2BIHA

Crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
453
structure length
453
Chain Sequence
b'PFPVRQDSPLTEVLPTDLKTKDNFVARDPDLLRLTGSHPFNSEPPLTKLYDSGFLTPVSLHFVRNHGPVPYVPDENILDWEVSIEGMVETPYKIKLSDIMEQFDIYSTPVTMVCAGNRRKEQNMVKKGAGFNWGAAGTSTSLWTGCMLGDVIGKARPSKRARFVWMEGADNPANGAYGTCIRLSWCMDPERCIMIAYQQNGEWLHPDHGKPLRVVIPGVIGGRSVKWLKKLVVSDRPSENWYHYFDNRVLPTMVTPEMAKSDDRWWKDERYAIYDLNLQTIICKPENQQVIKISEDEYEIAGFGYNGGGVRIGRIEVSLDKGKSWKLADIDYPEDRYREAGYFRLFGGLVNVCDRMSCLCWCFWKLKVPLSELARSKDILIRGMDERMMVQPRTMYWNVTSMLNNWWYRVAIIREGESLRFEHPVVANKPGGWMDRVKAEGGDILDNNWGEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NITRATE REDUCTASE [NADPH]
publication title Structural Basis of Eukaryotic Nitrate Reduction: Crystal Structures of the Nitrate Reductase Active Site
pubmed doi rcsb
source organism Pichia angusta
molecule tags Oxidoreductase
total genus 137
structure length 453
sequence length 453
ec nomenclature ec 1.7.1.3: Nitrate reductase (NADPH).
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2bihA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 2bihA01
3HBQA 1XDYA 3R18A 2A9BA 4PW9A 3HBGA 2BPBA 3HC2A 1OGPA 2A9CA 2CA4A 3R19A 1SOXA 2A99A 2A9AA 2BLFA 3HBPA 2CA3A 2BIIA 2BIHA 2A9DA 2XTSA 1XDQA 4PW3A 2C9XA
chains in the Genus database with same CATH superfamily
2WTPA 5I76A 1PTZA 4JJ5B 4JJ5A 5AL0A 3Q5YA 5I76B 1KJVB 1KJVA 2EIEA 2GK0B 2GK0A 4WEBL 3T8VA 1I8MB 1I8MA 2FBJL 2K3HA 4PV8B 4PV8A 1U3NA 3L4ZA 2Y06L 3CQFA 1TTRA 2CHXA 2E7DA 2MIZA 4JDTL 3VGHA 3BPOB 4H44C 1SJEA 1SJEB 3FN0H 1R24A 1R24B 1WH0A 2GB2A 2SODB 3EH5B 3H0TB 3H0TA 3NSCA 1NC2B 1NC2A 2GABA 4TMPA 4I0PC 4JR9L 4G9FE 3FO0H 3SDDD 3T0EC 3IVKA 3CSGA 3WG7B 3IVKB 3B9DA 1F6FB 1N4XL 1RP8A 3NRPA 5EC2B 1M57B 5EC2A 5AB0A 4NFBA 4NAJA 5HHME 4KU1A 3P0YH 2MQCA 1D9KA 1D9KB 2VISB 2VISA 2FQEA 4BEIA 3SSGA 4X2UA 4W68A 4Q52A 2NRDA 3BZ5A 3VU2A 4Q9BA 1IKFH 5CILL 4PVNA 3IMWA 2XVBA 4UBDD 4EI5C 5D55A 2YR3A 2XN9A 2XN9B 3B2UC 3WFBH 1S5HA 1S5HB 3QCUH 5L88H 5MHSE 5CR1A 3UACA 2PR9A 4G1MB 4G1MA 2I07A 2I07B 1ZXQA 2G0LA 4R7XA 4BHUA 1ZLEA 2P48B 5LAPA 4DK5A 4HJJL 4Z3EA 3REVA 3REVB 1SXCA 1HXYB 1HXYA 1R5WB 5AVTB 5H37G 5CCGE 4H1LG 1J1XH 1A25A 4WWKB 3IPBA 4WWKA 4HWBA 4PJIE 3LNIA 1P84J 3AQDA 3D52A 4YFDB 1ETA1 1MZZA 3T3PF 2ZYIA 2CNZA 5T5FH 5KSBE 2BIOA 4TF4A 5C0NC 3J27A 1HTYA 1FYTD 4ZFGH 4P3CH 5J4MA 2DYSB 4R5VA 3ALPA 4N2IA 4RAUB 4RAUA 5SWQA 5SWQB 2IV8A 1IGTB 1IGTA 1XZ0B 1XZ0A 3N91A 4MJ6A 4MJ6B 5T1MB 4X7SL 3HUJE 2IPTH 4XMVA 4X9HA 3TP4A 3RU8H 3VM5A 1PY9A 4N6RA 4N6RB 1ND0B 1ND0A 2VSMB 3GXDA 2IGLA 4BFEA 4CSZA 4Y4HD 2HLEB 3NDZE 4XPBH 1BMWA 1UC6A 4PJ5A 4PJ5B 4FYTA 3NTCH 5CIPA 5CIPB 1CE6B 1CE6A 2QGCA 2V3FA 3U9UA 3U9UB 1NCGA 4LSVL 1XIWC 4OGXH 1KXTB 1AC6A 1GJUA 4W4OC 2W94A 4LCYB 4LCYA 4OCRL 5AW7B 3HNSL 1IC7L 1KUMA 1BQSA 3B2VL 2ILLA 2JF1A 3HI6H 2HT2D 1ID5I 1EEYA 1EEYB 4HMDA 5EZOH 4JRFA 2NY1B 3U48A 1G7QB 1G7QA 3IJSA 3IJSB 1UM5H 3MJ6A 3MV7E 4M93B 3VG9B 4XHQA 3NJIA 1MNUH 1WJ3A 4LLVA 4LLVB 1RUMH 2DZEA 1SFDA 3NJJA 3HW7A 3R7QA 3H54A 3ULVC 1BGXH 4LHQB 1KJ2L 3F00A 3C8DA 2EADA 4J6RH 4AM0B 5CLXA 1AGEB 1AGEA 4AM0A 4G83A 2R0ZL 3C60D 4EN3C 3WNOA 1A4AA 4B5ZA 1CD9B 2ZUVA 3CZNA 1Q94B 1Q94A 4GAAA 2Z8VC 4PJ8C 2VZOA 1V55B 4PJGE 3SDDC 5BVPH 2TRYA 4ZW6A 2A38A 3ZXAC 1RZKH 5FCUH 1DBKH 1IGIL 3DRTA 3DRTB 4H13C 3PWJB 3PWJA 3WKQA 2FX8L 4YFLF 3SZ6A 5BUGA 2OQJA 2OQJB 4MS8C 3X3GL 5EF3A 2DMCA 3OLEA 3ZDZF 4C56E 3KM1A 3LQMA 2FWOA 2FWOB 2B15A 5KBDA 3H1ZA 1DBJH 1G9NH 1UXSA 1UXSB 4UM9A 4UM9B 5I1KL 4WUUE 1XGPA 1XGPB 2GY7B 3DX0A 3SGKA 3VB9A 4IW4C 1OAKL 1ECYA 1V54B 2X2IA 2ZKWA 3EBAA 4XPFL 5GGTL 3ROOB 3ROOA 3ME0B 3M6DA 4JO3L 4JM2B 4JM2A 1W72L 1A1MA 3ASWA 3M86A 3QK0A 3INUH 5INCA 5INCB 1KMGA 4D9QE 3FOLB 3FOLA 5D5MF 3UZEA 5F9AC 1VERA 4FQIL 1VENA 1Q0EA 2PWHA 1EEQA 4PVBA 1PZCA 2E7HA 1IBZA 1OK0A 4G6KH 2R8SL 4J1UA 4J1UB 4JQVC 3ZZSA 1I31A 3CAFA 5JXED 4LP8A 1JF5A 3NJKA 3PCYA 1BF5A 1IL1B 1IL1A 5DQJB 5DQJA 2BERA 2AJXH 4PBWD 2KS0A 4LZKA 3B6SA 3B6SB 3IKCB 3IKCA 4KDTC 4ZODA 3LN9A 3C6LA 1QLEH 3C6LB 4NBZB 3OJ2C 3SDAA 3SDAB 3O11A 3O11B 3WIHA 4P2OD 3VGFA 1G4RA 3BAEL 1TQBC 5D1ZD 2VLKA 2VLKB 5DWPA 1J5HA 3C8KB 3C8KA 1E5BA 3EUDA 1IIKA 4MA7H 1KZQA 5J0BA 1D7BA 4K5NA 3UZVB 