6B 4G6FB 5DSCA 1WIUA 2NX5A 5SWSE 5TQ0L 1I7UB 2ZUSA 3V0AC 1VZGA 2FD6H 5C08A 4IRSB 4X6CA 1PW3A 4JHBA 4OLVL 5MERB 3TO4B 3ZQWA 1NBZB 3GIZH 4UQ2A 2VN6A 3ARDB 4XMLH 3EJRA 1WISA 5DS8B 1N8OE 2EDWA 1I9JL 3NZHH 1R1CA 1PQZB 3TBWB 4CC4A 1LILA 1TO4A 3UERA 1Y1DA 5F7EH 5F9JB 3Q6FA 2X3CA 3VYPA 4JVWA 2K70A 1CICC 2C9RA 3GZKA 4LPTA 4NXSA 3G6JB 4DNLA 3ZDXF 1RXLA 4P5SA 5M95B 4Y9FA 3DIVA 1QFWH 2GJZA 3BH9B 43CAA 5T3XE 2ICCA 1IIIA 1JZ6A 1KTLA 2VQTA 3Q6GH 1E43A 4OGYH 3UBXB 5B7MA 5E6SB 3IN2A 2X3BA 4ZYKA 4EXPX 5J6GB 3K2MC 1MNNA 2BOLA 3ZYJA 3CFCH 5D1ZD 3TBWA 3HHSA 5K1NA 2NTFB 4WAFA 4NPYB 5FFGA 3P3SA 4X8XA 1YQ2A 5D72H 1U0QA 5I24A 4AH2A 1XT5A 2YQ2A 4HU2A 3KMDA 4PS8A 1IL1A 2YAFA 1BD2E 2GTZA 1N9PA 5GS3A 1KBGH 2JV6A 4UINH 2NY6D 3T0BA 2AK4D 2YD7A 4AOFA 3K0WA 1Y6NR 3QWOA 1ZPLA 2V2TA 1HIML 2B20A 1JV5B 3CSYA 1NCBH 3LKPA 4XO9A 3QCUL 3DOSB 2CNZA 4XNAA 4K7PX 4JRYA 2J43A 4XGZA 2A9MH 1I3GL 4IIQB 3FFDB 2WY3B 4IK6A 4PB9H 4LIQE 4NJ9L 1J18A 2NTFA 1KIPA 5DYFA 5LQBL 5EIIG 4KROC 3T4AC 5KBLA 1ADQA 1OK0A 1MREL 4JO3L 5C0AD 1SRDA 3OHMB 1IGML 3L1GA 3NIDB 5GS2D 3WN5C 3RE0A 3F7LA 2DTML 3NRQA 4QYOA 3T6WA 4JFZH 5HYJD 1FP5A 3OKMA 1KENL 4I0PB 1YECL 2FO4B 3O4OB 4Z9KB 4YO0A 5INDA 1OAQL 2CIKB 4B5EA 3WUWA 3A23A 4J8RA 1R0AH 4BRVA 2XPYA 1P7HL 2XWRA 1SXNA 2EIZA 2ZG2A 2KI6A 3N44F 2WKOF 3NAAL 3U4EB 2V5SA 1GGIH 3VXSA 1TTGA 2OJEA 5IUCA 1MW1A 2ZE0A 2O5ZH 4UOJA 1GGBL 2A0LD 2ZKWA 3IAPA 5DVKA 1KB5A 3MGTB 4NLAA 3EZJB 2WXQA 5AOLA 5E51A 4KDTC 4ORZC 4L4TD 4Z1PA 2XN9B 2OMZA 1JDCA 2XKSA 2ZOKB 4IHOA 2B9BA 5LO7A 2CDEB 5HDBB 2HTLC 4H8WC 4QLRA 1DVQA 2P28B 2FO8A 4OT1L 4XNUH 2MCMA 3BPCB 3D4CA 3LDBC 8FABB 4YFEA 2Y1VA 3CFBB 3X3GH 4UU9A 1MQKL 4HLEA 1LP9F 4ECNA 1F4XL 4POZC 1CF1A 4LB8A 1P4LB 5I16A 1F00I 2FLBT 5GIRA 4M7JH 5F9OL 3MRFB 5I15L 4OLYL 4XE0A 3K5SA 4RGOH 4LPCA 1R33A 4Z3GA 5FDWB 2NZ9D 4WNJA 3AFLA 1OPGH 4WI2A 3EOBB 2VLJB 3LZNA 