2BIHA

Crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
453
structure length
453
Chain Sequence
PFPVRQDSPLTEVLPTDLKTKDNFVARDPDLLRLTGSHPFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
total genus 137
structure length 453
sequence length 453
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bihA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2bihA01
3R19A 1XDQA 2CA3A 2C9XA 4PW9A 2BIHA 2CA4A 3HBQA 2XTSA 3HBGA 4PW3A 2A9BA 2A99A 2A9CA 3HBPA 1SOXA 2BIIA 2BPBA 2BLFA 2A9DA 1OGPA 3R18A 3HC2A 2A9AA 1XDYA
chains in the Genus database with same CATH superfamily
2TSAA 4C57C 4BH8B 3Q01A 3FCGA 2E75C 2DQIH 3N50A 4G6KH 2GJPA 4TLSA 1BFOB 2J6EA 1S9YB 2ODIA 1XF1A 2Z91A 4K71B 3JV4A 3F7LA 2NY7L 4V1DB 3RWGB 3L4CA 1TJIL 4ZXBD 3T65A 1DEDA 3IVKA 1F13A 1Y07A 5IB1B 2DQJH 3GLAA 3PWUB 4FEMA 4JRXD 5FPIA 1I3RA 3E6HA 2VDNH 5HYJA 3V79C 4L4VB 5C0AD 5DZOA 2V5TA 4HIPA 4ZPVB 1U8PB 2UY6B 1AGEB 4MJ4A 4ZW6A 1XAUA 1N64H 4BWUA 1KB5A 5ADPH 2F2HA 2EINB 2AAVA 3MBWB 2DLEA 3L3DB 5GRVK 2ZUYA 1KPVA 3JUYA 4TULL 5DD6B 4Y1AE 3ARGC 3UAJC 4YEFA 1T80A 3NSFA 1VZGA 3QWNA 2HVBA 1RHFA 2NT0A 3GNML 3Q2NA 3QUYA 1JN6B 1OD7A 2BOLA 2BSBA 2FNWA 3VVWA 1T1ZA 1G4RA 1X4XA 1Y0LA 4NFDA 3VGEA 1HZLA 2ILLA 1KMGA 1URZA 4FQQB 4BCYA 4NKIH 5FM5O 1C5BL 1QTPA 1AI1H 2X6CA 3ARGB 2IXQA 2QGEA 1MKFA 2AXGB 1SF3A 1RY7B 5BRZE 2ZXCA 2BDNL 3WDJA 2QL1A 1DVQA 4RRPA 3ZDYB 3T3MB 3O2VL 1F3JA 1MUJA 1T4KA 2BSSB 3ILPA 1CDHA 5DRWA 4QTIL 1N3NB 2BMKB 5KJ4A 5AOMA 3SDCB 3ZYZA 4ENEC 5ICYA 4NO3B 4YL9A 1KLUA 4J3WA 5TF1H 3S37H 4M6AA 1A7QH 3I6KB 3WKML 1DSWA 1KTKE 1MHCB 1E5YA 4Z7OF 2ENJA 2WTRB 5KSVA 3QUZD 2NUTA 4D9RE 3MCYA 1NLBH 1OPGL 1XF5B 3QNZB 4MJ2A 5IB2A 1KT2A 2JI2A 4PBXA 4N1EA 2NZIA 1CI5A 1BAFH 1N26A 1VCBC 3IPBA 5IZ7A 5CGTA 4XNAA 1DBJH 1U3HC 1Z5HA 1YEFH 3CLWA 2IFGA 4L05A 1EZSA 1UD2A 3I84A 4HX1B 4YO0B 3HN8A 1TNNA 4N90E 3MJGX 5H4YA 3B9DA 5I82A 5GGVL 3OX8A 3C6LD 4QXTA 3X1EA 5IB3A 4Y7MA 2K9UA 5T5FL 1E0OB 1JRHI 4UV7L 2EDNA 5GRWA 1M3JA 1S5IL 5FO7B 5E2VL 1TIUA 1G7PB 1SQMA 1NC4D 5JW5B 1SHXA 3JT0A 5E9NA 1TZIB 4X5XB 4P23C 4XB8A 1A3QA 2JMRA 1U8NB 1DCLA 5AALA 2O61A 1HL4A 4PJBB 3V7AG 1EH9A 1NQBA 2X4OB 4F2ME 4XNUH 5GJTL 2FWUA 3LMJH 2NY3D 2VZVA 3O2DH 3O8XD 2AEOA 4XPHH 4ZUUA 1GC1L 1HU8A 4YFDB 4HJJH 1OAJA 1KGCE 5DJZB 3UTTE 4I0KA 1OZUA 2O6EA 4CNIA 4Y8DC 3DRTA 1TYEB 4PREA 2RD0A 3RFZC 3LS4H 1OP3H 1TLKA 4HK0B 4TLTA 4ADIA 4Z95H 1MW2A 5DRNB 3A6CH 1UKQA 3T2NH 4JFOB 4LZKA 4AGLA 2CD0A 1J1XL 3MTXA 3SY0A 1RXLA 1MHPH 1RU9L 3PWPB 2FL5A 4NWUL 4LLQA 1PG7L 3F05A 4HFWA 1OWRM 3QQ4A 3H7LA 3ARDB 1UM6L 4L0YA 2QVIA 3OB0K 2XTLA 4G7RB 4ZNEA 3WS6C 4U6VL 5KBPA 1OB1B 1OAKH 1RUML 4X99A 3QIBA 1N10A 5JIQA 2BP8B 3HFMH 2AK4D 3GSNA 3GMOA 4KY2A 2XRAL 3QULA 2IBGA 3AITA 3TASA 3KPSA 5HHOD 5C2BH 4XVSH 5EU6E 3MRIA 4KAQL 1G43A 1WA1X 4HWEH 2X4TA 3PIQA 4X5RA 2C9UA 4TTGA 2E8YA 4HHWA 3ESPA 1GXEA 3CHSA 4J4PC 2OW7A 4LLUA 1IE4A 4YQXH 4ZUSB 2A83A 4LGPB 2BP0B 4YHML 5HYSB 2WXLA 2FX9H 1GH7A 4KI5F 5ITBH 5T33H 4YX2H 2WOBA 3K8MA 4G6AC 4ODVH 3T0WA 1KIUB 4PJIE 3BZ5A 4J6RH 4K2UL 2L04A 2Q87A 1WH0A 3SKOB 1DVZA 3MUUA 4WY7L 4YBLB 4MJID 1QQDB 4JG1L 1PNCA 4Y89A 5E1HB 4JQXC 1BYPA 4G9FE 4PJHA 1H3VA 2G9HA 1U8KA 3L3JB 1FJ1B 4FFZH 4WJ5B 4XVTH 2F54D 5IKCB 3RPIA 4PBWD 3B8SA 1O5PA 1XD0A 4JPIB 4ZFGH 5KSAD 3NIDF 3JWDC 3L1FA 2A4ZA 2UY7B 4GSQA 5HJ3A 4IRSC 5CILL 2XPYA 1UCBH 5JMOC 2JLPA 2IBZY 5MP6L 3HRZB 4GS7B 4QHLB 3AWGA 3NQIA 1BAGA 4L5FE 5ETUB 5I8KL 3PGCA 3JSSA 3EJTA 3FSZA 2L4OA 1PZAA 3MBXH 1JDAA 5I9QB 4Z7WF 3W2DL 5C09B 5C0ND 2I60H 5CBAB 3VFPB 2JJSC 4EJ1C 3WIFA 3KEHA 3TP4A 4J3BA 4WUUB 3VD4A 3DRQB 2AHIA 4OW6A 3ILDA 1S8DB 4NKDA 3ZDWA 4ZMPA 2FAUA 4WSGA 4ORZC 4BSJA 3C8KA 2YN5A 3QXDA 4WTXA 5MI0C 4E41D 2FLMA 3CDGB 3E38A 3N43B 4KKNA 4E9WA 3HMWH 3IRZA 4MD4B 5F6IB 4J3OG 3QXUA 1U92A 3QO0B 1SEQH 2FYYB 2VITA 4XP4L 3VXMA 1QX1A 4L3ED 5DVMA 1CG9B 2M83A 2BH0A 4OZHF 4EPSA 3ZKXB 4ZFOB 1J8RA 4HXAH 1ZEAL 4GP4B 3QQ9D 4OCWH 2DTMH 4F7CB 2AI0L 1U8QA 1IM3A 3NIFF 4AKPA 1A7RH 3KGSA 4Y19D 4MAUL 3FOMA 2MQ3A 3V0VB 5IV2A 2IAND 4RMVA 3PHQA 4UYQA 4XXDA 3PP4L 4GG6A 2KLSA 1NC2B 2HXAA 3GSVB 1K6QH 3R1GH 4P04A 5IVZA 1K72A 4PYGA 3T0VA 1QSEA 2Q3XA 4OIBA 4OLUL 4CADA 4K23H 5JQ6L 4AL8L 3OZKA 2RAMA 2X70B 1JV2A 1X5AA 4ELMF 1W6LA 2EKJA 3NDYE 4MNQE 4P9ML 5FYLD 2Y72A 2AV1B 5FHBL 3K3QA 1GKOA 1BYOA 4FKHA 2ZSWA 3PJSA 1OCZB 3IU4L 3S5LA 1ACCA 4FULA 2ZXEB 3V5DB 2AJXH 1S7XA 2AJVH 2VLJA 4HC1L 4KKLC 5FKPB 1X5LA 1QLFB 3L5JA 4L9LC 2A9AA 3FB5B 4M7KL 4WHYG 5IOPA 4JFFB 4ZMQA 2EIZA 1R24B 4Y88A 2VLKB 2D31A 1EEQA 5F3BA 3C5XA 3DO7A 1KACB 4QY8A 4NEHB 5C0BB 1E43A 2FECI 1I31A 4UQ2A 5I1DB 2CU9A 1JDCA 3DV6A 4NJ9L 5F7LB 2OZ4H 3G6JE 3CPLB 5DDHA 3BGMA 1OTTD 2L0DA 4I8DA 2A4EA 1E28B 3K80A 4LLDB 3PP3K 5D7JD 1SXZA 3DA0A 4ZUVA 3S3DB 4ZO6A 1I8MB 2IG2L 5I0XA 1TFHA 2YGVA 4I0PC 3IWVA 3CVBA 4TUOA 1NCBH 4EO5A 3N06B 4RX4A 2H3NA 3RDTC 5CEZH 4NKOA 3MRQB 3BWUC 2EEBA 3QAZB 4WW2B 5F70A 2OJEB 3LKSA 2N1KA 5JHMA 4WI8A 3ZKMC 4ZS6D 1AIFB 2Y1YA 3FQNB 2DQTH 2JKLA 4WSKA 4BH8A 2JE8A 4HPOL 4PCTA 3ZSTA 3UCRA 4XC3H 4EIBA 4P2RB 4PBVC 2FE0A 1BFOA 1S9YA 4NPJA 1CD0A 5T5FA 1R4XA 4F58L 4PV9B 