3UZVA 4DZ8A 4DZ8B 4UUJB 4UUJA 1SM3H 5CINH 4HWNA 4D3CL 2R0WH 1YAZA 5GJSH 1PMYA 4E9SA 3RVVC 2VAAB 2VAAA 2NY4B 1M3IA 2Z65C 1UD2A 1E4HA 4U0QB 3NCJL 1THAA 3RZWA 1A7BA 4GINA 2Q0ZX 3RWDA 4HIQA 3RWDB 5MEQA 4OCSH 5MEQB 4XO5A 4B9KC 4PGBA 4PGBB 4AVJA 2J56A 3IB4A 5DJ8B 5DJ8A 4LARL 1C5CL 3DMMD 3FCGA 2VJ0A 2YKLH 2DYRB 3FB6B 3FB6A 4TPRL 3ZKSD 3SGJA 5F9WB 3KMDA 2EE6A 3GO1H 4JZOA 4JZOB 4S0TD 3SKOA 3SKOB 2DOCA 2WN3A 4ECNA 5T1JA 4J39A 2WKOA 3O9WB 3O9WA 4FKKA 4XX5A 1BM7A 2YN3A 5KZCD 5J1TC 4Y89A 2QVIA 3TA3B 3TA3A 5BO0D 1TEYA 1TZGH 2PO6D 3N43B 3N1GC 3S5LA 4TNWF 3S5LB 1MCLA 2N7BA 4KRPD 5AZEL 3TN0D 3ZE2E 5J56B 2XA3A 2KZKA 5KVEH 3UOAB 1T0OA 4AYFA 4AYFB 5AG8A 5B8CB 5B8CA 3NRQA 3P9LB 3P9LA 4MCNA 1CK0L 2IGFH 5BVJB 5BVJA 3H3KA 4KKBD 2BSRA 2BSRB 1EJ8A 4L8DA 3GK8H 4L8DB 1DLFH 2OS7A 4AQEA 4AQEB 3K0YA 2EUZA 2VDPB 4LPVA 4N2FA 5FM5M 1BEYL 3N42B 2DKSA 1PF3A 2DKUA 5MENE 5D7KE 1HEJC 2R7EB 2R7EA 1AHWB 1AHWA 2BOBA 2BOBB 3GNML 3NCEB 2YD0A 5B3SB 1ZMYA 5K9QG 2AABL 1G7HA 1G7HB 3QG6A 3QG6B 4ADJA 5AOZA 5KW9L 3H2PA 1VEPA 5DLMH 3U9WA 2AXHA 5A2FA 2DL9A 3MV9E 3CLFL 5KTEH 1QEXA 2Y07H 5I5MA 3I50L 2B20A 2C9UA 3EJTA 4TUKL 4AL8L 3S5LG 4YDLB 4C4BA 3T0WA 4RISL 4L2LA 1G0DA 4UAHA 1QTSA 2BJML 1TQUA 2YJLA 5AAWC 3GD1C 4XOAA 3JBG7 4NRZB 4NRZA 2XQYA 1FL3B 1FL3A 3HR6A 1HHJB 1HHJA 5IF0B 3VYPA 5IF0A 3TFKC 1JP5A 1D5IH 4XXWC 3AADB 2WNKA 2XJLA 4FI8A 3H53A 4IIQC 4WU5B 4WU5A 5DRZA 5DRZB 4PGEB 2Z1PA 4PGEA 2PWDA 4FLOA 1H19A 2MCAA 2IH8A 4D9LH 1JE6A 3C2AL 5IQ7L 3IS1X 5DFAA 1UWEH 1A4CA 3BH9B 3BH9A 1MCHA 5DS8B 5DS8A 1LE9B 1LE9A 1LO2L 2VLRE 4IEFA 4IEFB 1BQKA 3KM2A 4DKEH 4M1CC 3D3VE 3O6FC 3CSYA 3CSYB 4LP4A 4DW2H 4AQZA 4UWQB 3W0WE 4AUUA 4HVBA 1RK0B 1RK0A 4PV1C 5A2LH 5EB9A 1R5IB 1R5IA 2XKSA 2YAQA 5ESVB 5ESVA 3WUZA 4BZ2L 5F6IB 2R1XB 2R1XA 4KXAA 1KIPA 1KIPB 1IJ9A 4ZXBD 3DYPA 1NLBH 3V0HA 4GMSH 4IRJC 5F97E 5TQ2H 1MCWW 1AI1L 2NLJA 2NLJB 5GGUA 5GGUB 1T1WA 1T1WB 2WANA 5K1VA 1Q90A 4IBWA 1T5KA 2HPTA 3VFUA 3VFUB 3LXAA 4A67A 4S0HA 5IBUG 2VN4A 2YEVB 3IDJA 1HAUA 3IDJB 5E5LA 2FH8A 2J8UB 2J8UA 4F57L 4ETQB 4ETQA 1BW8A 2MHAB 2MHAA 4P3WA 4NKDA 4NKDB 4PG9A 1SN2A 1EFXD 1XHHA 4PG9B 5JTWA 4BQCA 1GR7A 1SVBA 2DIAA 1IM3B 1IM3A 1BQLL 3QHFH 1Z9OA 4PRBB 1S5IL 4PRBA 4NM8L 4A6YB 4A6YA 3ZW3A 2C9VA 1XF1A 4QTFA 3WNLA 3ZVVA 2X53A 1DE4A 1DE4B 4P2QD 1A3RH 1MI5E 2W88A 1X5HA 3OMAB 4X7DC 3VH8B 3VH8A 1QNZH 2J1WA 3ZHDA 4AUYA 2Y72A 5ISZE 1XH3A 1XH3B 2IH9A 5C0BB 1AZZC 5C0BA 2YQ2A 4P2YA 3WNMA 2YPLE 2EH7H 5SX4I 2CK2A 5I6KA 5IUSA 3FU5A 5AQ0A 3M88A 2E7LC 1EANA 4M3HA 1NGXA 1NGXB 2WNWA 3CSTA 3E8UL 4AYEC 1UXLA 3ATEA 3ABMB 4Y2DA 4Y2DB 5F7EL 3QG7L 1FGVL 3GKWH 5JR1L 1RUKL 2E76C 1T03H 1LK2B 1LK2A 2OPCA 4YQXH 3FONB 2B9AA 3DSFH 3FONA 4B27A 3GDCA 2GBAA 2X70B 2X70A 5DVNA 3VGAC 5FECB 5LO7A 1F6AA 1F6AB 4DP7X 5TK4A 1K72A 4TNVF 2HXAA 1A6UH 1TQCC 2EDLA 2B3RA 2K1MA 4NKOA 4MA8H 4KX8A 4NKOB 3GDBA 3GPSA 3RWIB 3RWIA 3ULVE 3OR7A 2GHWB 3OR7B 5IBLC 3QDGE 1SRDA 4DPCX 3K5SA 1VZGA 3RGHA 1N8OE 1UKQA 1VACB 1VACA 3LZNA 1V5JA 3QGVA 2ATPB 2ATPA 1KENL 4APQB 3CSPA 4A63A 4APQA 3BKYL 4HK0A 4HK0B 1XAUA 5BW7A 2X6BA 3WHXA 2XY1A 3WHXB 2RCSL 2DM7A 2JFCA 4G59C 5AZ2L 1OTUD 5GS2D 5ACZA 5ACZB 5EBGA 2G5RA 4YOKA 3MBEC 4TQEL 4R2GB 4LOVA 1VA9A 3WE6A 3WE6B 1YA5A 4GPVA 2RALA 3CZEA 4PGCA 4PGCB 2XUWA 3CDFA 4ZNCD 1XDTT 1EJOH 2AXWA 3MRCB 3MRCA 4GBXD 1NMAH 1ZCRA 2UXFA 3TS8A 1WFJA 2PPDA 4FAAB 1NBVL 3DA0A 1YC8A 4UTBA 1WF5A 5I5IA 4TQ8A 1UJ3C 2HZHA 5I9QB 1AO7A 1AO7B 4YUEH 4OV5A 4OV5B 2MPAL 5HHVH 5D93C 1DCLA 4OZGA 4OZGB 3MUY1 1PKQB 1PKQA 4LXFA 4F9PC 3LMJH 2AZAA 3AS1A 5B38G 35C8H 1QLFA 1QLFB 1U91A 1U91B 1Z3GL 4P5KA 4P5KB 1ZLSH 5ID1B 5ID1A 5FX3A 4FI6A 4P49A 4TVPL 3FH5A 1EO8L 2KL6A 1BM3L 3QYMA 1B4JL 4EIBA 4WUKH 5FYJE 4KFMA 2NYKA 4B60A 1JGVH 3OWEA 1H3PL 4BK8A 4B5EA 1UOWA 3VI4F 1ZPUA 2AEQL 2QQKH 1F3RB 2DTSA 2ZXCA 3CK0L 3N06B 4GSUA 4R4FH 4ZXBC 2NY2C 1DVYA 4EXPX 3QZWB 3QZWA 4MQTB 4FFWD 1CD0A 5E4IA 3RUGF 2JSFA 3QS3A 1QAWA 3PWPE 1VEOA 2HX7A 3D4CA 2BVPB 2BVPA 3ULUC 3F2LA 1U2HA 3GTNA 3OV6A 4G6FB 4RRPM 1RP9A 4MQXD 4QKTA 2ZKHH 4OZHE 1ZXKA 3WJLA 4GFTB 1XF2B 1XF2A 1X5AA 1AKPA 2E6QA 2CRMA 4JFXA 4JFXB 1E5YA 4PVMA 3VRIA 3VRIB 2V5SA 2WJ7A 3IJ8A 3PABA 3PABB 5J7CC 1LO4H 2CIKB 1R3IL 2CIKA 1DVFC 4P5MB 4P5MA 5E4OA 