3DV6A 4M1CD 5B39G 1NBCA 3ECWA 3MBWB 4FG0A 4JGUA 5LGYA 2A1WH 1DVYA 2MRYA 3QQXA 4K8RL 1OGTA 3M17B 3RB5A 5GZOC 1V7MH 3BH4A 2QMKA 3FUFA 3GXPA 4V1DA 5KBPA 2YN5A 5FUCC 3GKZA 2QLYA 5D1ZI 4I89A 3ZL2A 1CU4L 3FTUA 5JDJA 2C9XA 1F97A 3WDJA 5IQMA 1WZ1L 1U8NB 1J87A 5A2BA 5CZRA 4TF4A 4DGIL 1FN4B 5DI8B 3SPGA 5CGYC 3S5LG 4MA7H 4OJAA 4LPXA 4LCCA 2OTWA 1FRGL 4F9PA 1IVLA 1ESOA 4PJGF 2BZ7A 2WLIB 1R5WB 4FMVA 4R5VA 3ZTCC 4YUEH 2EIBA 2E9GA 5F97E 1KB5H 2YPKB 3GSRA 2JKWA 1UT1A 1Z6JT 5DD5L 4LNRA 3AREC 5CSZA 3S96A 1DBJH 5DQDL 5KVGL 3D39E 2VL5A 2WLJA 5IQ9B 2UX6A 4GY4A 5GJTL 1HILA 4DGIH 1UCBL 3OZLA 3CPUA 1WZ1H 3C5ZD 3LV3B 4WNQA 3HPJB 3UTTB 1FL5B 2EH8L 3AWEA 3QUXA 4H8QA 4XVTL 3NA4A 3BP4A 4CNIB 1DVFA 4P4KA 3G6DH 3H55A 4RMTA 3O3UN 4XP6H 2D4DA 1IFHH 2IWEA 5G4OA 2J8UF 5H37G 5TDPA 3GIZL 4YBQD 1H6UA 2EZ0D 2WTRB 1ADQL 4YDLB 1PKOA 1XIWD 4LSTH 1Q9WA 2MNWA 3ULUH 1TJGH 2YWYA 3IFNH 1QWUA 3GM0A 2BH0A 1K5NA 1NPUA 2EKSB 1XDQA 4FL4B 1HHGA 3ZT6A 3KH3A 2YS4A 4JN2B 4DOHE 3D69A 1YVLA 3E2HB 3V4PB 4M9PA 4S1DD 3IDYC 4E68A 3AQXA 3LEXA 2ZP8A 2AQ1A 3SE8L 4JZNA 4J28A 3QE5A 2CR3A 1TKWA 5DD1H 5C07D 3I2CH 2WXPA 4DPBX 1J12A 1CBVL 3M88A 3V5HA 4XXWA 4A7SA 1CD0A 3QG6B 2JB6A 4WW1A 4QXGH 3VXSD 3HZYA 1F4HA 2OJ1A 5EZOL 5IVXE 3GC3A 3VE0A 5HXMA 1A8JH 4FHBD 2TRYA 3BPNC 3WNMA 3D18B 4JPQA 3DARA 4DEPC 5IB2A 2FJFB 4DUWA 2APVA 3EYSL 1AO7D 1T1XB 3FOLB 3VX1A 3BVUA 2DAVA 4PJ8B 4WU5B 1EH9A 3A4DA 5T3ZL 1CTOA 4N68A 5IP4A 1KIUB 2NY3C 4GIOA 4ODTH 2Y9RT 3K6SB 3TA4D 3ARGC 3CTTA 4FRWA 3REVB 1ZT1A 4NRZB 5F2FA 2VLRB 2Z7YA 3OR7B 3QJUB 4R0LC 5G5DA 2AC0A 3KPPA 2O1AA 1C7SA 1F3RB 1QACA 1ZSDA 1KIRA 2VLME 2Z4QB 4UV4H 3VSTA 2X2UA 4DSYA 2R23A 1KEGL 4P2QB 3MRPB 3BKJH 1QRNA 2JKLA 3CDFA 4BWWA 4P3CH 4RAHA 4QGTA 1IC4L 1VFAA 3SIKA 2ZAIA 4HJEA 1WFUA 1YMHA 4K71B 1H8NA 3NIDF 1MHHB 4WEBL 1G1OA 3OX8B 3MRJB 3NA9H 5M94B 2ZX6A 4WRLA 4XVUD 1CDCA 1KGUA 4KJPD 