4Y1AB 4F7MB 4V1DA 3RWGA 3TPKA 1KDJA 4DPBX 1AAJA 2XV2A 4UTAL 2WO3B 5HHMD 3VWJB 2DD8L 3I6LE 1H5BB 3UABA 5LQBL 1I85C 5IB1A 2X0UA 3PWUA 4I0CC 1R3IH 5EOTB 1XDYA 4L4VA 2VC2L 3EJYC 3ZT5A 3HI5L 1CLCA 4UAOC 5K9QG 3Q06A 5BRZB 2UY6A 5HI3C 1AGEA 4CVUA 1VADB 4AIZA 3PE9A 5HYIA 1EWHA 4B7LA 3RGVC 3O81A 1NGPH 2RCSL 3K2MC 3MBWA 3IFPB 3IGLA 3GZPA 5AYUH 5T5NG 5DD6A 2YHGA 4U7MA 4P99A 1XZ0B 1ET5A 4DK5A 2O93L 5EUKB 3VRLF 1OGSA 5CN1A 1JN6A 1U8MB 1CLVA 2CGRH 4A67A 4OR1A 4QRPA 5K59E 2QADD 5H8DA 4FQQA 3OAYH 1MRDL 4B60A 1UWEH 2OP4H 4Y9GA 1L9MA 3JVGA 4FQ2L 1EZUA 3NEXA 3VFRB 1G7HB 2A9ML 3X12B 3HC0B 2AVGA 2PCPB 2DL9A 5I8OH 3FH8A 3D6GA 4JHAH 4Q9RL 1QUPA 3SDCA 1N3NA 1NIBA 2BMKA 3P2TA 2QZQA 5I6LA 2GK0B 4Q56A 2B39A 4NO3A 3VFSB 2VXUH 3IGFA 4KHXL 4YHLH 3QI9B 5BZWA 3TN0D 5D8JH 3VWKB 4ODTL 4M3JA 3I6KA 3CAFA 4FNLL 3WFDH 4APQC 4IBWA 1E9OB 1LK3L 2WTRA 4UTBH 1BD2E 3ZDZE 1W80A 1K8IB 2J7LA 1CXLA 2AJ3B 3QNZA 3BXNB 4XVUD 3ENEA 4FLHA 5DC9B 4F2MB 2KHAA 5FO2A 4LLMB 5CINL 5I6KA 1QFPA 4NENB 1B90A 1XIWC 1AOZA 4APQB 2DICA 4L4TB 1IX2A 4HX1A 4YO0A 4OBSA 1G4MA 3UTTB 8PAZA 2Z4QA 2WVTA 4F15C 1K3ZA 2D2CC 2VCOA 5I1GL 1G7PA 4N2CA 3T4AC 3TONA 5JW5A 5BUPA 2Y1VA 4NM8H 3G5YA 4N2EA 4PTTB 4X5XA 1HSBB 1U8NA 1ZS2A 3EJJX 5DEFB 1P7HL 1CWVA 1WEJL 5LGJA 2X4OA 2P28B 2CHNA 2FATL 3B9AA 3CBKB 4PUBH 1D7CA 3FT3B 5ANME 1JXKA 2PR9A 5FO8B 1B2WH 4H13C 2XXFA 1RJZA 1NCDL 3QZPA 2W0FA 3T4YB 5DJZA 1A6VH 4ZX3A 3ROOB 4HZAA 2GTZB 4LCUB 4XBPB 3TJPA 4GO6B 4XWGL 4HK0A 3MLPA 2KUTA 1TJHL 2X87A 4FQLH 5CJXC 5DRNA 2D03L 4JFOA 1AXTL 5B39B 1HYSD 3KR3L 5EU6B 1AHWC 1VF5C 3B37A 3KHOA 5CS7A 1P9MC 4HDIB 1AS7A 3KYNB 2IJ0C 4U2YA 4LVOB 2AEIT 3SKMB 5ESQB 1F42A 3F04A 3GXDA 3Q0HA 2A6JB 3QHFH 3ZX1A 2AGJL 1OB1A 3D39D 4PRIE 1XR8A 3BP4B 2BP8A 1NM4A 2MNWA 5CIPA 3BEWB 2J20A 3HAEH 1A8JH 5JHDE 3N44B 3KYKH 4PJIB 2YWYA 1UB5B 2Z9TA 1PD1A 1XH2A 2OMBA 2AEQH 4QJ5B 1DBKL 3Q43A 4G9FB 1IILE 5GZNA 1HILB 4IHOB 2EYSA 2LU3A 1TZ8A 4XGZB 4PJHF 12E8L 3RWDB 2E76C 4ZUSA 1O6SB 1KG0B 5HYSA 3IDYB 5INDA 2EIBA 5I0WA 3SYQA 3VXSE 1BWMA 1BJ8A 4OVUA 2D7TL 4WWPA 3B6SA 3R0MA 5EUOE 2OYPA 3VU1A 1KIUA 4DIXA 4TLUA 1VPOL 3SGEH 2LABA 4LRNH 3SKOA 1QP1A 1QQDA 4OZ4B 5I0VA 3ALXA 1GS6X 4WJ5A 1FJ1A 3EFOB 5CGYD 1G7JB 5IKCA 5ACZA 4H0GA 4JPIA 1KLFA 3L4VA 4WKZB 1AQHA 2AP2A 3PDDA 1OGAE 2UY7A 4F9PC 4Y1SA 3ULVF 2A74C 3EJPA 4H88L 4FNQA 2FWLB 2VIRB 2EP6A 3DUSB 3HRZA 5ETUA 2YPVL 4AC4A 4XNBA 5GS2H 2HJLB 4BQ8A 3E0GA 1RUKH 4LCCB 2CPUA 5HDQL 5CBAA 5BV7C 3VFPA 1WVZA 4CU7A 4DKFH 1NKGA 3T1FB 5DJ6B 1XSJA 2F6AA 3DRQA 3EBAA 4FERA 3FTWA 3E6FB 1I3VA 2K6ZA 4N5UA 2BNQE 4GG6F 2CDEB 4ZRGA 1V55B 4LHJB 3V6FB 4XOBA 4B9CA 4JVWA 5T1DL 4ZAKD 3QO0A 2FYYA 2MNJB 1CG9A 1AZBA 1QLRB 2E47A 2B3IA 4FNUA 4MNQB 1UWGL 5G55A 1WA0X 5EO9B 1IGCL 1YJDH 4JZNB 2Y36L 5F6HI 4ZFOA 4QXVA 3DETC 4KPHL 5BOJA 2WQSA 3ELAT 3QUMB 2A2QT 4UTAA 4XAWH 1FGVL 2Z3FA 1JFHA 4XNZC 4IJTA 5D7LD 3QISA 3V0VA 4NSKB 4OY9A 3RX7A 3Q2CA 4BSWB 2XQYG 1D2OA 1NC2A 2YGOA 3ABGA 4YR6B 2AQQA 4HUUA 4W1TA 2GK2A 1HWWA 1MCPL 3VMPA 2AK1H 1AKJD 2GPZA 2X70A 3LNGA 3O6FC 4RMBA 3GS0A 1ZA3B 5CZRA 3X11B 3G6JB 1BLNB 1A65A 2V7NB 3FAWA 3CFEB 2FT8A 4L5FL 5IJCC 3TA3B 5FGBA 3C2SA 5E9AA 1G9NH 3ZDXE 3QT2A 4XCYB 1U8OB 2XG5A 1P2CB 3V5DA 3V9FA 5JPNC 1BREA 5FKPA 1N5YH 5ALBL 4JVPA 4M4RB 5IBUB 3KPRD 4JFFA 3FZUD 1KWKA 2VLKA 4N9GB 4UANA 2LVEA 4HQQL 1KF9B 1JK8B 1TTRA 2V2WB 4PQXA 4TQ8A 4L0PB 3WL9A 5I1DA 2A99A 4I3RH 1BBDH 3CPLA 3P0YH 4LHUD 4PJ8B 4HHGA 3DYOA 1MFEH 1QLEB 2VQ1B 4LLDA 3OLGA 4YC2C 4ZMTA 1X5JA 3C5SA 1PAMA 1CK0L 2EH8H 2B1AH 4K4KA 3LD8C 3REWB 4L8CB 5D1ZI 5IREA 5FKAA 3MRQA 5TE6L 3IJ8A 4WW2A 4WIQA 2OJEA 5FYKU 2R4SL 2ZWYA 3LRGA 4DERA 3F85A 3OG6B 3FQNA 4KH2A 3UO1H 3L48A 4E9TA 1ACYH 3D85D 4YDVB 3CGTA 3RP1A 4ANUA 2FO1A 1BVNT 4KMTL 3V7AE 4P2RA 2Y1ZA 3IKKA 3QDMD 3B2VH 3OLEA 1I9RL 3GO1L 4PV9A 4EZMA 3JWNG 4F7MA 2VR5A 3QW9A 4O02B 4HKXA 4M1GH 3QUML 3VWJA 3RKDC 2ADIB 1D7DA 2I25N 4YZFF 1H5BA 1OE1A 1NOAA 2PCXA 3C08L 4K7PY 1W0YT 4WW1B 5EOTA 3US9A 4MNHB 3SN6N 1FNLA 3EFFA 3V4VA 2KPNA 5J8OA 4W9EC 2ZKHL 3H9SA 5GHWH 4RGMC 1ZK5A 1VADA 2UYLB 4DWHA 3IFPA 3ZDYF 3T3MF 1X7SA 1QSFE 3KJ4B 2LTQB 2ENPA 5EUKA 2EACA 1CFSA 1HHKA 1QFUL 2Z8WC 5AZ2H 3PQYD 1U8MA 2FX7H 43C9A 1W72H 4XODA 3RL2B 4JEGB 1QNZL 1BD2B 2WSKA 3ZDZB 5FFLA 1OT1A 3LPFA 1AR1B 2WZAA 2YJLA 3VFRA 3X12A 3Q8EA 5DI8A 5D1QE 3SDAC 3HC0A 5CZXD 2PCPA 3A4FA 4NN7C 3MV7D 2WIIA 3HI1B 1RZQA 4KBPA 4A6YH 4PS4H 2GK0A 2NDFA 3KLLA 5FLVA 4NQTA 1FE8L 4GI6A 3S88H 4N9OB 1BHGA 4NAQA 3VFSA 4HS8L 4XC1L 5D4QA 3QI9A 5I16B 3VWKA 3SDAB 1JTPA 4HJ0C 3KPLB 3FCSA 1QFWI 5AW6B 3NAAH 4UT6A 1GHFL 1IRAY 5DUPL 4PVBA 2FUTA 2Y5EA 1K8IA 2CBQA 2IMMA 4XMPL 1CT8B 1RK1A 1SN2A 2AJ3A 1CGUA 5A1AA 3S37L 4F2MA 2HKHH 2JCCE 1P5UC 4J39A 4RMTA 4LLMA 3WO3B 4NENA 2A6IA 3KZ8A 3TV3L 2APWA 4L4TA 3IJHB 4U6TA 3WY3A 1SUHA 3QFJE 4MGXA 3IK2A 3UTTA 4KGJA 2N0MA 3PWNB 4XXCA 2AZUA 5J1AB 4GQ9H 2CE6A 3QHZH 5J12C 1JZEA 5AZEH 4R5VA 3ZTNH 4Z0XB 4LSQH 2EUXA 4PTTA 4XNXL 1PLGL 2DY2A 1HSBA 2DQMA 5F7WC 2AANA 5DEFA 3VRJB 1IJNA 3VNZA 1SVZA 5HVHB 3GXPA 2FIKB 2IDCA 4XMVA 3RIFK 3WKQA 5TDNB 3HFFA 3FT3A 5FO8A 3QQNA 2AJYL 4QJ4B 4MJ5B 