3KR3H 4BCYA 1ACXA 2I9TA 1FF5A 2DQHH 1SGKA 5I1GL 2I9TB 5IHUL 1MY5A 5ENWB 4JFEA 4JFEB 2YEZB 2YEZA 5ENWA 3FN9A 4PSPA 3UZQB 3UZQA 1UGNA 4N1CA 1U3HB 1U3HA 3ESPA 3F3HA 3HFML 4M3JA 4GSQA 4NKIH 3PPSA 1CGUA 5DJCB 5DJCA 3TA4D 3WTUA 5ABAA 3D9AL 3HG1E 4QHKJ 4ZMVA 3O8XC 4PTTB 4PTTA 5BRPA 1SOXA 4XO8A 2O6DA 1T7YA 2HP4A 2NNCA 5D6DC 2NY7H 3HLKA 2PR4H 3TM6A 2HTLD 4LNRA 4LNRB 1TZ8A 1F8TL 1TZOA 2ZCKH 4P2CG 2ED7A 2H5UA 1PD0A 5HHXH 4UV4L 4NUQA 3TBVB 1UOKA 3TBVA 1CDYA 3UBXB 3UBXA 1XQ4A 1IE5A 1F18A 1IVLA 2P8MB 2P8MA 3CGTA 4HCRL 2IDUA 4S1SL 4AEHL 3CZSA 1CLVA 3V4LA 5IM7B 2WWNA 5IM7A 4HHWA 2PWFA 4IBVA 4TSAH 3VO0A 5I28A 2QEJA 1UZ6F 5JORB 5JORA 1MWAL 4M5ZH 1J5IA 3WLWC 2EUVA 2OMTB 2OMTA 3BYYA 4EUPG 2H1XA 4KKNA 4Z7NF 3EYSL 2YD5A 1FNGA 1FNGB 2W38A 4UCFA 1LYQA 2PPAA 4HWEH 3KS0J 3TASA 5C2BL 5DWUH 2ZWLT 2FWLB 4HLEA 3IN0A 5E4AA 4NWTH 1ZDQA 3V10A 4LQFL 1IBFA 4GBXC 1INDL 3SDYL 1X5XA 3T0AA 1QX1A 2XTLA 5L7XH 5E9AA 5KANG 2DQCL 1BOGB 1BOGA 3G6JA 3G6JB 3G7TA 1JZDC 3JV0A 3P02A 3RJOA 3WY1A 2P8LB 2P8LA 4AV4A 4DP8X 4L8SC 1S3RA 1ZTXH 4W9KC 4W9GC 5HGDA 5HGDB 4ANVA 3FQXB 3FQXA 2ICEB 2ICEA 3NAAL 4E9QA 3IRZA 3WAKA 3MDJA 4ZDHB 4ZDHA 3B56A 4YK4C 6PAZA 1XGTA 1XGTB 4KO5A 1I1AA 1I1AB 3AS3A 3I02B 3I02A 2YD8A 4HUUB 4HUUA 2E5EA 5EEUA 2PPCA 3QIWB 3QIWA 1ZIBA 4E9YA 4EBQH 1NKOA 5HVWA 1VLXA 5E8DH 3S34H 2WLJA 3LEYL 4I9WD 1E4KC 2QQNL 1F2QA 3RFZA 1MHPH 2AJVH 3RFZB 5FFOA 3THMH 3TJHC 3VYNA 5E5UB 2ED8A 4KGLA 2VXUL 3NPZB 3UGUA 1HKLH 3ZQWA 2AXFB 2AXFA 1RLBA 2VERN 3EIFA 4MLSA 4Y7OC 5IB2A 5IB2B 3MI6A 4XAWL 5E0FA 2KT6A 3WDJA 4YSSA 2OV0A 3IFNL 3QJHA 3QJHB 2UX6A 4DVRH 2TAAA 3Q05A 1DN0A 1DN0B 2Z7WA 2PYFB 2PYFA 4HMCA 2OMVB 2OMVA 1JMZA 5F7MC 1BAGA 2ZXGA 4G8EA 4G8EB 4OFYA 1WHPA 2IPUK 4DVBB 4DVBA 1BYPA 4K71B 1W91A 1F00I 1CICD 5BJTA 5BJTB 2IPUG 2CR0A 4FFYA 1XSOA 2VTFA 2X0UA 4JM4L 3ULVL 4G8IA 4G8IB 5HHMD 5H94A 2CDEA 2CDEB 5H94B 5IVZB 2HWZL 4FOMA 5IVZA 3DX1A 5BCAA 3IPEA 4F2MA 4JHUA 4F2MB 5DMIL 5IUCA 3BT2H 2N7AA 5JW4R 4R90L 4UYQA 4L4TA 4L4TB 1EZUA 3NCBB 4NQDD 5B1BB 4OCXL 3PDDA 1PY4A 4LCCA 4LCCB 4NP4L 2X6MA 4XN4A 3T09A 4TNWK 1JIBA 1JPEA 5JHDB 5JHDA 5MHSD 4QUOA 4LEBA 1A6AB 1A6AA 4FQ2L 3QJVB 4J4PA 3MLZH 3I6LE 4Z3IA 4NEHB 3QQ9C 1CL7L 1J1OL 3HZKA 3HZKB 3BQVA 4KNSA 3MZTA 1IU1A 3AMKA 4MNQE 4G6JL 3VVWA 2FLBT 4Y0GA 4JUSA 4XZUA 4XZUB 1SBSH 3WN5C 4ZFOL 3ILQC 1LD9B 1LD9A 2DYPD 4OAWA 2C9RA 4OAWB 3TH2T 5HYSA 3PQYB 1TJHL 3L5HA 3NIFE 3PQYA 4L8BA 4L8BB 3ZR6A 5HYSB 2XWBA 2XWBB 2DQJL 3V0VA 5DZAA 4N2HA 2MTAA 4U1MB 1LO0H 2G60L 4PD4K 3GSVA 1DQML 2XLLA 2IFGA 3GSVB 4KHTH 1F3JB 1F3JA 4XP5L 3HRZC 1ZPLA 1PAZA 1X9LA 3FCBA 3VU1A 3LIUA 4YE0A 1KN4H 1Z5YD 2V3DA 3QDAA 4OIBA 1NCCH 1OAZL 3MJWA 2NSMA 5LG6A 4P9HC 2ZT9C 1AO7E 3BP6B 3BP6A 3SPHA 4KZDH 1TETH 3BE1H 4DZBB 4DZBA 4XB3A 3VA6A 5JOPE 4ZNEE 3GBEA 1WD9A 4QNPF 3F6IA 1JXJA 1CT8B 1CT8A 3OX8B 3OX8A 4K3JL 5JHLA 3BSGA 4OVUA 3MBXH 4YBLC 1YEEH 1LK3L 5I8EA 5I8EB 1MJ8H 1NL0H 2LE9A 3NABL 2YMOA 2JCCF 3QRGL 3U2JA 4UT9L 2X4PA 2KDGA 3FUJA 4C57C 4Y19E 3IMRA 4WV1C 1FH2A 4XWGH 3R06A 3R06B 3NP4A 4URTB 3N6YA 3S88L 4F58H 3WV0A 5I30L 4N86A 4YHOL 4K3EL 4UT6A 3MRLB 3MRLA 4GRLC 1E3FA 1AZBA 5FA4A 3IWVA 3VD0A 4LVHC 4POZD 1VIWA 5K9JL 5I75C 4J3SA 2OP4H 4GI9A 5DD1L 1N0XL 3SKJL 2X4TA 2X4TB 3DC0A 2FT8A 5F7AA 2WB1A 2E9BA 1N64L 1FNAA 3PJSA 3PJSB 2QSVA 1TNNA 2JIXD 4BFRA 4JEGB 2NNFA 3L5WA 3L5WB 4G9DB 4G9DA 1MUJB 1MUJA 2OK0H 4M8UA 1GOGA 4TQHA 5H2BA 3UO1H 3QPXH 3KLKA 2P44B 3H56A 4Y4KA 4Y4KB 2E56A 4N20A 1I9RL 2DQTL 5I1JH 3OKLB 3OKLA 2VSCA 2AEPH 3CH8A 2YAPA 5HI4D 3T3ME 2OZ4L 2YPVH 1CDIA 3NCFB 1VAHA 4XVOA 5I5RA 2CMRH 4NRYA 4NRYB 4F3FA 4F3FB 4KJWD 4E9VA 5A40E 1EVUA 2CRYA 4OM1L 3X13A 3X13B 1XEUA 3KVQA 4AYSA 3KG5A 1OZUA 4HWZA 4HWZB 4ICWA 3GSQA 3GSQB 2P52A 1B0WA 3C5ZC 3JVFC 5FM5O 2Q7YA 2Q7YB 2SEBA 2SEBB 4TUUA 4XN7A 3HHRB 3FU0A 2OYLA 3IE4A 2MCMA 2PABA 1QSVA 1ZT7A 1ZT7B 2D4FA 2XQBL 4K9EH 5T1KD 3ETBF 4JO4L 4D9QD 5DHVH 1P9MC 1HE7A 1B2WH 2F7IA 3EJYD 1G4MA 3R7RA 5B4MD 3WU1A 5DD3H 1KGYE 5J1AA 5J1AB 3OJDB 4RMUA 5INDA 5INDB 2X4SB 2X4SA 3U79A 2J57A 1MG2C 1E8ZA 2VR6A 2IDFA 4GIPD 1CQYA 1RXLA 4FEIA 5DQDL 2ZUQC 2UWEB 2UWEA 2XTJB 4QRPE 3LB6D 3NEEA 3CN4A 5IQ9A 5IQ9B 5F71A 4JQXA 4MZ3A 3HVNA 2EC9T 1KTJA 4XVSH 2DMHA 4M00A 5DJ2A 