4PP1D 3IJEA 2X4OB 3P1VA 1G7JA 5IBTH 2Q86B 4AQZA 1ZTMA 3ZKQD 1D5XA 2GUYA 2VO5A 2GTWA 3OB0K 3OKNB 5CKAA 3FAXA 1NIFA 2MSPA 5KYWB 1JGDB 1PLGL 1G9NH 3S5YA 1MCDA 2V2WB 4H88H 2EXSA 4KMQA 2VE6B 1G5AA 3VFUA 5GRJH 4X9IA 1M1XA 4MJ2A 5FYKL 1EJFA 4AW7A 5JIIA 3EJZC 1LK2A 2VMJA 4LF3B 3TT1H 3QHTC 4M1GL 4GG6A 1AHWA 3RGVB 3TP4A 1KWGA 4FD0A 5HDOA 4XNDA 1I9EA 2AXJA 2K6ZA 2XPZA 3FNKA 3T0XA 4J3OD 1RZFL 1K72A 4RFOH 5HP5A 1HKFA 5DJ8B 2BSTB 3HZMB 1SJEB 4NHCL 1OP3H 3MRNB 4Z7AA 2KQMA 3KL0A 1HHIB 3O6FA 4MD5B 4CDGC 3LRSA 2JJUA 1S46A 2VDPH 3HAEH 4Y4HB 1IC5H 1OXYA 1SLWA 5E1HB 3ESPA 1KJMB 3OAZK 4BQ8A 4ENED 2BP0B 3K8MA 1FZMB 1N8ZA 3OZKA 3QHFH 2P7TA 2GJPA 3WSQH 5IQ7H 2NXZD 4JNXA 3PFQA 4G6JH 3IDIA 1ZT4B 4N0YL 1C16B 1UATA 3CN3A 1SOKA 3EFFA 5H8DA 5IM7A 4Z78B 3H4FA 4PU2A 5BS0B 1RD6A 2P43B 4P2RA 1TR7A 3BWAA 3IYLW 2X3AA 1OSYA 4KROB 5DMGC 4QEGA 5AZ2H 5IMKA 1HYSD 1IBZA 3FOMB 4B97A 3S35X 1E4WL 2FQGA 3WJLA 4CMMB 4HG4K 5FECA 4YC2C 2OMUA 3S3CB 1UURA 1QLEH 4U2ZA 1X7SA 2AV1A 1Z32X 5A7EA 3A4EA 5DFAA 3W5NA 4HEPA 4PY8J 4BCZA 4G6JL 1AQHA 3ROOB 4DGVL 3V5KB 4YHOH 5F1OB 4QHNB 2XZZA 4LRNH 5B22A 4WSGA 3E3QE 4U33A 3L1OL 4TUUA 4OCMC 3RFZA 3QDME 4PUBL 3INUL 1A7RH 4M7ZB 3Q1SL 1D5MA 4NHCH 3DWTA 3VDAA 4ALAC 5DDHA 3RWIA 1NCOA 3T0EA 1PX4A 4MAYA 1U3HC 1YMMD 3GDCA 2NSQA 2BOCA 3D1MC 4YBLB 1IT9L 4C55A 2VDMB 3T4AA 3D2UD 5T3XD 1GHFL 4KMTL 4Y9CA 5ADOL 4TSBL 4Y8DC 4ZSOB 1I1AD 3GHPA 2P8PB 2A77L 2WTOA 4LASL 3QEQA 3WLWD 3T2OA 5E5UB 2CM6A 4OD1H 4CRPA 1FZJA 2VR5A 4GMSL 3WCYA 4PV9B 1MG3C 3DX8A 3TIDA 4FQLH 1BGXH 4HQQH 2CHDA 1EEYA 2A6DA 2CBPA 3FB5B 3PP3K 1JZHA 3QWNA 4WW2F 3NFNA 5LGJB 4KAQH 4LLYB 2AZUA 2F2HA 4NO5B 1T1XA 3MA7B 5F7YC 3SYAA 1J9RA 2GJRA 4G72B 5B4MD 4U1IB 4ZK8A 5DZJA 1I85C 4YN3A 1LO3H 1T04B 3PDDA 4YSTA 1CLOH 4LCIH 1GGCL 3CHXA 1N59A 2D4FA 2JIXD 4OQTA 2F54B 4Z7OF 5C8JB 4WV1B 4N2IA 4U1GC 3EJYD 2YC1B 3CSBA 4J4PA 3BSZH