1FH5H 3MGOA 3T4YA 3Q6GH 1U42A 2GTZA 3OXSB 4LCUA 4OF7A 4MQ7B 1INDL 3QWRA 4QO1B 4XBPA 4BHUA 1J0YA 5E6RB 2O5YH 1Q9WB 4PRIB 2AXWA 1C5CH 1SXAA 1ILSA 2HFFB 5LAPA 5IT2L 2YPVA 4OLXH 2XN9E 5B39A 1VHPA 1N6VA 3B2MA 4Q0XH 3P54A 4LSSH 5EBMB 3D3VE 3MRKB 5EZOL 2IAMB 4GB9A 3SKMA 1UH4A 3F58H 4YE4L 3SDDA 5ESQA 4FFTA 5CJQH 4Z95L 2CUHA 4LSTH 5J3HD 3F7KA 5ANHA 4DNLA 1OP5K 2XC8A 2A6JA 1ADQH 2AJSL 3D12B 1T83C 3VXSB 2PTUA 2L7JA 3QQDB 4TTDD 3BEWA 1CQKA 4H8HA 1P7QB 1JG9A 5H94B 1RUQL 2FRGP 4HKZA 1UB5A 1KTLB 2G4EA 3QUZC 1NFAA 2GYSA 4LARH 3MLZL 1JL8A 1N7ML 3T0EB 4F37K 1YQVL 5ICZB 4QXGL 3PPSA 4G9FA 4P46D 1HILA 1CFNB 3HFML 4IHOA 3H3BC 1T4WA 2YPLD 5IOKA 4XCCH 3RI5F 1O6SA 2Q8AL 1KG0A 3GGWB 1XCQA 3D07A 4X9GA 4DTGH 1G1YA 1OGAB 4AK1A 2X38A 4JY4A 4KH9A 3CX5J 2VMEA 1FYHB 3KH4A 5IROD 1EHXA 1NBZA 2FUQA 4PGEB 1FWXA 1M53A 1R6VA 5K5YA 3UG4A 3OC5A 1NCWL 4OZ4A 5CZVH 3SEPA 4HULB 4ZUTB 2NY3C 3EFOA 1G7JA 1EGJA 3AB0B 1RLWA 1ZHBB 2NXYC 3ZY7A 5CLWA 5CO1A 4JHWL 1FZKB 1YMMD 2BNQB 1UZ6F 1KGIA 5F0PB 1E40A 3HZKB 1KDIA 4CC1A 3F7RA 3C5ZB 4JDTH 1CQYA 2M1KA 4OLWH 2ITDA 2VIRA 3ZKQD 1KELL 3DUSA 1AANA 3D30A 4FFZL 3X1NA 2C9QA 3WE6B 3C2AL 5KN5B 3AXLB 4YSSA 2HJLA 3OB0H 4OFYA 1ORQA 2RA1A 4LCCA 2VZ1A 3CZGA 4JO4L 1XEDA 4DPRA 2HSIA 2X2UA 1Z1WA 2R9HC 2IIJA 3PAZA 1TZOA 4UQEA 3WNMA 3T1FA 5DJ6A 3G5VA 1RV6X 1JF6A 1XFPA 5GRZA 3E6FA 3OKEA 2GJ6D 1IKOP 4N22A 4F7TB 2BZCA 1K85A 2CDEA 2ZX6A 1EFXB 4M48H 2Q7AA 3V6FA 3IE9A 2GSIB 2XKUA 3FUIA 3U1SH 4NO0D 4BWWA 3NQKA 2QELA 2WSPA 2KH2B 2WVUA 2YSSB 3KG5A 3NZHH 3BCDA 4JZNA 3IJSB 5B22A 3SIKA 4PRAB 2WBKA 3BH9B 3QUMA 3ZDXB 4FFWD 4LQFH 2LU7A 3TWYA 4NZRH 3BKJH 2X9WA 4JHVA 5IUCA 4TXVB 3HE7C 4NSKA 5I17B 2ORBH 2P45B 2GT9A 2RHEA 5GGSY 3EDDA 5J56B 4YR6A 1PG7X 3T2PA 2VDLH 1CF1A 4JJOA 1QBMH 1BVKA 2D3VA 2N7SA 4PP2B 2MCAA 3ZBMA 3HE7B 1ZA3A 2OJZL 3RWIB 4AJWA 3G6JA 1BLNA 2V7NA 3N04A 1MEXL 3CFEA 3NRPA 1MG3C 2YMTA 1MXDA 2DQGL 4R90L 3TA3A 2YD0A 1PD0A 1R47A 3R1GL 4D8OA 3TBBA 1MVUB 1I7UA 4XCYA 1JNLL 5LDUA 1OQXA 1P2CA 2XKNB 2CRYA 3DECA 4RDQF 3B9VA 3CX5K 1AJ7H 4M4RA 3D52A 4N9GA 3LS5H 3LJ3A 4WW2F 2V2WA 3FU0A 1JGVH 3UGEA 3HNSH 1ZV5A 2VZSA 4F8TA 3NIGF 1F4YH 4PJ8A 4JDEA 2C7FA 2VQ1A 3EYQC 2DM3A 5HGBA 3VD2A 4F5CE 1LVEA 4FFYL 1RJLB 4HGKC 4XNQA 1CU4L 4FNSA 4KHTH 3UBFA 4R96B 5C08E 3KPTA 5E6SB 1ZMYA 4J8QA 3REWA 2N0KA 4LMQI 5KEZA 1VGKA 1CS6A 4L8CA 1N5AB 2ZAHA 5DWPA 1BF2A 2IH1B 4TNWK 1MI5A 1W8EA 1P5VB 4LP8A 4ODSL 3WY4A 1JI2A 4HS6B 4OCXH 2X5PA 4GKOA 3STLB 5E94B 4YSOA 3ZLQC 3UBXI 1QSFB 2X6MA 1YN6B 2XYBA 4O02A 3V8CA 4A04A 2ADIA 1IQDB 5E2UH 2BZDA 4IOSA 4XC3L 3VYPA 4RFNB 2ARJB 4NXSA 3TC9A 5D1QB 1JZ8A 2B1HL 2HWZL 1T89A 3LH8A 3B7YA 2UYLA 5F9OH 1LEKA 3WD5L 1RQ5A 2IOOA 3HG1D 1OCWL 3MUJA 4HSAC 5I2IB 5EEYA 4FXKA 2ROYA 4MVBD 2ROXA 2ENSA 2H0EA 4AV4A 2ZAIA 3GXIA 5MEQB 4M3KB 1I8AA 1T6VN 1O7VA 1ETJA 5DVKA 4U6YB 3RL2A 4ZOEA 1BD2A 3PP3H 3ARFB 3U0PB 4XBEH 4UOW1 4G43B 2ZXWB 4UDUA 3TGXA 4YXHH 2JCCB 3U4EA 1A02N 4RMRA 4AKQA 3HI1A 3QIWD 4XVJL 1JZ7A 3X17A 1DLFL 2Q0ZX 3LEVL 3QFJB 2N7AA 1JRHH 4K5LA 5L9DH 1J18A 1F90H 5DA0B 5DK2B 5I16A 1QWUA 3KPLA 4OJCA 3NFSH 3S5ZA 4LSUL 5I1HL 4W4NA 2KZBA 3WEOA 2LOEA 2V2TB 4NN6C 3A6OA 3L54A 3MLSL 3VXRD 1AQMA 1W8OA 4ES8A 1CT8A 2CNYA 4ETQB 3EYSH 4N2NA 1IBGH 1LL1A 5JQIB 3KBFA 5JR1L 3BN9D 4HWBH 2H7WA 3WFDL 3II2A 3IJHA 1RIVH 4NCC2 4YE0A 3THMH 1JDDA 1FYTE 1R5VA 1MIMH 3MGAA 1CN4A 4GRLA 1XSIA 3SE8H 4U0QB 3KS0H 3ARRA 1GGTA 3BUYB 3MRNB 4KDTA 4N26A 5J1AA 4MB1A 1JYNA 4Z0XA 2QQLH 4F8PA 4OB5L 1IM3D 5E5RB 5ES4B 4MMXB 1HINH 5B8CB 2V9UA 1CLZH 3FQRB 2JKTM 4D9QD 4FQXB 4FZ8H 3UAEA 3UX9B 3OJVC 4RFOH 3D3VB 2A6KB 5TDNA 4DF9A 4FP8L 4Z23A 3U25A 4EXKA 2CK0L 4S1DC 5DHYB 3VH8G 4BSVB 4MJ5A 1E67A 1CDCA 5I1EH 3GMNB 2VDQH 4QO1A 1ZHNB 2J1YA 5I8CA 4HKJA 1SY6A 3BD3A 1Q9WA 4WO4C 5IESH 1SJXA 4PRIA 2E7BA 3DVNB 4X7TA 2HFFA 2F53D 4AQ8C 3GMRB 4F33B 5E5UB 5IMMA 3UJIH 3EDKA 1AO7D 3MA7A 2JK5B 4NRZA 1A6VL 3BDYH 3N44F 3KNBB 3G9VA 4C4KO 7PCYA 4KQ4H 4NZUL 4Z7AA 3MRKA 3MLVH 2G2RB 2ZOLB 1AVAA 2Y7LA 4NNPL 4XP1H 3ZZSA 5K33A 3ZL4L 4GP5B 3GXUB 5CAYB 5JUEH 4CN6A 1BZ8A 3BP7A 2OMUB 3KYMA 4DESA 5IJKA 2A73B 1UM5L 3EOTH 1LO2H 3JVFC 3W3BA 1WT5A 1XQ4A 2J73A 3GK8H 3N41B 5EU4B 2MTAA 3VXSA 4JFPB 3QQDA 1NAKH 5EU5A 1FNAA 4N2FA 2E4TA 2OCFD 1T0PB 1YJDC 5H94A 1CR9L 4XPFL 1NMCB 5EBGA 5HGAA 3HLKA 3S8GB 1VDGA 1JPTH 2WJ5A 3T0EA 1YY8B 5ICZA 4OT1H 3IN2A 5EWIL 2WLMA 3H9HB 5E9DE 3TYFB 4LO9A 4Z5RB 4XE0A 1DVFD 5T3ZH 1NUNB 3TT1H 2X09A 3GGWA 2WQUA 1UM4L 4IRZH 4JRFA 4RAVA 4W93A 1ZLSL 4Z3JA 5E4IA 3V0FA 1OGAA 4JZOB 1Q0EA 3PGFH 3NA9L 5DHVA 3GMLA 5DHEA 4JFDE 4ANXA 3L81A 1FFNB 1DQLL 4PGEA 2XSKA 3TF7C 1G9NC 2YS4A 3APFA 3WV0A 4NNYA 3FU6A 5E4EC 3T6XA 3FUEA 3OZ9L 4ZUTA 2ATPB 3EH1A 4Y9CA 1U8HB 5I6PA 1FZKA 1KIPB 3WFZA 2BNQA 2GBAA 5I73C 1HNYA 3HZKA 4FNRA 3C5ZA 5C07E 4HWUA 5C9JB 5L2JB 3T0XA 1M56B 3WE6A 5KN5A 3AXLA 3BQUB 1C16B 4TUKL 2A9DA 4YVNA 2F19H 4ATTA 3QHTC 2R27A 2IAAC 3BVNB 4MA3B 1J5HA 5C0JB 2QGDA 1OF0A 4WWKC 4TRPH 2PXYB 1E4XI 1Q90A 3KWXA 3B2UD 1MAMH 1X9RA 3QYMA 5ISZE 5AL0A 4KY1L 2NY4B 2X42A 4WFHE 2EE0A 3R7QA 5I15H 1EFXA 2P47B 5FXCH 2GSIA 1GPOH 3TEUA 4YS4A 5KVDH 4RCAA 