5DJ2B 3SBRA 3MLXH 2K45A 3LZRA 1FVCA 1FVCB 3D39D 1KPUB 1KPUA 2AGJH 4XXCA 4OD2A 1SPDA 1L0YA 3BP7B 3BP7A 4OD2B 4PGZA 4X4XA 4X6EB 4DO5A 5C9JB 5L6YL 2C9AA 5T1DL 5GRUH 1E3XA 3QORD 4UV7L 1OSPL 4P05A 2AW2A 1VPOH 1WP6A 3MA7A 3MA7B 3MN8A 5B1AB 1CXHA 3NEXA 1J0HA 5J13B 3SE8L 2MKWA 4BINA 3P0VH 4F80A 3RVWD 4HIJB 2XZCL 2XV0A 4HIJA 4HK3J 2WZ6A 4PBVC 2Q8AH 5IMMB 1BAFL 5IMMA 2FTAA 3ZE0F 4KBPA 2EYTA 2EYTB 1ZOXA 3APDA 4GAJL 1I8LC 3EYUH 4YLBA 4JFHE 5B1KA 1ZSHA 1L7IH 4HEPA 1G6RB 1G6RA 4U3HA 1R6VA 3N44F 3EJZC 4XP1L 3K46A 3VGDA 1JWSB 1JWSA 2JQMA 3B2DC 3HTLX 1QPXA 5BO1H 1CYXA 5EN3A 1GYUA 1RZQA 4B41A 1UT9A 2G2NA 2EVFA 4W9JC 2WVSA 3ZN6A 3LRLA 4PH8A 3ARVA 2ZONA 4AJ0A 3L4TA 4NO5A 4NO5B 1AIFA 1AIFB 4RGMB 2O6FA 2QGDA 3LS5H 5D4JA 5DJ0A 2IQ9L 1H5BC 3ET9F 3GI8L 4TN9A 5DJ0B 5AKRA 3WXVL 1NC2D 2ZUTA 5H8DA 3S37H 43CAA 43CAB 1ED3B 1ED3A 4BFIB 4A7VA 1RPQA 1O6VA 4WQOA 3ECVA 5I8KH 4LSTH 1DJHA 4K5MA 3S8FB 3KVDD 1AJ7H 1BCIA 4WW1A 4WW1B 1J8HE 1HL8A 5KS9F 4XPGH 5IVXB 5IVXA 1ZHLB 1ZHLA 2K78A 1FNEA 1FNEB 4HW6A 2FB4H 4U3CA 1D9KD 5FGCB 3UMTA 5AW6B 2CRIA 1ZJAA 1NCHA 4R97B 2HA1A 4FYSA 1JNLH 3ENEA 4DQOH 5D7SL 4KJWC 5CEZL 3QNZB 3QNZA 4HJUA 4L4TE 3UEQA 4DKTA 1OGAA 1OGAB 3FU8A 3TO4D 5EU3B 5EU3A 5LDSA 1LDSA 1JDAA 1YYML 5D1XC 3NH7L 3GTVA 2MJWA 2ZOWA 4G3YH 2GQHA 4HYTB 4W9LC 3CPUA 3WIFB 2EXYC 2XN9D 5JHDE 4JE0A 5D7KD 4O2CA 4O2CB 2YBGA 4IK6A 1RZ7L 5DFTA 4G72B 2YIHA 5HHPB 3EHBB 5HHPA 2YUXA 4R26H 4HG4K 1R0AL 2DEXX 3L3OC 1FJ1A 1FJ1B 5I66B 1SXSA 5I66A 5C08B 5C08A 2R29A 1JMXA 3BPLC 1MKFA 3GPEA 2FUQA 4P46D 4YHYC 5GS0D 3EOAB 3EOAA 4FNRA 3IK2A 5B4MC 2VW4A 3WUWG 4CSPA 4OCYL 4ZW8A 1WDAA 4WWKD 3B7RL 3MV9D 1QABA 5FB8A 5FB8B 2BVTA 1G9MH 3L8QA 4OB5H 4PB9L 3UC0L 3QEQE 1GCYA 3O2WL 1U42A 4WI7A 2WZ5A 4CILA 3HMXA 3GHEH 2EE0A 4IGBD 1PFOA 2YRPA 4MVBC 4HC1A 3MACL 5DZLA 4ZMLA 4KO9A 2OXHA 2OXHB 4F5CA 5JPNA 3LZFH 5JPNB 1LMIA 4OZFH 3L1OH 4N2OA 3DPDA 3QPQC 3EZJB 2FDBP 3D0LA 3D0LB 4U4BA 1HXMA 1HXMB 2ZIDA 1SEBB 1SEBA 2O72A 1DEEB 1DEEA 4JFVA 4L29B 4L29A 3ZT6A 3ATAA 3N1FC 4PJ5D 4MXQC 1WIPA 3BSZA 5I19H 5EEXA 2EH8H 4MXVE 2WBKA 4NC1C 4KZ0A 5TE7H 1MFDL 1IE4A 4AVKA 2R56H 2HPOA 5T3ZD 3H3PH 4BZ1A 2GEQA 4JGMA 2ZJSL 1O9VA 3VSQA 4FTVE 3OAYK 1QKZL 3DARA 3U7WL 2IVFC 2PYEA 2PYEB 2NY1D 4PJDE 2FX9H 3W1ZA 2XRAH 4OLZH 4FERA 4AMKL 1U8HB 1U8HA 4OJFH 1E7VA 3P3YA 4DGYH 3ROLA 3NZSA 3ROLB 1JPST 5D7EA 1CR9H 3BH8A 1MFBL 3BH8B 3US9A 5JLZA 5JLZB 4XP4H 3BHBB 3BHBA 4E68A 3HI5L 1VSCA 1MQKL 3RKDC 1CFTA 1CFTB 1ZHBB 1ZHBA 5AW1B 4Z7OB 2D0FA 2GFBA 2GFBB 5AAMC 4Q9RH 5F1NB 5F1NA 3IU4L 3LDBB 3BPOC 2VWEE 2DJSA 3CHQA 2K6ZA 5LQBL 5DEFA 5DEFB 3E9TA 1VESA 3LOWA 1QBMH 3L48A 4H0IA 4UZSA 2YC1B 2YC1A 3BDYH 4PREA 4PREB 1CXKA 2M1KA 2EINB 3V4VH 3VTTA 4U1NA 4U1NB 2QMJA 2YPLD 5EDSA 3ZHFA 4GUPB 4GUPA 2H3NA 2NY6C 2H3NB 4JX0A 1KT2A 1KT2B 2CXGA 3ULUL 4RMSA 3F58L 3ZL4L 1WZKA 1IMHC 1D9KC 4XPAH 1IUZA 1RSFA 1ZVHA 1NGYA 1NGYB 4KVNH 2VC2H 4S1QH 1PG7L 3V6OA 3ZBMA 3WEAA 1N68A 2I9LA 2I9LB 4PJEA 4PJEB 4KK8D 4XWOD 4NZRH 3CTTA 1SY6A 3PGFH 5TQ0H 2C3HA 1T6BX 4NUPA 5LXGL 5D7LE 4WEBH 4U2YA 3S3CB 1UD8A 2M8XA 5DSCA 2Y06H 1CIDA 5DSCB 4JDTH 1QSFE 2BY1A 3BX7C 1QFUL 4TYUA 1LHZA 3BMWA 4JHBA 2RB8A 1J9CT 1MFAL 4O00A 3FAXA 3NSJA 1ZE3C 1Q72L 4L18A 1P0SE 1GOFA 1QSZA 2R9HC 1JZ7A 1FBIL 1N4XH 4WWKC 3V79C 4N8VB 4J8QA 1DJZA 4N8VA 3HR5B 3HR5A 2UWEE 1U33A 2XTJE 2QPSA 4AVHA 3RWCA 3RWCB 3MAWA 4GG6E 2Y2TA 3FO9B 3FO9A 1URZA 2Z4QB 2Z4QA 2WQRA 3O2DL 4FZEL 3GUFA 1JZ8A 1NGWA 1NGWB 1CFSB 1CFSA 2IWEA 2QZQA 2LW3A 4PRPB 4PRPA 5CILH 4TXVB 2ALAA 2YA0A 3S8WA 4IOFC 3SBWA 2VLKD 2H9GB 2H9GA 4BK5C 2GTWB 2GTWA 5ANHA 3FUHA 2CLVB 2CLVA 4Q6IC 3BZEB 3BZEA 3UTTE 1NFDE 3HJEA 5CD3B 2GBTA 1T5XB 1T5XA 2I5YL 3MV8B 3MV8A 3OAZH 1DVUA 1EPFA 4DHLA 4NKMA 4NKMB 3RVXD 1X5IA 2NY4D 3RZCB 3RZCA 4HJJH 3CMGA 3P30L 3V7AE 2N3JA 1N59B 1N59A 1ET7A 4PB0L 5FYJD 2ZYRA 2F74A 2F74B 2CO7A 2CO7B 3KDPB 3KPQB 3KPQA 4JQIL 3OF6D 4R8WL 4WU7B 4JFTA 4WU7A 5AYUL 3WLBA 3WLBB 5CJOL 3T0BA 2NY1C 5I18H 2FBRA 3CZGA 4QDGA 3IMBA 5BZXA 4M93C 2DMGA 3VG9C 3O6LL 1BREA 5KBMA 4EQ3A 2V9UA 1QBBA 5JO5B 5BRQA 4C4UA 1WGOA 2HUEA 2G3XA 5CN1A 4YSEA 1NEZA 2IALB 2IALA 4X7SH 1H3WM 2OR9L 5ICXA 5ICXB 1A9BA 1A9BB 2EO7A 3O9WD 1BV8A 4X5PA 2FJHA 2FJHB 3TA3D 1XWVA 2HG5B 2HG5A 4D8OA 4ALAC 2G5BA 2G5BB 3BW9B 3BW9A 4LSVH 4NM4L 4AH2B 4AH2A 2Y7NA 5I24A 4HT1L 3QFJE 1J9SA 4OCRH 4X9FA 1UEYA 3HNSH 5TFSH 1EAPA 1EAPB 1IC7H 2UY7B 2UY7A 3GLAA 3B2VH 3QI9C 4CC4C 3K2UL 4Q9CA 3LX9A 2EKJA 3TX4A 3L9YA 1EHXA 1YUHB 1YUHA 1D5RA 3OLIA 3EJUA 1MCFA 5IROA 4PJGF 5IB1A 4CBPA 5IB1B 2Z7UA 3HG1D 2F53E 1UWGL 3H9YA 4DEPC 5IR1A 5IR1B 3IAPA 1GKEA 1HJCA 1EGJL 2GKIA 4KK8C 2QFPA 3BC9A 1L3NA 3SGKC 1MCRA 5K69A 4E9TA 1THCA 4ZMQA 1TQTA 3F6JA 4XNUL 1KTLB 1KTLA 2MOVA 2Y2WA 1KJ2H 4JHVA 3QQXA 1Q0XL 4JM2C 4AGNA 4WSJA 4PWFA 1FNSL 2CKBL 5HDLA 1NEZG 1KYUA 1CL7I 3N0AA 2YGOA 3LJ3A 5JHMA 1QZNA 4E9RA 3VRLF 4AE0A 2NSQA 5F3FA 2OULB 1Y1DA 4M56A 2I60L 2VN5A 1MCKA 1IAMA 1LXMA 2NYYD 2FR4A 2FR4B 4KJYA 4KJYB 5E5MB 4J3OC 3D06A 5E5MA 4D0BA 2B1HL 4D0BB 4DP5X 2CUMA 2DQDL 1IGIH 2W59A 5GQBA 2FX8H 3ZE1F 4WSGA 5HDQH 3X3GH 2YD4A 3ZMNA 1XMWA 1CD8A 4MAUL 2HJKB 2HJKA 3NT0A 1X44A 3QAQA 2HMIC 4UMGA 3C6LC 3SDAC 5I1KH 5FYKU 1UGKA 1T4KA 1T4KB 1FH5L 3GMPB 3GMPA 3UTZB 3UTZA 1DJYA 3DXAE 3K6IA 1VKXB 1VKXA 2XWZA 3SODB 2ZF8A 1OAKH 3DIVA 1EUUA 4Z3JA 5DGQA 4XPFH 4OD1L 4R6UA 5GGTH 4ZMYA 4JO3H 4QRRE 1W72H 2DQGL 2WXKA 5T5FA 4C54A 2IBGA 1U4FA 4PWGA 1E8XA 3KW7A 4WTZA 5I6XB 3B9KB 3B9KA 4FQIH 3S35L 2R4SL 5ESQB 5ESQA 3ZJAA 5DR5L 3GJFH 3T2LA 1FRGL 4CSSA 4Q9QL 1OCZB 4FMFA 2NZ9C 2R8SH 2PKDA 4YC2B 4L0PB 1LP9E 5E2UL 2NXZB 3HKZA 3QQ3B 1E6JH 3QQ3A 2YN5A 4P9HL 3OAZK 4ZMZA 4CNIA 2XVGA 4CNIB 1CE1L 3F04A 4PN6A 4QXUL 3K74B 4LCWA 2HT4D 4LCWB 4IIZA 4RVBA 1KBKA 4D7BA 5CJXA 5F9WC 4RGNC 3QXVA 2OX5B 4FL4B 3BWUC 1OY3B 1I9EA 3BAEH 3L4XA 2ENYA 1X9QA 3CN3A 3CV5A 1O7DC 3GJEB 3GJEA 3ZYZA 4MDIA 4MDIB 1HSAB 1HSAA 4DAGL 1N12A 4NQEE 3PNRB 5HXMA 6TAAA 3O9WC 1Z9MA 4ZX6A 1MCNA 4YX2L 2Q5BA 2P5WE 3TA3C 3QDHA 4D3CH 3RKPA 2PLTA 3MQIA 5C0BD 2NNRA 4NC1E 3ZDXB 1IGJB 1IGJA 3BMVA 4DP0X 3EYQC 1SF3A 1OARL 1M42A 1TVBA 1TVBB 1KBBA 3GGWA 3GGWB 3NCJH 2QADB 1U92A 1U92B 4BKLB 4BKLA 3AY4A 3BAIA 1MAML 2VR7A 2AITA 3KYMB 3KYMA 4Y2DD 3TIDB 3TIDA 4J2XA 1R1CA 3ZO9A 1L9TA 3E80A 4LARH 1C5CH 2F2HA 3W2DL 4BDVA 4BDVB 2N59A 3SDXA 5C0IB 3SDXB 4CADA 4CADB 4NXSA 2PMZA 5C0IA 5KVDE 4OCWL 4A38A 4X6CE 3I9AA 4GKLA 4OLWL 1PYWA 1PYWB 2J21A 2ITCA 2ITCB 3NK3A 4LOFA 4YGAB 4HLZH 3SYPA 4XP6H 3ZRFC 1GGTA 2YSSA 2YSSB 1FC2D 4M1GH 3I6LD 3BVNB 3BVNA 4PW9A 3FAWA 4EI0A 1MJ7L 2X6AA 4AMXA 2EDWA 4APQD 3BVWA 4H40A 4XPTH 3KPRE 4MNQD 1WAAA 2YQBA 3ZYIA 1HZHL 3EF4A 4FQLL 5HYQA 5HYQB 5JQ6L 4O58L 4ZUVB 4ZUVA 5AZEH 4Z3FA 1H9VA 2ICES 1YN7B 1YN7A 2QDVA 3MLTA 2V17L 3MLTB 4G6AC 5IBTL 3LD8B 3WJJC 4R2GD 3QNYB 3QNYA 3TV3L 3TURA 1E40A 1CK0H 4RGOL 5LGJA 5LGJB 4BWUA 4Z7UE 5HBBA 4M7KL 5HVFB 4FQJL 2EJ1A 3F7VA 3F7VB 1BQHB 1BQHA 4PJFB 4PJFA 1N7ML 2Z64C 3V6ZB 3V6ZA 1LWRA 2R2EB 2R2EA 3POHA 2XBTA 1BEYH 1XGZA 5IIEA 1H3TA 5GISL 5IIEB 5DFVC 1AO7D 1NICA 3E2HB 1IT9L 3QP3A 3GNMH 4UOZA 4X4MA 2VXQL 4PHXA 1MCQA 2BH0A 4Y8DC 2AABH 1TCRA 1TCRB 3D2UD 2XFGB 2L04A 5KW9H 2D9QB 4TSCH 4K8RD 3JZYA 1XBRA 1QLEB 4OUOA 3Q2NA 1E5UI 4NT6B 4NT6A 1O6SB 1O6SA 3K2IA 4MAZA 1UCBL 4BCXA 3V0FA 1TCMA 3CLFH 1BAWA 1RIVH 2R0LL 3I50H 3NFSL 3OAWA 4TUKH 4FNLL 3NSDA 1OW0A 3ILEA 4RISH 1AKJD 1DQTA 4HSQA 3UTSE 1KFAL 4TTDC 5D7IE 3UYRL 5D70L 1NSNL 2YUVA 3FT2B 2BJMH 1JCKA 3FT2A 2E27L 2PWGA 1OP3H 3U1SH 5I1AA 5I1AB 2MNWA 3ML9A 4G6FD 1C1EL 4KXCA 3Q8EA 4U1KA 4U1KB 4HDIA 4HDIB 3A0OA 5K59E 4EZKA 2IO5A 4HD9A 2NDFA 2ICWA 2ICWB 1NOLA 3V0EA 2XZQL 4JFPB 4JFPA 4ACTA 3C2AH 4WKXA 5I6MA 5IQ7H 4CSTA 4Z7AA 3W9EB 3W9EA 4X5QA 1JS4A 3KPSE 3ARYA 3EXJA 3M45A 1F3DJ 1LO2H 2NNAA 2NNAB 4B0MB 5L2KA 5L2KB 4PJXA 4PJXB 3T8MA 3UJJL 4JFED 2GW5A 4YHPB 4YHPA 4BZ2H 1AZCA 2JMRA 2WBJD 1HINH 1U3HD 5JIMA 3GSNL 4YHIA 4YHIB 1FE8L 1AI1H 5DD5L 4NJAL 3TT1L 1MPAL 2DL2A 2E3VA 2QJDA 1TYRA 2ZAGA 4Y1AB 4Y1AA 2GPZA 4Z7IA 4AJWA 1JJUA 1FQ9C 2RGSA 4F57H 2F1BA 32C2A 32C2B 2OFQA 1H3XA 4GXUN 5IOKA 3ZDYF 1AZUA 2QPFA 4S1RL 3BAWA 4DK3A 3OBAA 4NM8H 3T0DA 2P45B 2UZXA 2UZXB 3ELAT 3I9GL 3HHSB 3HHSA 3U4AA 1G1KA 2VW6A 3TIEA 3TIEB 5BW7C 2GJJA 5DA0B 3ULVF 1TENA 1BECA 2ADGB 2ADGA 1VFOA 3BD3A 2FSDA 4N0FA 1P5UB 1P5UA 4N0FB 1XGUA 1XGUB 4LSSL 4JRYE 4I18B 4I18A 2YD1A 4UMSA 4P5RA 4I48B 4I48A 4TQIA 4WEUD 4QRPD 2KQNA 1E2VA 2LLGA 3E8UH 4FQHA 1D6VL 4FQHB 4LOUD 1RCYA 5AOJA 3RE0A 2C5DC 5F7EH 3QG7H 