4I5BB 4YDIH 1NBYB 3SD2A 3AWEA 3VXNB 3ABMB 4AENA 5JW3L 2UWEE 2YSSA 1GKEA 2GY7B 4E0RA 2HJFB 4R0LC 3GUFA 4WU7B 4BIKA 3G6JF 4PRAA 3AM8A 3BH9A 2B14A 2RMNA 1CB4A 3MRRA 2OYLA 1HH9B 4UI2A 3CN3A 5DMKB 1X5IA 3RWCA 1LQBC 2EE3A 2R2HB 1I1RA 3QPQD 2BWIA 1QW9A 4RGNC 3BO8B 2X28A 4NHCH 2QV2A 4S1SL 5EFIB 3RB5A 1OAUH 2XJLA 4P2OB 1GMEA 2CQVA 1DSFL 3SBPA 4OQTA 1HHJA 3BUPA 1L0PA 3MODL 4PP2A 1TQCB 1BW8A 5CCKH 2EYTB 3RWIA 4I3SH 3RE0A 2R83A 1BQRA 1J1OL 1SDYA 1EJOL 5ESVB 1MVUA 1SLWA 4AGOA 1PEWA 4RMUA 4AX3A 2XKNA 2BK8A 2PCFB 3WNPA 4KRMB 1A25A 2EXWC 3U1QA 4MA1B 4AVKA 1NCOA 2LV4A 2R0ZL 2OK0L 3OPZH 3S3JA 1BJ1J 3P2DA 3SODB 1DJGA 4FGMA 1KJ2A 5DT1H 3BDBA 2HG5B 5AWNL 4DO5A 3BGFB 3FFCD 3NZ8B 2WHVA 4BINA 1RZPA 3LIZA 4WHTB 5KS9B 3KD4A 4ODHH 4APXA 1I9EA 1HZHH 1PZ2A 3KDMB 4MZ2A 3V6OA 5JQHC 4GSRA 1B9KA 4Y4KC 1RJLA 1PZBA 1E27B 4KJPD 4R96A 4KTEH 1JPEA 5KVFH 2DQDH 1CFMA 3VQMA 4DAGH 1JGLL 2ZX9A 3UTQA 4OI8A 2IH1A 4Y4KB 3T1WA 2MKLC 5IMOA 1GVIA 1E50A 5IHUH 5J13C 5D1XC 1HL5A 2A3TA 3H4FA 3M07A 1BEYL 3IAQA 4HS6A 3DHJA 2CG9X 4ZAKC 1FCCA 3D06A 4ZMVA 5E94A 3LH9A 1IEAB 5DO2C 3DIVA 4MXVE 1W0WB 5E8OB 3QJUB 4JM2B 5JW4N 5DEZA 1G9HA 3L3OA 3UO1L 3GB7B 4E42B 3V0WH 1IQDA 5D93B 2J5LC 4MXWH 3V4PH 3C5JA 3CK0L 4FYSA 3CXHJ 1OD9A 1N8ZB 2XA8H 3UC0L 4X5LA 3D09A 3DGGB 4EDWH 1ODAA 2E5EA 3ZDZF 4PRHD 5DSCB 4Y2DC 5D1QA 1E4HA 1OP9A 4QMEA 1MY5A 5JA9A 4JG0L 2QKIA 4K94L 3TJEH 3I9PA 4E36A 5DD0H 1WAAE 2VDPB 1UA6H 2QPSA 1EDQA 1ZIBA 1K4DB 2DM2A 1KY6A 5CR8A 1LP9E 2COVD 5MEQA 5GHWL 1FLRL 3MJ9L 4LDOB 4U1GB 4U6YA 2YOCA 5CNHA 4DCQB 3U0PA 5LG1A 2XLLA 4P5MB 3D2UA 2APFA 1PDKB 1YYMH 4DGVH 5IFHL 4B9IA 3I2CL 5GGQH 1F4XH 1MJUL 1NCAL 2JCCA 1KYAA 4FKKA 3DGCR 4FEIA 1V7NL 2FX7L 2DKSA 3K2UL 3MNDA 4ZFFB 3O4LD 1DUZB 3QFJA 2CJ3A 1KXTA 2OXGB 2KMWA 4BJLA 5DK2A 4WZ9A 3RLSA 2GQHA 1KZYA 2RR3A 1TVBB 2ZKWA 3BPLC 2BY1A 2V2TA 5AB1A 2WZPA 4JGNA 4OCLC 4PS4L 3M7OA 2JTYA 2Y1AA 4GQPH 4ETQA 2YQBA 4JFVA 2YEVB 5F7EH 3U4BL 3ULAB 4LDCA 1Z9SB 1MFDL 1KY7A 3AGWA 1KGJA 3MFFB 3B2DC 3FJTA 2JJWA 4LPYA 4FADA 2HLAB 4WQOA 4KJYB 3SDYL 1E65A 2IMNA 1X5FA 3MRNA 3BUYA 5MEPB 2XIIA 1LYQA 4N0UE 4OM0L 3T9WA 3ULUF 1A7NL 3TO4C 1DQKA 1OSPL 3AREC 2KS0A 2ZOKB 4MMXA 5B8CA 3RILA 4YFEA 2P24A 4Z78B 4FQXA 2B20A 4A2EA 3V7MA 3MCLL 3D3VA 5D1ZD 5C9KA 4MAZA 5F7BA 5I18L 3QHZL 4YK4C 2QQKH 4Q9QH 3QORD 5DHYA 4BSVA 3AREB 1MDAA 4NT6B 3LRHA 2J1ZA 4EBQL 1MNNA 3QBTB 4XCEB 2XWJB 3GMNA 4TUUA 1ZHNA 5HHVH 4P59L 5T3XD 4JM4H 3X14B 3LZFH 3CXHK 2VDPL 3DVNA 2IWGA 4LKCA 1FP5A 3GMRA 1JHTA 3GS7A 1G5GA 4NRYA 4WNQB 4F33A 3PWLB 4NP4L 1BBJB 1TMCB 3Q6GL 2JK5A 2WCPA 3FTGA 3ISYA 3KNBA 1N0LB 2IC2A 2SODB 3GSQB 2KZWA 1KGWA 3SO3C 3BAWA 2NT1A 3SE6A 3SBWC 4K9EL 5E9DB 7CGTA 2PPAA 5LB1A 2XZCL 2XKSA 4C4BA 5EORH 2GIMA 2OMUA 4YH6A 4AM0Q 2K7QA 3AG4B 3HAEG 4M4PA 4Q0XL 2ZOWA 2I7OA 4GUQA 1TCMA 4N6QA 4XMLH 3TWCH 4LSSL 1QFWM 2G60H 4JFPA 4OLVH 2MSPA 1E8XA 4JFDB 4H1LH 5CJQL 3SJVE 3L1OH 3WGVB 1T6BX 2XCMC 2E59A 2VOTA 2EUVA 1YY8A 5JHAA 3BSZH 5FCSH 3OR6A 3TYFA 3LHPH 1N59B 4LQ1A 2F8VA 4ZYKB 2IQ9L 3LKNB 4M5SA 2FBJH 3O6MH 3GSUB 5DD3H 3K71B 1RHHB 5I1IL 5C07B 1J05B 2BHZA 1FFNA 5DR5L 2IDTA 2EEFA 4M7ZB 1CXIA 2XOTA 4BZ1H 4TQHA 1E5AA 4D3CL 2WXQA 1L9PA 3L3KA 4Y5XB 2HZHA 3Q9QA 3ZE1E 5EU7C 1BXAA 2P80A 4HCFA 1IM9A 3K4DA 4GAYA 1U8HA 5ISZB 3DMMD 1V10A 1KIPA 4R83A 2L8AA 4LRIA 3TNMB 3UTSE 3BZ4B 4BKSC 3ARQA 3SPHA 5C9JA 2ZWSA 5L2JA 3OWRA 2UX6A 3BQUA 1C16A 1LNUA 1MJ8H 2ICWB 2UWEB 1OP5H 3VXOA 4AV0A 4KOBA 3GUTA 1HJBC 3BVNA 4MA3A 5C0JA 4MHHG 4X7SL 3SGDI 1ZT4B 4BCZA 4OLWL 2PXYA 1T20B 2UV3A 1EUTA 2WUCH 4XH2B 5JZ7C 1MW1A 3ZDXF 2XPGB 1XGYH 5FYKD 4D7PA 2QVMA 3BFWA 4G8GE 1AFVH 25C8H 5J6SA 4HJSA 1HDMA 1QMUA 3T8MA 2Y06H 4I5BA 1NBYA 1VENA 2H0PA 3QO1B 1DR9A 2AW2A 1KCUH 1IC0A 5DUBB 3F83A 2J6WA 3MLXL 2K4WA 2HJFA 4WU7A 4ZNCD 5CF3A 3SD5A 1MJ7H 1HH9A 4H0IA 2FJSA 5DMKA 2C9XA 2ALAA 4P46C 2DM4A 2P43B 3SHSA 4Z3IA 2MOGA 1I9JL 3BO8A 1I9IH 5EFIA 4YHIA 4P2OA 5L4IA 3S96B 5SWSE 3RJDA 1KCRL 5DS2A 4Y5VB 2YAFA 3EBGA 2MCPL 4UOJA 2WWKO 2EYTA 3MRHB 2X2YA 1TEGA 2MQGA 3MR9B 1RUPH 1JWSB 3RB7A 2YAEA 1SLUA 3TIDB 2ZUQB 3WTSA 1MVFA 1QBML 2PCFA 1JNNL 2VO5A 5GXBB 3MJ9A 3VG0L 4LDLB 1ZLDA 1T7ZA 2FQDA 3SPIA 1LK2B 4F20A 2ZCLH 2OTWB 5FGCE 2F58L 4BQ6A 4KK8D 4OD2B 2H26B 2WBWB 1CFVH 2HG5A 4R4FL 3TH2T 1U6AH 1JCKA 5GPRA 1NH6A 4M6OH 4WHTA 5KS9A 1NFDE 2DM7A 3FSVA 5DFTA 1OXYA 3KDMA 1QPKA 5E6YA 3HC2A 3VTTA 2EZ0C 5JOFB 4PLNC 1IGJB 3CFUA 1T3FB 1LD9B 3Q44A 4NO5B 1E27A 1G7MB 4HBCL 4MBRA 3IDXL 3KVQA 2RH0A 2HLEB 3NJJA 1HI6B 3BFOA 3ASOB 2DH3A 3P02A 3I74A 1RK0B 2OTUB 5C70A 4KRPD 2DMKA 4LLYB 4HIQA 5FGRA 3FUDA 4Z7NE 1A21A 1TPXC 4DUWA 5I76B 3CN2A 4GBXB 1Z0NA 2JIXB 4L3AA 1IIKA 1NGZA 4EUPG 2FR4A 1IEAA 1OKEA 4QOKD 4R8WH 5E8OA 1X5ZA 2MPVA 4JM2A 1NUDA 3JWOL 4X8JB 5I23A 3H8NA 4XP5L 3GB7A 4E42A 4ZMOA 1LP9B 2GJRA 2P5EE 5KVGE 3FN3A 5MERB 3WNIA 3C6SB 3MZGB 5E1AB 1XGTB 2BW4A 5GRUL 5C86A 3NP3A 3R4DA 5I0YA 4XMUA 5I75C 1K8DB 3CH8A 3HMXH 4XOEA 5L88H 4EXPX 4OLEA 3DGGA 2YD1A 2G5RA 4WDIB 1IEHA 2VR3A 2EDWA 2ZIDA 4WFGE 2BNUA 2CIKB 4PJAE 4YEEA 4PCYA 2JCCF 1WWCA 4N2IA 4JAMB 1OB0A 1BPLB 1DQTA 3ESMA 4FYQA 1X3DA 1CXHA 4PIRF 