1FGVH 5JR1H 2VE6B 1RUKH 2VE6A 4PEEA 5F7DA 5F7DB 2OR8A 5C1MB 3S37X 2V4LA 1ASOA 1GS7A 4R83A 3WTWA 3V0WL 1JUFB 1JUFA 2EC9U 3MUZ1 2VDRB 1JGLL 4PYGA 3T4YA 3T4YB 4GNKB 1I1CA 1GGCL 3OB8A 1D5MA 1D5MB 3RIAF 1AQ8A 1YSOA 4B95C 3KPMB 1IQWL 3KPMA 2JKNA 2XXGA 1KBVA 4JFDB 4JFDA 3T3PB 1JGIA 1FO0A 1KENH 1I1AD 3NQKA 3EZ8A 4GAFB 3BKYH 3Q13A 5ICZA 3WS6C 1YJDC 5ICZB 1FLRL 3FQWB 3FQWA 3RNKB 3RNKA 3QIWD 1XGQB 1XGQA 2NUPB 2NUPA 3BDBA 3KAAA 3SE9L 2RCSH 1KWGA 3FHAA 5E08H 3HNTL 5AZ2H 4H0HB 4KY1L 1MW0A 3CVIL 3EJRA 5DC9B 3FYIB 4AQ1C 3MXWL 5I2IA 5I2IB 2A4CA 2K7QA 2YOCA 3P3TA 4TQEH 4XTRD 4N24A 5EEYA 4EMZA 1TITA 5SWSE 2YGQA 5C0AE 43C9B 1YEHH 1EBAA 43C9A 3CVHL 4AIZB 4AIZA 4BGDA 3BOVA 3NPSB 3GFUA 4N6QA 5EZIL 4BQ8A 2A9BA 1NBVH 4RMVA 3QAZB 4ZYKB 4ZYKA 5FS5A 3BJ91 3V95A 4H0GA 1DCEA 2MPAH 2UXTA 2HFEA 2HFEB 3QE5A 4JN1L 4L5FL 4KQ3L 5IB4A 5IB4B 3I2CL 3QDME 5LBSA 2EIBA 4C58B 1I7RB 1I7RA 1Z3GH 4KI5D 1MLCB 1MLCA 1VGEL 4N1EA 5E94B 5E94A 3TWCL 4TVPH 2WXFA 4CW1A 1EO8H 4CW1B 1BM3H 1KGCD 4ELME 4POYA 3HN5A 1B4JH 4B3EA 3ZZ1A 1WZ1L 4QXWA 4PJ7E 4JRXE 5G4OA 1H3PH 3TEXA 2AEQH 1NJ9B 1NJ9A 3CK0H 4KZCA 4Z9KB 1MCEA 1F0LA 5JQIB 2C3VA 2C3VB 4WY7L 3B1UA 4L4TD 2CA4A 2DDQL 3ZX1A 3KDMA 3KDMB 4JREB 3W81A 3LRHA 1CXIA 5D8JL 5D9SB 5D9SA 3MNWA 1AC0A 3MNWB 4RA0C 5E7FA 2FBOJ 4M1DL 5JHDD 3LXBA 5IJKA 4BV1A 1RFDL 1U3ZA 2JJSC 4WSKA 4J4PD 1YEGH 4RGNE 2BRQA 3T9WA 3PHQA 3PHQB 3QXWA 4L23A 3KHQA 1KV7A 4L4VA 1JRHL 4L4VB 5E6UB 3A4AA 5EU7C 4LBAA 4Y2OB 4Y2OA 2X9WA 5CLTA 1GYAA 4LFHD 4HS6A 4HS6B 4PJHA 1KGUA 4PJHB 1R3IH 5KJRL 3WO3B 3ZDZB 3VSTA 1CTNA 5DZNA 4BXVA 2HT3D 5I1GH 1U41A 1XO8A 2YAMA 4J28A 3QEQD 4YSDA 5CUSL 5IHUH 3PQYD 2MQGA 4KVPA 4L1SA 4QD2E 5EBWA 1FVDA 1BZEA 1FVDB 5EBWB 3VCLB 3VCLA 3VWKB 3VWKA 4LOUC 3D9AH 1BVZA 3LH9A 1XV8A 3JV5A 2ADFL 1U58A 1U58B 1NA8A 3EJSA 2BVYA 2G4EA 1BZQK 3GS0A 2XIBA 1FIEA 5DO8A 4A7UA 2J8HA 5D5MB 5D5MA 3VFGL 3X1EA 1WUZA 3VXUB 3VXUA 1G9EA 4DO4A 1B6UA 4N2MA 1F8TH 1CGXA 4CMMA 4CMMB 5DEGA 5DEGB 4W81A 4UV4H 4KY2A 4QIRA 5E99L 2AS5M 2EABA 4F8TA 4HCRH 4M6ML 4S1SH 2ICEC 1G5AA 1PLAA 6FABH 3DGCR 3MKKA 5CF3A 1AR1D 5I73B 5A3ID 1SYSB 1SYSA 1YY8B 1YY8A 4FTVD 5DI8B 5DI8A 5B1CA 4OF0A 5L4FA 3MREB 3MREA 2D7NA 4BUQA 5JW4N 3TCXA 1W6LA 2NX5A 1WS8A 2NX5B 3KJ4B 3NCCB 2B8OT 3GLDA 1NCAL 1MWAH 3MOAH 2KZ1B 5IY5B 4L05A 4CVWA 3EYSH 5F0PB 2CM5A 1JF1B 1JF1A 1MAJA 1KB3A 5C2BH 2XWRA 1KPRB 1KPRA 4WHDA 5EZPA 3QFDA 3QFDB 2J4WL 2GI7A 4NIYE 5ALBL 2GVYA 4LQFH 3ARZA 2FEDC 4XOEA 5T3ZL 1SDYA 1QZ1A 3B2XA 4QRQB 4QRQA 1T80A 4R5TA 1FCGA 3SDYH 3BXNB 3BXNA 2JJWA 4RMTA 3K6SB 3K6SA 1FZKB 1FZKA 2IH1A 2IH1B 4LE8A 2H2SD 2DQCH 2E47A 1U8IA 1U8IB 4LBEA 1J11A 3DTDA 4G11A 1JDCA 4LBEB 2H0JA 3KWXA 5CN3A 1ZA3B 1ZA3A 4PLJD 4V2CB 4F9LA 1DJSA 2ZF9A 1RSYA 4GXVL 4MBRA 1PD1A 3NAAH 3NRFA 3HC0A 3HC0B 3A24A 4KI5C 4Y4KD 2CJ3A 4WLCA 3SBPA 4LMQE 3PUUA 2KQMA 2LTQC 4WNSA 3QIBA 3QIBB 3X1NA 3IDGA 3IDGB 5CP7A 5CP7B 4AGOA 2WXIA 3RY5A 2X2HA 4HPOL 3BKMH 3CIAA 1I75A 1SJHB 1SJHA 4OLUL 2VR8A 4UTCA 4YL4A 5TDNB 5TDNA 1OXYA 4NNPH 1KC5L 2I26N 3UAFA 4KTEH 4IQHA 3LEYH 1U8KB 1U8KA 1A14L 5GGSB 2QQNH 5GGSA 3IDMB 1BF2A 2Z4TA 4L1LA 1MRFL 5F1SA 2OJEB 2OJEA 3HHMA 5DUPL 4ALAL 2VXUH 3IAQA 5C0RL 4Z5RA 2Z31C 4Z5RB 3GRBA 1BD2E 4HGKC 5K39B 2NUTB 4JMNA 5K39A 2NUTA 2HN7A 2HN7B 4XAWH 1G7LB 1G7LA 1QW9A 1Z9SA 1Z9SB 3BLPX 4HOZA 3ZHLA 4KX9A 1HHIB 1HHIA 1MHHB 3K1DA 3N85H 5EUKB 5EUKA 4FYQA 1CLOL 2CJUL 3MJ9L 2ESVB 2ESVA 2EZ0C 3MODL 4PJCE 4NZFA 1T2QL 2QTEA 2ZXBA 5EU5B 1DQLL 1S9YB 1S9YA 1UXWB 1UXWA 5EU5A 3SHSA 4XHJD 1HOCB 3HZYA 1GYVA 3HZYB 3WGVB 4DUXA 3VW3L 2XTJD 1DR9A 3UL4A 4JM4H 1I1FA 1I1FB 2PXYB 2PXYA 1KLUB 1KLUA 3ULVH 2APSA 2HWZH 2F6AA 2Y69B 4XNYL 3V8CA 4KUCD 5E9DB 5E9DA 5IOPA 5IOPB 5DMIH 4LPYA 4Y9GA 4R90H 3HBZA 5LJYH 4BZYA 2JKWA 2OR7A 3IYLW 4OCXH 4F8NA 1LEKB 1LEKA 4EXKA 4NP4H 3NIFF 4ZMPA 1RQ5A 1DFXA 1RZFL 4BWWA 4DUWA 1KJ3L 1HX0A 1UB5A 1UB5B 3MLYH 3QUZD 1TMQA 2DLIA 2BP5M 3P0GB 4R5XA 4FQ2H 1W6WA 2P3YA 4KQ4L 3SY0A 3SY0B 4YDKL 3QUXA 3QUXB 4OF8A 3QISA 1MVUA 1CL7H 1MVUB 3A21A 4KK9C 4M7JH 4LEEA 3T3PE 1NBZB 1NBZA 1BBDL 3KWTA 1HZKA 3NUKA 2HLAB 2HLAA 3DVGA 3DVGB 4M6NL 3FRUB 3FRUA 4LOEA 3H9SE 4D9RE 5F3BB 5F3BA 1BXAA 4G6JH 1EEZA 1EEZB 3DYMA 4AEFA 3C6SB 1OAYL 2I27N 2KPWA 3C6SA 1EX0A 3GSXA 3GSXB 5HJ3B 5HJ3A 4HUXA 4HUXB 1EERB 3EUUA 3JWDC 1NINA 4NNYA 4YL9A 3V0AC 2H2PC 3IM1A 4JRLA 2WUCL 1TJHH 3SJVB 3SJVA 4DEWA 4YPGB 4YPGA 3UROR 1UTDA 2DQJH 4HJGA 4FN0A 4HJGB 4XNZB 5GGVY 4HMEA 2G60H 1TTUA 3UPCA 1DQMH 1FV1B 1FV1A 1HCFX 1ZLUH 4U7SA 2WCSA 5JOFA 5JOFB 3FTZA 1OAZH 1NIAA 1R3KB 4G5AA 3T6VA 1TOXA 3KGUA 3UAJA 1K3ZA 5EEVA 1KCKA 3OZLA 2MSPA 2UXGA 3K2KA 4QXTB 4QXTA 1UCTA 5E8PA 4XNQB 4XNQA 5E8PB 3UO8B 3IDNA 3IDNB 1V3JA 2BNUA 1XCQB 1XCQA 2BNUB 4Z1PA 2E75C 3DVIA 1PZBA 1OOAA 3MC0A 2I32A 5LNEA 3O41A 3O41B 4A7SA 4Y2NA 2Q20A 5I0ZA 3QFJD 4R0LB 4R0LA 5I26A 3T6WA 3WCYA 1W8NA 1Y6MR 2W91A 2J20A 4RFNC 3VFPB 3VFPA 3Q06A 2IOIA 5ABDE 4NYLB 1LK3H 1QP1A 4NYLA 4W93A 3CDZA 3CDZB 3NABH 4BD4A 3QRGH 2HRPL 2MNUA 4UT9H 3TESA 5A16A 1TZIB 1TZIA 2APFA 2CKNA 3B4NA 1OGAD 4MYWB 5DD0L 2F53D 1DQQA 1DQQB 2Y25A 2OI9B 3F7PC 2ZZUT 2VSKB 3T3MF 3S88H 3PIQA 3PIQB 1P6AB 4R96B 4R96A 4XGZA 4XGZB 5I30H 1DQVA 1RU9L 1VZIA 4K3EH 4YHOH 1YEKL 1NDTA 2ALWA 3VAEA 4K55A 2BCKB 2BCKA 3TTYA 5K9JH 1EHKB 3EHBD 1H8LA 2O5YL 4NN6B 1OAUL 2AKRB 2AKRA 4PTUB 4PTUA 5DD1H 3SE4A 1N0XH 3SKJH 3NN8B 1ODAA 3NN8A 3PP4L 1N64H 4HOMA 3T4AB 1AHKA 3T4AA 2DMKA 1JSYA 3T0XA 3FO2B 3FO2A 2IDQA 4NGHL 3O3EB 3O3EA 3ULUF 2W65A 2W65B 3WNPA 4YDIH 1I9RH 1W9XA 3Q0HA 3RHWK 1A6ZB 1A6ZA 2DQTH 1CI3M 1KDJA 4XHJC 2OZ4H 2JV6A 4Y5YC 3D2TA 1YY9D 2ORBL 1BIIB 1BIIA 2FWSA 3AT8A 1T89A 4I0CC 4HJSA 3TH4T 4OIFA 1IB5A 4RFOL 4JQXC 4TRPL 4OM1H 4XX1G 1LEIB 1ZK5A 1LEIA 2I85A 3GXUB 4JKKA 1H6FA 3VD2A 4Z3TA 5D5ME 3NZ8A 1NTDA 3NZ8B 4NO0A 4NO0B 2XACC 3DXAD 4P06A 5E03A 1USQA 1UD6A 3VD4A 5J5EA 3T6QC 2CJSA 3Q9QA 4PU2A 4ODUB 4ODUA 4DOHB 1GPOL 4B9CA 5FCSH 4IKKA 3QUYA 3QUYB 2ZCLH 1ANUA 4BH8B 1QBLL 2XQBH 4BH8A 4IKLA 1IFHL 3FKUS 1JF6A 2ZOKB 2ZOKA 4JO4H 5L0QB 3GSRA 3GSRB 4N2CA 4KXBA 3E0GA 1JZ3A 2X1OA 4UQBA 3V9FA 3FPYA 4UB0H 2Q3XA 2K4AA 1HS6A 2HYMA 4KJQC 3ZGHA 2ZWYA 5T3XE 1NAKL 4A37A 1I3VA 2IJ0C 5DQDH 1IILE 4JCLA 3WNNA 2FCBA 5ADOL 1QPKA 2ADYA 1K6QL 1Q1PA 3SD2A 3CH1A 3CH1B 1FYTB 1FYTA 1KEGH 4ZFZB 4ZFZA 4K07A 1FZJB 1FZJA 2MPVA 3G5ZB 1YMHA 1YMHB 1O6TA 1NCBL 1X5ZA 3V5HB 3V5HA 5L6YH 2FO4B 2FO4A 5T1DH 3QCTL 1AYRA 1A3ZA 3Q8CA 4UV7H 5I1EL 1OSPH 4NQED 1K4DB 1K4DA 2FYVA 2V7NB 2V7NA 3DBSA 1IC4L 1Z1WA 1HHGA 1CDJA 1HHGB 3B3BA 3VI4B 3VI4A 5DHMC 3FYEB 5DURD 1J05A 1J05B 1T6WA 2XZCH 3RUGA 3B7TA 4N2KA 4JDZA 1QFWM 4JDZB 3RUGB 3VSVA 3WSQL 3ZSSA 2QVFB 4WGVB 4XNDA 3RX7A 3QUHA 3EADA 2WQVA 2X9XA 4WAFA 3KYKH 4GAJH 4HAGA 1RJLB 1RJLA 1V7ML 2A9ML 5TPWL 4R97C 2DMBA 1NUNB 5JIKA 1OQOA 2XFXB 2XFXA 5KN5A 5KN5B 5DC0A 3Q1SL 1EZLA 4YWGL 4TV3A 4QHKI 4MB3A 4XP1H 4IMKA 3ZIYA 3P2TA 2X0WA 4IJTA 4CN1A 2IADA 2IADB 5LGHL 1ZGLA 1ZGLB 3WE1A 1KCUL 4KMTH 4HS8L 3EHBC 3VNZA 5HI3C 2IQAB 2IQAA 2IQ9H 3GI8H 3U4KA 3KLHC 5D2NB 5D2NA 3C60A 1OPGL 3C60B 3WXVH 1MFUA 3WO4B 2BIMA 2ESVE 1ZLVK 2AK4E 3B7YA 1AY1L 2XOTA 4YDNA 1XXFC 3JWNG 1D7DA 2GTQA 3V0DA 5D2LF 4WKZA 4WKZB 2YLKA 5FM8A 3RVTD 2WP3T 4P3DA 1T3FB 1T3FA 3NIGF 4P3DB 3D09A 3EG9B 1G9HA 1ZS2A 3EG9A 4IHBA 1YEIH 4ZMOA 4JCWA 2ERJB 3L45A 2YA1A 5CEZH 5D7SH 2DB8A 4OF3A 3TF7C 2WNGA 4PRPD 5JPNC 4ZSOB 4ZSOA 3NH7H 4OKDA 3LYRA 3SCMC 2IAMC 1JZ6A 4L9LA 4L9LB 4YHML 5FF6B 5FF6A 1ZEAL 4XC3L 1EA9C 2G3ZA 1RZ7H 1I8UA 1IBYA 2AQPA 4RSVA 5AOLA 2CJTA 3VFWB 3VFWA 1EWHA 3RGBA 1R0AH 5GIRB 5GIRA 1XGYL 1HNGA 2H45A 5DXWA 4ODXB 4ODXA 1BQUA 1AS8A 4FLSA 4Z7NB 4JRWA 1M71B 1M71A 2BZ7A 5LG1A 5IHBA 4LKCA 4LKCB 4OCYH 1I53A 3DTXB 1PJ9A 3DTXA 1T20A 1T20B 4MXVF 3UC0H 2Y7MA 3O2WH 4GS7B 3SJVE 2W0FA 2W0FB 3UTSD 4BFKA 3W11C 1FHNA 1ZTXE 1UWXH 3IMVA 1PAMA 3L5XH 5KSAA 5KSAB 1RK7A 3PGCB 3PGCA 3QCVL 2CBPA 4XN1A 4I1NB 2NT1A 1ECZA 2WXPA 1INEL 4LT7A 3CN0A 2YARA 2ADIA 2ADIB 3I9IA 3M1BA 1QVOA 1QVOB 3FTYA 3M1BB 4KK5C 4ZMAT 1HWGB 1RZ8A 1RZ8B 3SPGA 1YJDL 5D1ZA 5D1ZB 1BJMA 3LDBC 1ITBB 1U8QB 1U8QA 5JXAL 2R1YA 2R1YB 4PWJA 5EO1B 1UKSA 2X7LA 2X7LB 4XH2B 4XH2A 5EO1A 4G71B 3P4MB 3P4MA 4IKJA 1MFDH 1DBML 5I15L 5GZOC 3BP5B 3BP5A 2X2YA 5FGSA 4AGPA 2ZJSH 2BY3A 2EVIA 1QKZH 3ZMRA 1OK8A 2J6EH 3O6ML 3U7WH 3DUHA 1SMOA 3AQZA 3CIQA 3ARPA 4WFGE 5KAQG 1CIUA 3PHOB 3PHOA 5IROD 2LQRA 1SXAA 5KAQF 2NR6C 3V6OC 2UYLA 1DUYB 1DUYA 2ICWJ 2UYLB 2GG1A 4JPIB 1XT5A 4JPIA 4M8QA 5EUOF 4A7GF 1MFBH 5AVSB 1TEGA 3PPEA 