1ND0B 4HIEB 1QFWH 4DKAA 1WK0A 4F3FA 4OJDH 4P4KC 4M1DL 1JHLL 4E9VA 1KJMB 3BKML 2ZP9A 5E6IC 4Y16B 2DBLL 4Z7QF 4DCQA 5HPOA 4KQ0A 4P5MA 2YD9A 1LO4H 1PDKA 1UG9A 2EDMA 3F62A 4FQJL 3UIYA 1Y6MR 2DJUA 4P5KA 1BVOA 2HRLA 5FUZL 3L3GB 1YUHA 1KOAA 3SKNB 2HN7A 3VQ1C 1A9BB 3BZEB 4TPRH 1J8KA 5TTRA 4KKCD 4BZ2A 1DUZA 3JV6B 3RZCB 3R4RA 4FXGB 1MCKA 1L7IH 1M71B 2E7MA 2OXGA 4XBEL 3LRSB 4GT0A 4JO8A 3H42L 5TDPA 3ARUA 4MNGB 4N0UB 1A1NB 3MLYH 4AQEB 3RUGE 4JUSA 2XBZA 2ZCHH 3K81A 1L7TH 1TENA 3LQMA 2QHRL 2GKIA 3PS6A 4JRXE 3G5XA 1Z9SA 3QIUD 3U7YH 3U7WH 3MFFA 1PSKH 2DOCA 5C0EB 4J3OF 4S1RH 4JKLA 3RPKA 3MLWL 3ES6A 3WS3A 2WPGA 5TE7H 4KJYA 2AFNA 2B15A 3U9UB 2BLFA 2YA0A 1IBGL 1MZZA 2OMVB 3WS6A 3VSQA 1M9WA 4LVEA 2WMPA 4UQ3B 2ZUUA 2BS71 4N5EC 4XMZA 3PXJA 4TVPD 4HBQA 4N8PA 4Z78A 4O4YH 4KROD 2I9TB 2HVKB 1DFBH 4UF7C 2QQNL 3MRGA 1D6VL 3ZO0A 1JZGA 3RWEB 3CLEL 1TNMA 3OTTA 9CGTA 4PVLA 1FNSH 3WI9A 2QVFB 2QQLL 4NT6A 2WNWA 4MQXD 5DMJB 2X4RB 4C8XA 4XCEA 2DQUL 4MVBC 3CSBA 4JW3A 1KN4L 5CMAA 2BRRL 3X14A 1WC7A 2HFGH 4PG2A 2FJGB 1U8IB 3N41F 4HCRH 3TEZA 5TQ2L 3OLIA 3TO2B 1KBGH 2YIHA 3WXWL 3SJVB 1ZLUK 1N0LA 3LTVA 3GSQA 3QH3B 4LVHC 1ZVHA 5HJGA 4G6FD 3WNLA 1R0AL 1S7WB 2AJZB 3MOAH 3IJ9A 3OXRB 4LHUG 5E9DA 1J86A 3W37A 1LDPH 3QIWC 1NDMB 5I6XB 3MRCB 5BZZA 2NZ1A 1U8CB 3ZZQA 1OAYH 3ARBC 2N4IA 2UXFA 5G5DB 2HX8A 5PCYA 1EZVX 1E5BA 2X1XR 3IPEA 2X7LB 4XP1L 3MA9H 1J5OL 2Y5QA 4WU5B 3KBPA 2YO3A 2J4WL 2P49B 4XI5D 1FNFA 2FD6L 3GK8L 3FPYA 1UUSA 4A7VA 4UCFA 4Y4FB 5JHLH 1N59A 3BN9C 4MAYC 1ZJAA 4ZYKA 3BDXA 1OF2A 3DLQR 2F7RA 4PJ9D 4KZEL 4ELKB 3GSUA 4CC4A 3K71A 4NWTL 3I9IA 1KEGH 3MROA 4XO4A 1JPTL 1RHHA 4ODUB 1XGQB 2WNKA 2LFEA 8FABB 1WCBB 3V52L 3EOAB 2K4AA 3GMQB 4M61B 1W2KT 4GO9A 4X50A 3TT1L 1BF8A 1ZA6B 3EO0A 3U6XA 4Y5XA 3SQOH 3MJ8A 2VSMB 3UDWA 5ILTH 4JFQA 3NN8B 2E86A 1VEOA 3Q7JA 4WJG3 5TK2A 3NGBC 5ISZA 3KPOB 1R3LB 5FCUH 1FFTB 5T5NF 4NQXB 3W0WD 1SEBB 4IDLA 1AKPA 2VDNB 2L7EA 3SE3A 2W65B 1YEJL 2H4EA 3MV8D 3J7HA 2VM3A 3EKCA 4DGYH 4GQRA 4NUPA 2IALB 1CGSL 3IMBA 2ICWA 2UWEA 4ODXB 3R8QA 1VGEH 3ABZA 1FDLL 3K72B 2AXFB 4GW1B 3CD4A 2D9QB 3U1PA 5FHAL 2N3JA 1JXDA 3OV6A 1GS8A 1YEDB 1Q0YH 1ZT4A 1HWGB 3QRBA 4XH2A 1T20A 4GXVL 3U7AA 3B1UA 4QEGA 2VXSL 4KZDH 2NY5H 4LXFA 2AEPL 3BWAB 3LQAL 4NBXB 4PJ7E 4L9LA 1P4BL 4L8SC 3AG2B 1X9QA 2UZXA 2VJXA 1EXHA 2IV8A 3S8WA 4LLWA 4NZTH 5SWSB 4ALAH 4QXUL 2XTJD 3J27A 4P8QA 5EOCL 2C9RA 4F1SA 3FW6A 1DBBH 3LOWA 5DUBA 4NQDE 3H85A 5KWYC 4N68A 5DD1L 4LEXL 4NCC1 1FL6B 4PB9H 1DQDH 3GINA 5DVOA 3WBDA 5IEKB 1L9NA 5AOKA 3T6ZA 3PHOB 4G9DB 3BKYH 4BH7B 3U79A 4O2EB 4YDMA 1BLIA 1QYGL 3RX9A 2FQEA 4PRNA 1W6WA 4JQIL 1O6TA 3CBRA 1UXSB 3OGOE 4EI5B 4F1ZA 1ACXA 4H20H 4PJ5A 2NY6B 3TT3L 5HGGS 3TL5A 2VH5L 4ZW3A 2EDOA 3UTPE 4AQZA 5FGCB 3GMMA 2Y6SC 3IGUA 1T21A 4JUTA 3HI6L 3H2QA 4GI8A 4HV8B 3MRHA 3NJIA 5I1JL 3PFQA 1P0SE 5AW2B 1NFDB 5JXED 4YBQD 3KGTA 1JI1A 3QNFA 2GSGB 4FL4C 4TVPH 4AE1A 5KS9F 4S0HA 1JWSA 2R29L 5D7KE 3T0BA 2ADFH 3N5AA 1H8SA 3TIDA 3HC3H 1T04B 3OB8A 4AJYV 2XPZA 2DWEA 3HE6C 4FCHA 1NCGA 3LH2H 5D71H 1AZCA 1LK2A 2C7UA 2J71A 4JQVC 3GSWB 5EA0L 1BIIB 1FFPB 1I85A 4FL4B 4AKOA 4CC0A 2OTWA 2FJUB 4OD2A 3TYGH 2H26A 3QQ3B 3VD7A 3C8DA 2VDMH 5J9PA 2OSLB 1EPFA 1IL1B 4E41E 4R2GD 4K3DH 5KYYB 4DUXA 3O9WC 3FAXA 1H3PL 5JOFA 1IGJA 4NI3A 4XCNA 1LD9A 2YD4A 4NO5A 2D3JA 4JM2F 2EDFA 1PZ5B 3VH8B 3WO4C 2IPUG 5L2KD 3SCMD 2VJ8A 2P5EB 1FSKB 3CHXA 3CQQA 4NUGH 4Y19E 4AJ0A 2YSTA 1WV7T 1J8SA 5I1KH 4IIZA 4PRDA 1OT2A 2IANE 2OTUA 3VNYA 2IVFC 1UWXK 4LLYA 4JK0D 2CGZA 2DI7A 2VN7A 5I76A 4X2UA 1H3WM 4GBXA 4J3XA 2JIXA 1BFSA 4Z18A 1IGFH 4PJAB 4YHZH 4F7EB 4Q6IC 2DAVA 3KLAB 4Q52A 3HKZA 1PFCA 4DAGL 5GZOD 1XL6A 3NJGA 3QXTA 1RLBA 2N56A 4A37A 5FYLE 1MREH 5K9OA 1ZTXE 1G0YR 1WAAA 1NGWB 5F9WB 4N20A 4NQUA 3CC1A 3INUH 1LP9A 5CWSA 3VTMA 5E1AA 3K4ZA 1XGTA 4EEEA 3UPAA 3MNWB 4BDVB 2NXZB 1HQ4B 1Z0MA 1RIUL 4WDIA 1TTAA 1GIGH 3RU8H 1MHEB 2CIKA 2EO7A 1NOFA 1MWAH 4IKLA 2NNXA 4XP9H 4HLZH 4JAMA 3DTXB 4HUKB 5D4JA 1A4KB 3B9KC 3Q6FB 4YL4A 2J3SA 5DCCA 1G5AA 4POYA 5IMKB 4HIEA 2LW3A 1RZ7L 4ZTEA 4B27A 3RJQB 3U36A 3OAWA 4HCIA 3CFJB 3CFTA 4ZXBB 3MRDB 1KJMA 2A38A 4DGIH 1FZJA 2WD0A 5IG7B 5D9SB 2GSMB 4JRXB 5B38G 1Q9OB 1JPSH 1UA6L 5DZJA 4YXLH 3PL6A 3SKNA 2E9JA 3ARXA 5C0AB 5B1JC 1IGIH 2P52A 3KXFA 3VXQB 4FYRA 1FNGB 2DQ6A 3JV6A 3RZCA 2FGWL 3FULA 4FXGA 4QWWC 1M71A 2CCWA 3LRSA 4KOCA 3GRWL 4JANB 4BK5C 3NVQA 1CE1H 2DIJA 3NK3A 4MNGA 4N0UA 1A1NA 2NYYC 1PJ9A 4MS8D 4AQEA 5IJDC 1N70A 5E1QA 5KVGL 3WIHL 1OANA 2PO6D 1U58B 3G08B 4JZJC 5A6IA 5CJXA 2B9AA 4MKTA 1UACH 5E23A 3SOTA 4JFHD 1S7UA 4NOFA 4OTXH 2ADJB 5L4JA 5L6YL 1KC5L 3RI5K 2X9ZA 1L9OA 2WTPA 1KTBA 2BS8A 5ITFB 5LGYA 3VUAA 2JQZA 2XWCA 1TJMA 2GBVA 5HVGB 4JZJB 4TSBL 3U9UA 4G80B 1UWFA 2VXQA 5IWLC 4LVNB 3ZN6A 3ESVF 2C34A 3KLDA 4Q74A 2OMVA 5E0QA 4XO9A 4CKVX 2IWEA 4HAGA 4WTQA 4ZFQA 4UQ3A 5E5MB 1DQMH 4R6UA 3OAZK 1JPGA 1I4FB 1YEIL 3MN8A 3NCYS 5EZIL 4ZDHA 3ZL2A 2F5AH 3RVXD 3SYAA 4BHUI 2I9TA 4HS3B 3A24A 5F7UA 5F7FA 1GAFH 4XE5B 2B5IB 1FA4A 3VGAC 1IQWH 3RWEA 3FQ4A 2ZCKH 4EN3D 2DZEA 3CZFA 5ADOL 3KBHE 2DLTA 3EH2A 2HP4A 2LVCA 1QFHA 4AE0A 4XNYL 4OGYH 4K7PL 5D72H 4XMTA 4HOWA 3DO3A 2FJGA 3BPNB 1U8IA 3C6LB 4M6NL 1RSYA 5H37H 3TO2A 1HQRA 3H0TB 4L4JA 1M7UA 5BS0D 1J8HA 2GCYB 4J1UA 1G9MH 3QYCA 3QDJD 2HFEB 1BJ1H 1IC1A 5LXGL 1FIEA 3LZFL 3MCKB 5KUMA 1S7WA 3VD0A 3TS8A 2FJFB 5F1IB 4ZD3H 3FT0A 4WV1C 4W9GC 1NDMA 4I1PA 5FW6A 2WBJC 3O8XB 4R84A 5DJ8B 1U8CA 4E5XB 2YK1H 1KV7A 1T22B 4KKPA 2HAZA 5G5DA 4HMEA 1YN7B 3GSRB 4PM1A 1UD6A 4LCYB 1FIGL 2DTSA 5E1IA 2CLZB 4WU5A 1HOEA 2D0FA 4J6IA 5IMLB 1AP2B 1IKNA 1I1YB 2HT4D 4UT7H 4Y4HD 3VXUE 3CU1A 1CICD 4UZUA 3X1FA 5DZVA 4Y4FA 2FSDA 4B0MM 5CEXB 2NSQA 2P5WD 4BK8A 5CCJA 2CO1A 3EYVB 4ELKA 3ILQC 4BFNA 5J6GB 4ODUA 1XGQA 3EHBC 3PFUA 1XB6A 8FABA 1UOKA 2D4FA 3BJ91 5IW6B 1UZGA 2AEWA 2YRLA 4M61A 5DFAA 5DXWA 1F4HA 2XFXB 1F2QA 1ZA6A 2R29A 2YAPA 2UWEF 2O6PA 1WWWX 3PNWB 2VWEC 3P3RA 4GFTB 1E4XH 4U2ZA 1BG9A 2NX5A 5EU3B 3KPPA 4GOSA 2OW6A 5D1ZC 3TCLB 3NN8A 5C0RH 1HXMA 4I2XA 2E9GA 3KPOA 1R3LA 3ET9F 3ILEA 4X7CC 4BZ1L 1SEBA 2PWDA 3RVVD 4MS6A 2W65A 1PJWA 3A6BL 2D0GA 2EIMB 1F6AB 3G5ZA 3GC3A 4JPVL 1R5WA 4ODXA 2PF6A 5T1KD 2VSDA 3BWSA 3K72A 3O3EB 4MA7H 4GW1A 4D0BB 3KL5A 1ZLVK 1BXVA 4GKNA 5E2WL 3A67H 4ZG1A 3BAJA 1YEDA 1G7LA 3D2UD 3EOBA 3N9GL 1SOKA 5EC1A 2O26U 3UYRL 4OZIF 4N6RB 3WDHA 5BVPL 2WZ0A 4P05A 5TE4L 5GS1B 4R26H 3BWAA 1TZHB 1DJXA 3FF7A 3HW7A 1KZQA 1WZAA 4DEPB 1J9CT 3CQFA 5KSAB 2GHWB 2GEQA 2FB4H 4QIRA 5AVUB 2AF2A 3LPOA 4AYMC 1DLHB 4B9JA 2I69A 2KPWA 3GJFB 1XTMA 1IMHC 1H0DA 1LGVA 1MCWM 4I85A 5IEKA 5JIPA 1RK7A 1AFVL 2IWKA 2EJ1A 2IO5A 2YAHA 1BOGB 4G9DA 4BH7A 4C54A 4JREB 4O2EA 4TS6A 2WUBH 3T6VA 4NKQB 4CSTA 1FO0H 4EI5A 3VXTB 1WP6A 3UJJL 4ONFH 2EH7H 4JX0A 4TYUA 1BYNA 3FRPG 4PSPA 5H35B 1BXUA 4E41B 1ZLEA 1NFDA 1Z5LB 3W38A 4LEOA 1OOWA 3L9BA 2GSGA 4NUJB 5GGSB 3IN0A 2NSMA 2V4LA 4LPTA 4K5MA 1T04A 4WI4A 2J6EH 3OKYA 5DHXB 4GSDH 4C56D 3DK2A 1BQ5A 4Y19B 3GSWA 3FUMA 1PLBA 3HLAB 5D55A 1BIIA 1FFPA 2IANB 4JPKL 3TZVD 1TKWA 3LAFA 2OSLA 4ZBJA 3DK0A 3O2DA 1SQ2N 1IL1A 1ZE3H 2QHLA 3N1QC 4H0LC 4IGBC 4FTVA 5KJ7E 3L45A 1P4UA 1ML0A 3GRWA 1N0XH 1NWPA 1THAA 5F7KC 5HHPB 4G5ZH 5B1CA 1YEHL 2V0AA 1PZ5A 3FRUA 3VH8A 4DN3H 3M1CA 1KB5H 1KGYE 3RNKB 1XAKA 3UZEA 1WAAF 2P5EA 2PW1A 3WIHA 2YJQA 3LEYH 1JHKL 1LP9F 5D7LE 3SKJL 3IWUA 2MFNA 4U31A 5KSUB 3TVMA 3JZ7A 3MBED 1E6OH 3GBML 4H44C 2QSVA 2J5WA 3NCJL 3WEBA 2W60A 4W4OC 4PJAA 4F7EA 2R0KH 4GRWE 3KLAA 1DP0A 4QGTA 1XH1A 4HJ1A 3FO0L 1JZ4A 5I8EB 1NGWA 3HJ0A 4WNSA 4UQIM 5D7JB 4J7RA 1U41A 2K7PA 3SE9L 4HSQA 1JWUA 4IDJL 2YBRB 1HQ4A 3T3PE 2WP3T 4EZLA 1HAWA 4JO3L 1U91B 1MHEA 4NPYB 3LRMA 3FU5A 5L0QB 4FI6A 1EERB 4JFZH 3ZK0A 1P5UA 5MHSD 4JLRA 3VGFA 3DTXA 1HEZB 1A4KA 1NCCH 5DFVD 3Q6FA 4YHYB 2QPEB 2DI8A 4GQQA 1MELA 1IFGA 4ZW8A 3KGRA 5HBBA 3LB6C 4F2FA 2EAEA 5EZLB 4Q2ZB 5K39B 3FUFA 1L4IA 3CFJA 2WY3B 3N42B 4X6EB 4ERSL 4ZXBA 3MRDA 2Y3AA 4CUCA 1B0RB 1ETZB 3FQWB 3DSNA 5IG7A 2O6CA 5D9SA 5BXFB 5IQLA 4TVUA 3EO9H 4JRXA 5BRQA 4MRCA 1Q9OA 2VR6A 4NM4L 1V3LA 1H8OA 5C0AA 3NBNA 1BGXL 4G6JH 3VXQA 1FNGA 1SXNA 2H1PH 3F12A 2JB5H 1GCYA 2ATKB 3PPEA 4JANA 3SY6A 6PCYA 5HHQB 2RACA 1I7RB 1FL5B 1RURH 1XBDA 2Z31D 5FYLL 1ZTXL 5I28A 5KJRH 3MRPB 4JMNA 1ET8A 4KKBD 3EF7A 4TPRL 1U58A 1EO8H 3G08A 3WUWB 4LAJH 4PHXA 4QXWA 5KVMC 2QADB 1XR9B 2BNRE 4KVCH 3RBSA 5IQMA 1A14L 3EW3B 4GRMA 1DANT 3WEAA 3H3KA 4PLKC 1GZHC 2ZG3A 3Q2WA 3RAJH 5ITFA 4LSVL 1IT9H 4HSCX 1PY9A 4NLAA 1HYRC 4I87A 2V9QA 6FABH 1UEMA 4IRJC 2H32H 5I5RA 4G80A 2JV6A 2GB2A 1FFRA 3U7YL 5EF3A 4MBOA 1PCXA 1S5HB 1MXGA 2B2XL 5E5MA 2NY2C 2Z4TA 4JFXA 1I4FA 1NSNL 3C60C 3PQYE 4JN2B 3SOBH 3TN0B 3D18B 4OLZL 4UM9D 3IRPX 4YAQB 3O41B 3GSNH 3OMAB 3QUZA 2W0LA 3M6DA 1Z3RA 3BPOB 4KI5E 2D3LA 1HSAA 2IBZX 1VEMA 2VAJA 3KJ6L 4NXKA 5GIRA 3P3UA 2P8LA 2CKBB 1LMKA 5EF0A 1NPNA 4J12A 4Q6YA 4Y5YC 4KU1A 2COQA 4XOAA 4ZW7A 4EVNB 32C2B 2MQCA 4KTDH 2H6UA 5C6TL 3FU7B 3D51A 1C1EL 3J07A 4UV4L 3BVXA 3CHPA 1SZNA 5F9JA 1NC4A 1XCTB 3VFGH 4AMWA 3D0AA 4Z8FH 2ZD0A 3QDHA 1CYWA 2R0WL 2GCYA 5E03A 5AVYB 1J0HA 4IK7A 1JAEA 1E42A 3NIDE 3QR2A 4GFXA 3MCKA 5TK4A 5GGUB 2NY5C 1WBYB 4HCRL 2XU9A 3ASWA 4PMEA 3O8XA 4I89A 5DJ8A 1RULL 2B0SH 4E5XA 3QA3A 4OF3A 1T22A 4H1LG 1WZKA 1CI3M 3HS0C 4Z7WE 2HT3C 2GABA 2CMRL 3UAJD 3ARGD 5AKSA 3WJLA 3PU7A 5EEZA 1LDPL 2CLZA 1QEWB 4UQCA 2HVJB 4HW6A 4YBHA 4PSRA 5DMIL 1VA9A 1OAQH 3HS0B 3ZE2E 5BO1H 2LR4A 5LGHH 1YEGL 1KXQE 3QIUC 4ZX6A 3GF8A 5CEXA 5F7AA 1OM9A 1D5XB 1YEEH 2CDGB 3EYVA 2X3BA 4HT1H 3V2AR 3ZHFA 1HWHB 1QHQA 1R3JB 1VSCA 5CU9A 3DDFA 3L5WA 4ENED 4BFBD 1ETB1 1LM8V 4XN1A 2AMGA 3NIFE 4BQCA 5DEGA 5LXVA 2B8OT 1EHLL 2AK4A 2RFXB 1AXSB 2XFXA 4I88A 4UZSA 5LN8A 3RWJB 1IBZA 3SGDH 2NQCA 3PNWA 2IDUA 4M03A 5JLZB 4ONGL 5HHOA 4WGKA 5EU3A 4EUPB 2WAQA 1R5IB 3TCLA 1BDYA 1PQZB 3ZZLA 1QATA 2NY7H 1ZLUH 2JQMA 1TJIH 2YMOA 5LG6A 4ELME 1UTDA 2BVQB 2BXYA 1XSOA 2WXMA 3GI8L 2CKBL 1U3HD 2WWMD 1IB5A 2X2HA 4P5TC 2P46B 5MEOB 2ZE0A 5ID0A 3O3EA 4D0BA 4HPYL 1I1AC 2F7OA 2VN5A 2JKWA 4V11A 2MCG1 1BAWA 4MWFB 2EICA 4P23D 4HIHB 1T2QL 5IR1B 2VR4A 4P5TB 3L4XA 4N6RA 4MJIA 4TULH 2YZ1A 2ZP8A 5GS1A 2IOIA 1F3DJ 2YD3A 3GNMH 1TZHA 5F44A 2EXYC 2YPLE 1WE5A 4ECNA 2CIIB 2C1PB 2F54A 2X9XA 3MV11 3O0LA 4DT2A 4BELD 3BUTA 5KSAA 3PWPD 1DLHA 2VTFA 2NY5L 2WW8A 3GJFA 2BIQA 2J8UB 3WEMA 1EJFA 2NTSP 3VG9B 1XB3A 4FLOA 1KJVA 2BDNH 4IBUA 1NFDF 3DVGA 3O2VH 4YHKH 3ARDD 3NSYA 4XI5C 1HTYA 1BOGA 5DLML 1CIDA 1X4YA 2B4CL 3TJHC 4B41A 3UZVB 5IFJB 3BZDA 4RGOL 1TSHA 1EHNA 4GXUM 4OI9A 3VXTA 5CN3A 4OGAC 3EXLA 3RYMA 4UTBA 3MNVB 1AHMA 3WKMH 2H8PB 4YLCA 2CCLA 3VACA 1YMME 2E7LC 3U0WL 5H35A 3WTUA 1L9QA 4M7JL 4JN1L 1OPGH 4WTZG 4E41A 3EGXA 3N1PC 1Z5LA 2EO9A 3NPZB 1U2CA 1S7RB 4HU8A 2WGXA 1Z9MA 4L3FA 4L3EA 4E9YA 2VABA 3RWHB 4TL5A 4HIXL 1MFNA 4P0DA 1UKSA 3MRBB 5JIHA 3KVPA 4Q9CA 5GGVH 2WB7A 3B4NA 4ONHB 3AWFA 4M5TA 5T5FH 3QNYA 4UV7H 1JXFA 4Y19A 2JKSA 1S5IH 2OMTB 3FK3A 5D7LB 5E2VH 2IANA 3OHMB 3WN5A 2JB6B 4J4PD 2VR7A 2WKGA 3I02B 5IF0A 2FT6A 1OW0C 2PPEA 5J6HB 3EJRA 4OKVB 4GRWB 1VAHA 3LH2L 5GJTH 2ENYA 4PJAF 2LGNA 3O3BA 4PWIA 3MGTB 5B7EA 4G6AD 3P0VL 3WAKA 5HHPA 2BSTA 5ID1B 2B59B 2Y7MA 1GC1H 4JRWA 4NAJA 4NN5C 4ZJ9A 3TYGL 1MCOL 3OHXB 2VXVL 4ELDA 4HK3N 3HHRB 3WU1A 3NG5A 3KPRB 2X89D 3C09C 2Z93A 4ABQA 1J1XH 1TQWA 4GKZB 5C09D 1A4AA 1RU9H 1UT1A 4N1HB 4NWUH 4UT9L 4FNPA 1Y7VA 2Q5BA 5JOPD 1PG7H 4IRSD 2HX9A 2QSCL 3ZTEA 1KSRA 3PV7A 1UJ3C 4F2EA 4LHUB 4WUUD 2XZQL 1M7IB 4JL1A 5I8EA 2VLRD 3ZVVA 1UM6H 2EILB 5D7JA 4U6VH 3RRQA 1RUMH 2F8IA 5CD5C 1D5IH 3VGDA 3QZBA 4OJEH 2YBRA 4HUXB 1QBAA 2M26A 3D1MC 2XRAH 4OZFB 1B3IA 1U91A 5I74C 3WG7B 2OYKA 4NPYA 2Z7ZA 3WYRA 3S2AA 3F6LA 3ECWA 3CN1A 4KAQH 2BVPB 1ZGLM 4L23A 1HEZA 4WFEE 2J1WA 3D85B 3S9DB 2C5DC 2PUQT 3HG4A 3V0EA 2MNUA 3QDMB 3M1BA 4RZCA 4YHMH 3DIFA 1KCWA 1NLDL 2RIKA 4OBRA 4Q2ZA 5K39A 3LKQB 3FN9A 2YXVA 1B0RA 2WB1A 5BXFA 1TCRA 5D5ME 1G9MC 4WF7A 1RMFL 1RZKL 2BNRB 5AW5B 1OCRB 1D7BA 2ZUVA 2WXJA 5F1OB 4K2UH 4W9HC 3O4OB 3BE1L 1S78D 4JG1H 5I0ZA 1J0ZA 3M46A 3CXFA 5K9JL 3OKOB 1PX3A 1UWXH 1E3FA 2IGTA 2ZXAA 4CN4A 2ATKA 1IVTA 4MA8H 1DBAL 3KPSE 3G6AB 3MRPA 4WCYL 2KERA 4KI5C 5JPMB 4PW3A 5C0BD 2H3KA 1T1YA 1EZLA 1UH2A 2NYKA 3PQYB 3RTQC 1BQUA 4XPTL 5CILH 2E7HA 4AQOA 5CJ8A 3DX8B 5MP6H 4KKLD 2DLFL 1XR9A 1JERA 1EXGA 4RFEB 4YGAB 4AMKL 1CE1L 5TQ0L 2VQUA 3W2DH 2DLHA 3FN0L 5DQ9B 2O5ZL 1EBAA 3RTQB 3QPXL 4P2QD 2RGSA 1K4CB 2XWDA 5EOQL 2P48B 1DE4A 4M3HA 4PB0H 3BT2L 3E2HC 5EZPA 2BIHA 3QDGD 3DO4A 2IWFA 1CDYA 4M00A 1UD3A 3TN0A 3UEZA 4JN2A 3ZKNC 3D18A 4I0PD 3IMSA 3MYZA 2X4PA 2ZF9A 1UB6B 2P8PB 1QW8A 4UINL 2R4RL 4XP4H 1MAJA 3UACA 4YAQA 3RDTD 1AD9B 2VL5B 3E2HB 3TPUA 5LBVA 3EJSA 3WJJA 4Y1AD 1IC5L 3HEIB 1ZEAH 1DQML 5ICXB 3ZKMD 1COBA 3WELA 5HHNA 3K0YA 1SPDA 1KXVC 3S98A 2CKBA 3BRGC 1X5XA 1ZCRA 3NUKA 4Z7WB 4G42B 4X4ZA 3FOLB 3HC4L 1MIEL 4DUVA 4EVNA 1ZHLB 2MMXA 3QCVL 1W0VB 3FU7A 5FM8A 4NC1C 5CZKA 1T7XA 3WTWA 1XCTA 2C8NA 3MJ7B 4OLUH 5JO5B 1NCJA 3E8VA 5BRZD 2VMDA 3CHRA 5JQ6H 4AL8H 3WMSA 3VQ2C 2Y6TE 3VXRE 2IDQA 3ZE2B 3V0IA 1CBJA 2BIIA 2D7MA 3HZ3A 4LLVB 4P9MH 5GGUA 3ULVE 4KZ0A 1WBYA 2O30A 1FHNA 1MAKA 4Q8BA 4PLJC 5FHBH 3EJYD 4X6FB 5KG9B 3KDPB 3IU4H 3O3AA 2YEZB 3MLTB 3FB8B 4X6BB 3CVIL 3VXME 3RGVD 4M7KH 3ME0B 4E68A 4WWID 2Z1KA 1D9KC 2PYFB 5LBSL 3IDGB 5F0LB 4D9RD 2NQDA 1G6RB 3ATEA 4ZD3L 4PJXE 1QEWA 3LNDA 2HVJA 5JMRA 1X44A 3WKPA 2V6HA 4YIQA 3HG0A 4XO3A 3JZYA 4MQTB 3EJZC 1NAMB 2JFCA 3QSKB 5F3HB 1MCCA 1OAXL 4GG6E 1O9WA 3QUXC 3HR5B 3OAZH 4HOMA 5C0DB 1NUGA 4M1CC 2IG2H 1D5XA 2G3NA 2CDGA 3MREB 2ZX7A 3F64A 4BWTA 4ELMB 1MRCL 3DOIA 4HA1A 1MJJB 4P4RB 3LHAA 5HGHB 3ZYIA 3TFKC 3D39A 3MXWL 3QUKA 3GXMA 1BXXA 2ZONA 4QTHA 2F53E 2RFXA 5BJTA 1OEZW 3RWJA 2BW5A 4GSXA 4WK2B 5EO0A 4HPOH 3RVXC 5C8JB 4APQD 1AO7E 3QXVA 5JLZA 4EUPA 1IGYB 1R5IA 2R2EB 3G04B 4B97A 2ZXBA 4C4UA 2H1LM 3CTTA 5LCVL 3ZHNA 1MNUL 3LDBB 4K8RH 2YPLB 1IAIL 1UEYA 2BVQA 4UTAH 2WN3A 5EMYA 4BRVA 2DD8H 3LXCA 1XIWD 5LQBH 3CFMA 4R4BB 1WIUA 3JQOB 4LOVA 4YOKA 2WAHA 3BLKA 3D4CA 1ZE3C 2VC2H 2D73A 3HI5H 2R8SL 5MEOA 4W70A 2MRYA 3OKNA 1ZVYA 2E7CA 4JGUA 2UUDK 1ZTMA 4IKIA 4MWFA 4N24A 4RIRB 5TH2B 3IVKB 2RCSH 4HIHA 5IR1A 5E5LA 2F61A 4HETA 4FE9A 2XVKA 1W72A 3QC6X 2AITA 2C1PA 2CIIA 1RKRA 3EYFB 2UZYA 2NY1C 1F56A 4A7TA 4FABH 1S7QB 4MTMA 2IH8A 1BZ7A 1YMMB 1MRDH 1AZRA 5EU6D 3Q2LA 5F97E 1KPVB 4FQ2H 1TQBC 4NDMB 3BRFA 1A5FH 1P4IL 3PYCA 1UA3A 2J8UA 4UBDC 4V1DE 2A9MH 1UXLA 4A68A 5B38B 4Z3EA 2NY1B 3QUYB 4K7PX 3P4MB 4Q9RH 1NAML 2HCZX 3IDMB 3BYYA 3UZVA 2FB4L 4AEHL 3AY2A 1MPAL 4N2MA 5CLTA 5JTWA 4KHXH 4ODTH 4D8PB 3MNVA 4FNLH 1EXUB 2GJ6B 2H8PA 1LK3H 1MUJB 1H9DA 1HJCA 1JMZA 4N0FA 4PG9B 4XTRD 2EADA 1C7SA 1S7RA 4NO0B 4ZAKA 4DZBB 4L3CB 5HVWA 4ONFL 5CINH 3KL0A 3GBNL 3RWHA 3V0HA 4QRPE 4OGZA 3IJEB 4L37B 3MRBA 2WCSA 4L2LA 4KTYA 5AKVA 4UOQA 3KCPB 2OMTA 5I1GH 1ZLVH 1F8TL 1WHPA 4XX1G 3ZZ1A 4EZKA 4J3UA 2C3HA 3U2IA 2JB6A 3MJ6A 3UBXG 1Q0XL 2G3MA 3I02A 1HAUA 3WN5B 3FHQA 2F1EA 5AAWA 4QXTB 2FATH 3HB3C 2E9BA 4BA0A 1AKJA 1BQHG 4AQ1C 3MGTA 4RETB 2WV3A 4CMHB 1IAOB 1S7VB 2B59A 5ID1A 4L18A 1NCDH 1ZT1B 2O61B 4LSRL 1OQOA 3OHXA 3EDEA 1OTSC 1QKZL 4MSWB 4XWGH 4C59B 1E7UA 3MQIA 3KPRA 3P4LA 4ZUUB 5JIKA 3LN4B 2D03H 3B56A 1AXTH 4H0HB 4PJGA 1GRWA 3GIZH 4NGHL 3AT8A 3KR3H 2CHZA 4GKZA 4LP5A 1LJMA 4YHOL 4IJ3C 1HXYB 3KWUA 3U82B 4AT6B 4LHUA 2VKWA 1M7IA 4FHJA 2WK2A 4H26A 4LIQE 3I3EA 1DSYA 4UQAA 3SQBB 3SY0B 1PKQA 2FSEB 4TSAL 2YR3A 2AGJH 3E1F1 3F84A 3QPKA 3W57A 3QDAA 4LLQB 4DP9X 3QIBC 4JFYB 4NHUB 1J10A 3N42F 4DJMA 5D5MB 3KE0A 3QQ4B 4HLZG 4HUXA 4G83A 1MZYA 1PPIA 5GJSL 3H9YA 4MNQD 3UAFA 4S11A 4DEUA 2KDGA 1LO3L 1OM3L 2BVPA 1AGFB 1H3GA 2NNRA 3FFCE 3UYPB 4EAEA 2LLNA 5TFSH 3D85A 4EDXB 5I6MA 5AB0A 1I8LA 1XZWA 3HBGA 12E8H 1EANA 4IYKA 3QDMA 1CIUA 4BE6A 3KPSB 1ULVA 2NW2B 4LCVA 1V5JA 2LU4A 4MZIA 3DETD 3MRIB 3LKQA 3F8UB 3V0JA 1EAPB 4M8QB 2D7TH 5B4MC 1NZRA 4FG4A 2ATAA 1A3RL 2DIAA 4BKTC 1E4KA 4QPEA 2FH6A 4DP7X 1OAZL 2DWYA 2WLZA 4L29B 5EG6C 4XAKD 4LAQL 1VFAB 4ZSOA 4QHKI 1OHZA 3OKOA 1M3IA 3UJTL 3O6FD 3L5XL 1G1OA 3TBTB 5C0CD 4I1NB 5LBSA 4Z3GA 1NGXA 1Y6KR 3SPCA 4X4YB 3SO5A 5JPMA 2Z35B 1PZSA 4OZIE 2IOMA 1EHKB 3PQYA 3ZJAA 4UILL 4H88H 4R3SA 4FQ1L 5C3TA 3DX8A 4RQQB 1M2OA 1NCHA 3H9ZA 4XRCB 3PABB 2YPVH 4A2FA 5J4MA 2K8QA 1TQVA 4ZW5A 1NFKA 1PZCA 3OL2A 3WFBL 5I5MA 4I9WD 4NYLB 5DQ9A 4PRHE 5HDQH 3UH8A 4IBVA 5CUSL 2GUYA 35C8L 2OI9C 3NPSC 1EO8L 3MV7A 1K4CA 4H5SB 3LQZA 4ANVA 1XT5A 1AHKA 1UT2A 4Q58C 1JF1B 1QNIA 3ULVC 5IBLD 1DQIA 4YVUA 3GBEA 2OSWA 3JV0A 1JFQL 4K3GA 5T1DH 5C0GB 3WIFB 2ZICA 2VL5A 3VXRB 4ZODA 4GMTL 1DHKA 1UWGH 3AT9A 1IGCH 2Y36H 1L5GB 4D7BA 4JKKA 4U4BA 5ICXA 5LCVA 4BM7A 4KPHH 2O5XL 1P1ZB 3F7YA 5H37G 1FGVH 4FJYA 4HG4J 3GLEA 1J1PL 4KQ3L 1TZGH 4Y0GA 2YGQA 3O4LE 1U92B 3DXAD 1E6JL 4G42A 3FOLA 5T1LA 1U33A 1ZHLA 1QR1B 4H7VA 1W0VA 1O9VA 5BOZG 4NQQA 4QTFA 4PJXB 5JO5A 3MJ7A 2I5YL 3DX4A 2DJSA 1IM3B 1D5BB 1MCPH 3CSPA 3H6AA 1T6WA 3FRPB 3RKDD 1CZ8L 4LGRB 3FOMB 1UZ6E 4ZS7L 4TSCL 5HYEA 1L6PA 3Q3GB 4AGQA 5HPMB 1KXQA 1BZDA 3CG8A 3D9AL 4IS6B 4P06A 4X6FA 5AOJA 5IVZB 1RI8A 4QD2E 5E56A 5EDXA 3B9EA 3AVEA 2ESVD 3MLTA 3FB8A 2NOYA 5KBDA 4FYTA 3ALWA 1ZD6A 1IZJA 4GIAA 3ME0A 5ALBH 3ZUNC 4G82A 2BFVL 2PYFA 2JKXA 1G6RA 5C7ZA 3F00A 1P53A 4HQQH 1PAZA 3A0OA 4KKBC 2F53B 2YPKB 5EV7A 1MCBA 5FO9B 3FQUB 3KWVA 3OMZA 5F3HA 1AO7B 1JD9A 5HJDA 3B7SA 5IOPB 4M5ZL 3HR5A 4FG0A 1KB9K 2EIZB 2IPKB 2D31B 4H8WL 3VD9A 5F3BB 2EDRA 1KENL 3DYPA 4QY8B 5KBKA 2XWRA 4TQPA 3SDAD 1CK0H 4M56A 2FX8L 1GR7A 1NA8A 5IHBA 1MJJA 2J12B 4QHKJ 4X80H 5HGHA 2K6YA 5TE6H 3UADA 4AC2A 2R4SH 2G75B 3CFDA 2XZAL 2WWNA 4G7VL 4JFSA 4HJ0D 2WXPA 5C8JA 5HSFA 4MCMA 1ZWIB 4KO5A 4TUOB 4KO9A 1M7XA 4KMTH 4A39A 4OFQA 4JFFE 1IGYA 5KVEE 2FEEL 2R2EA 5IJVB 2VLKE 1IFHH 1ODUA 2DQCL 4K71C 1I9RH 1VIWA 3GO1H 3LKSB 3ULVL 2ICWI 4P46A 3RVUC 4KVPA 2YPLA 3QUMH 2XY2A 4S1QL 2J57A 1DVFB 3U6RA 3HJEA 3FO1A 4R4BA 3D0LA 2QDVA 3C08H 3KVDD 2ITEA 2GJZB 1REIA 4GEIA 3WJMB 3HVDA 1RJYB 3HZVA 5IROA 2ZKHH 2EXTA 4UIMB 2J8UF 1GC1C 3VFUB 4RIRA 5TH2A 4HG4K 1QWHA 5DVNA 2WN2A 3NEOA 2FLBT 3BMVA 3GXNA 1QFUH 2CXGA 3NIGE 3EYFA 5DZLA 3A47A 1S7QA 4AIZB 2YFNA 5JHDD 4HJTA 1HHGA 4LU5L 4P2RE 1YMMA 1QNZH 1OY3B 3ECBB 2Y0SA 4NDMA 3JVGC 4LPWA 1GOHA 3VFMB 4WTWA 4KK9D 4KX7A 5GRJL 2PETA 1U8JA 5B38A 3DIDA 3P4MA 1Z9LA 3NH7L 4QRPB 3FONA 5HDBE 3SDCC 1KBPA 3IDMA 2J1XA 1FE8H 2NUPA 1QLEH 1I3GL 4R7VA 2R69L 4X6DE 1EEUA 1MFMA 4HS8H 4XC1H 2WVSA 4EQ2A 4XPAL 3H9SE 4D8PA 3J2PA 1CYGA 1EXUA 1F11B 1P7QD 2YD5A 1GHFH 2GJ6A 4YHKL 4LOFA 4P07A 5DUPH 3U6XS 2VNCA 1Q9LA 2ZUXA 3ZOAA 4N0YL 3EH3B 4XMPH 4PG9A 5DF0A 1Z32X 1YAIA 1M42A 4HWBA 4NO0A 1I1CA 4X9HA 4L3CA 4DZBA 5BZWB 4EIUA 3WKNA 4DP5X 4GRWF 4HUVB 5CP3A 3TV3H 4K55A 3IJEA 4MCZB 2BP5M 3CFCL 4L37A 2BSDA 2VLLB 1BIHA 2EE9A 1D5MA 2E6PA 4POZC 3KCPA 1P6FA 4O02H 4R4NC 4FG2A 4OCSH 5DK3A 2WWMC 4XNXH 1PLGH 2NLJB 3OMNB 3AACA 2VR9A 5LKNA 1H9VA 2DF3A 5DJAB 2WLLA 1DDTA 4PJGF 2FZ3B 2IH3B 5KAQF 2Z4QB 3CC5B 2VJ0A 3FTXA 2YFOA 1P6AB 5E2JA 3IXTB 1IAOA 1S7VA 2AJYH 4IU3A 4NIYE 1ZT1A 3G5YB 3NCMA 1V3JA 3X1GA 5DURD 3N6YA 2R56H 1INDH 3MNZA 5LGJB 3FHEA 4MSWA 3AAZB 5IT2H 5B7MA 2EUWA 3REVB 4L4TE 3MACL 3LN4A 3HUJA 4HU2A 1RJZB 4ILDA 2HUEA 2ZUWA 2W0FB 2NXYD 3DWTA 5HGDB 3NESA 2IGFL 1Q1JL 3EH4B 4DK3A 4YSAA 3FFCB 5IHHA 1BEXA 1HXYA 5EZOH 1VFUA 4YE4H 5DUML 3D7PA 4AT6A 2H2PD 4PV1C 3ARDC 2QDWA 4CJ1A 3SQBA 1U2HA 1QFOA 2FSEA 4GUOA 3NJKA 2AJSH 1PVHA 4RMQA 3MRLB 5IHZB 2KI6A 3VFTB 1NBVH 2R51A 2R9HD 4JFYA 3ML9A 3BSHA 4NHUA 5C0IA 1Y1UA 5D5MA 4PV8B 5CEZD 3AXIA 3T2OA 3T3PF 4F91B 2DWSA 3MUY1 1LLAA 2CRMA 2UXGA 3AQXA 2ZJSL 1RUQH 2MQ0A 3ARPA 2WANA 4ZUWA 2YA2A 3MLZH 5DLLA 1N7MH 1AGFA 1MVYA 1YQVH 3IU3B 3NCBB 4QXGH 1SM3L 3K8KA 1HE8A 3UYPA 1XR8B 1D5IL 4EDXA 5GZNC 1XEUA 5CIPB 1FRGL 4YDKL 1U2YA 3EGSB 5BPPA 2NMSA 1MCNA 2Q8AH 2NW2A 4HAFA 1B4JL 2VW7A 1PF3A 4KXBA 4OZIB 1EAPA 4M8QA 4OF0A 5LLIC 2ZKYA 4AL8C 5I1LB 1DVSA 1IFRA 4IBZA 3HE7D 5G4NA 2EYSB 2Z8VC 4FLSA 3A21A 1OE2A 3LIUA 4JO5A 3VE0B 1WTLA 2K8MA 1CFQB 4QRQA 4G8EA 4KO7A 4YBLC 4L29A 5B3JF 4PRHB 1NCWH 4MLSA 3MRMB 1VFAA 2CGYA 1JVLA 1X9LA 4JO2L 5SX4I 5E8DL 5AOZA 1TLMA 3HG1A 3B6SB 4HD9A 4WJKB 2B77A 3TBTA 5FOBB 2EXSA 4X4YA 2XWTA 1QABA 4LIQL 5C2UB 2Z35A 4JHWH 1TO4A 2AABH 4WI2A 1QG3A 1F3DH 1KELH 4RQQA 3HRZC 4GS7C 4XRCA 3PABA 3C2AH 4FDWA 2Q9OA 3AUVA 5ACZB 1ZPUA 3GRGA 4MA8L 1KLFB 4PCKA 5I9QC 2WM0A 2AMUA 4NYLA 4JO4H 3WN6A 1C08B 1G7IB 3FUKA 1MFBL 2WINB 4H5SA 3QIWA 3SDXB 3O4LB 2BC4B 1JF1A 5A2AA 3BAIA 3AG1B 3EYQD 1XXFC 3K91A 3CDFA 2ERJB 2WXNA 5C0GA 5F6IC 4PB0L 3VXRA 2HRGA 4ORGA 2HUHA 3ZKXC 1L5GA 1JZFA 1QSFD 3ZE2F 3HG3A 1O0VA