2GJ6E 2MH4A 1TJGL 3HI5H 2BVUA 5CFAA 2RIKA 5EWIL 5BOJA 1MQKH 4YLCA 5KYXA 4AQ8C 3NACL 3ZKXB 5EA0L 5KYXB 4ZUSB 4ZUSA 5AL8A 1NPJA 3EJPA 1X6NA 4JPKL 4UNTA 4UQDA 4JFYB 4JFYA 4Z7WF 1WAPA 3IU4H 4Z18A 2L0DA 2NSXA 1Q0YL 3PV7A 1FNFA 1JRHI 5EPMB 5EPMA 4QJ4B 5FUZL 5LQBH 3WMPA 5ALCL 3A6CL 4LCUA 4LCUB 3RB5A 3UBHA 4HZ1A 1G84A 3O3AB 3O3AA 2PO6A 2PO6B 2D7MA 3WY4A 3VX0A 4JVWA 2OSLB 2NDGA 2OSLA 3KEHA 4G80A 4G80B 1ASQA 3ULUH 4WHTB 4WHTA 3WDIA 4DETA 3QRBA 3F58H 2XZZA 4IRSD 3ZL4H 1HT6A 2DQMA 4NZJA 3RX9A 1XB6A 3MRHA 3MRHB 1YPZB 1OHQA 1YPZA 3VX1A 4BHUI 4FTDA 3R8BB 3BLKA 4BFOA 5L8JB 5C0JA 5C0JB 5EU6A 5EU6B 5T3XL 1JNJA 3SBWC 3MRQB 1KIQA 3MRQA 4GG6F 2NOYA 1K5WA 3PP3K 4NZ8A 4ZOAA 5F0LB 1SVCP 4QAMB 2BIQA 3RVUD 5IESH 4EN2A 2HVBA 4AZ8B 3CFQA 4AZ8A 1UEMA 5IQNA 3WD5L 2C1PB 2C1PA 3B9KD 5K1JA 1QFUH 1SBBA 5A6IA 3B3IB 3B3IA 5DS1A 3RZCC 5KVGL 1CF8L 1MFAH 3X3FL 5AVZB 2XX1A 5I0DA 2CZNA 4XCNA 1O9WA 4XCNB 1Q72H 4CUCA 2BS9A 4N2DA 4ZT1A 4YSCA 2VN6A 1W8EA 3MUGA 1SDDA 1SDDB 2QL1A 1S6NA 1FBIH 2AMUA 3MUGB 4OZFA 4OZFB 1BP3B 3BGFB 3HN8A 4H8PA 3JWOC 1M6UA 1ZJBA 1PLGL 2IWFA 3K81A 4LCWD 1CURA 4FZ8L 1HILB 1HILA 3FK3A 3MV11 1T66D 3O2DH 4RLDA 4FZEH 3S9DB 2V7HB 2V7HA 4FNUA 3GT6A 4K2UL 3BYTA 4BRJA 4MKMA 2WAQA 1P84K 3CVCA 4BM7A 3NJHA 4EPSA 1Z3RA 4TKWA 1UWXK 3OMIB 1KACB 4JUTA 2CK0L 1BLIA 2LHAA 4NZDA 2R2HB 2I5YH 2R2HA 1B6DA 2JCCB 2JCCA 2YEQA 4U1LA 4U1LB 4PW4A 3VTAA 3H9HB 3H9HA 4OT1L 5DK3A 1WSST 2BINA 2QADD 3DETD 4JGJA 1S4IA 2B1OA 2IDCA 3AXLA 3AXLB 4JQIH 4PB0H 3WAJA 4MWFB 4MWFA 4R8WH 3K4DA 1JNNL 4ORGB 2EICA 4ORGA 4WK0B 5AYUH 4DF9A 5CJOH 2K3TA 4H8HA 1INQA 1INQB 1WGVA 2ED9A 5KSVB 5KSVA 3II2A 3QSKB 3LKOB 3LKOA 2VR4A 2E9IA 3O6LH 1XCXA 4WW2F 3L4WA 2DWDA 2DWDB 2KUTA 5LLIC 3A4EA 1S8DA 1S8DB 1JPTL 5G2NA 1KXQE 4FQ1H 2R27A 1RHHA 1RHHB 5GRZA 4PVLA 4PHZA 4DKAA 4X42A 1EFXA 1EFXB 1H8NA 5GGRB 5GGRA 5D6CB 5D6CA 5F3HB 1UD5A 5F3HA 4AJVA 1O5PA 2WXNA 3KEDA 4C8XA 4RIRA 4RIRB 1L9OA 3LPWA 1S9WA 1S9WB 1HE8A 3V52L 3ORJA 2H47C 5FDYA 4Q7DA 3TYGL 1S9KC 5J12C 2ZG2A 3R19A 4RAVB 4RAVA 1OANA 2XXFA 4HLJA 4YSOA 1JPFB 1JPFA 4HT1H 1KCSL 2VM9A 2YAEA 4YIQA 1FNHA 4YIQB 5E6SB 1XD1A 5I0VA 3PV6B 3PV6A 3KH3A 5E6RB 4TUJB 4TUJA 3K2UH 1KXVA 3ZT7A 5GS1A 5GS1B 3SD5A 4JG1L 1DHKA 1YDPA 1YDPB 3ARDB 3ARDA 4JY4A 4JY4B 3T2QA 2WLIB 2WLIA 4MNGE 3ATFA 2ADJB 2ADJA 1UWGH 3G9AB 2WQWA 3CLEL 2OYKA 1EGJH 3EDJA 4YHLL 3ZTCC 4ZMWA 4FG0A 2Y2YA 2YMTA 3IWUA 4I3RL 5EN2B 5EN2A 4XNUH 2XHNA 3C12A 1Q0XH 1G7PB 1G7PA 1UZ6E 1FNSH 2CKBH 2DIEA 2P9RA 1Z5LB 1Z5LA 5I6XC 1SLXA 1WO2A 3CFNA 2DTML 2X3BA 2PNDA 4ODSL 4RDBA 2QTVA 1CN4A 2I60H 4WO4B 2FJFB 2FJFA 4GP5B 4WO4A 4Y5VA 2CPCA 4Y5VB 4YC2C 5HHOE 1BOYA 2EIKB 5L4IA 3WFCL 3FDWA 2B1HH 2NXZC 1BG9A 1R4XA 1S46A 2C8NA 2DQDH 2F54E 4PBXA 2ODIA 3QEHA 3QEHB 1KEML 3TGXA 2BNQB 2BNQA 4IOSA 3ULSB 3ULSA 3IRCA 3GWJA 2XI9A 3PDOA 3PDOB 4CKVX 5M94B 4MAUH 3S7GA 4HIIA 4HIIB 4QRFA 3INOA 5CJXC 1LP9F 4W9ZA 5ICYA 5ICYB 3DJTA 2KERA 1I8AA 1FH5H 4NQCE 3UG5A 1CC3A 4PP1C 3TVMA 1AQDB 1AQDA 3TVMB 1FCCA 1EIBA 2A9NL 4FQCH 4OD1H 3ZSTA 4XP9L 1B4LA 1JTOA 3JWDL 5GGVL 1B2YA 2DQGH 1XZWA 5EIIB 5EIIA 3P3RA 4XE0A 4HEME 3KL0A 4JNXA 4XBEL 1TU2A 1TU2B 2BMKB 2BMKA 4W9IC 3S35H 2R4SH 4AQAB 4AQAA 3MNMA 3KD4A 4JG0L 5DR5H 1FRGH 3MNVA 3MNVB 4MB1A 4Q9QH 2BDNL 3DETC 5LUMA 1UH3A 3AY4C 3DOSB 3DOSA 3MA9L 5K9QI 2ID5A 1KBWA 5E2UH 5DHEA 1H9DA 4OJEH 4KC3B 1KN2H 1UVQA 1UVQB 2H3XC 3RPKA 4CC0A 2ENSA 4JFFB 4JFFA 1CE1H 1U36A 4QXUH 2JLLA 4H0LC 3O4LB 3O4LA 3TXAA 3ZUNC 5DMYA 1QSEA 1QSEB 2XNAB 2XNAA 5B7FA 4AM0Q 2BSBA 3MV01 4UOQA 3APMA 3RA7L 1IFRA 1BYNA 2DWEA 2DWEB 3CFKA 3CFKB 4N8PA 3IGLA 3WKPA 1BD2D 1FPTL 3VVVA 2DQUH 4PJ9C 5DDHB 2OLDA 5DDHA 3VRJA 3VRJB 2P43B 3W82A 1TIUA 2FL5B 2FL5A 4DAGH 5D96B 2EEXA 1CLCA 2EYRB 2EYRA 4FXTA 4X6CF 4YX2H 1IBGL 5I74B 4P23A 4P23B 4HJ0C 3WMQA 1LE5A 3QPKA 1LE5B 1YMMB 1WPCA 1YMMA 2F1EA 5KYWA 5D1QC 5KYWB 1RUQL 5B7MA 1UT2A 1MLBA 1MLBB 1KGWA 1GGBL 4LP5A 2ZXAA 3QHZL 1OARH 2WINA 2WINB 3L7FB 3L7FA 4TNFA 3TBYA 3TBYB 2TSBA 3ZLQC 4G7VL 1KJ2A 1KJ2B 9CGTA 5AAPA 2NCEA 4Q56A 3SBQA 2X3AA 4EOWL 4YLQT 1MCOL 4JKPH 2GJPA 1MAMH 3NIDE 4WJG3 4O9HL 3L6FA 3L6FB 1NGQL 5KSUA 5KSUB 4DIXA 3P4NA 3P4NB 1PJWA 4KOBA 3W2DH 4OKVB 4OKVA 4ABWA 3GZKA 3MXVL 4X7TA 4X7TB 4OCWH 1FIGL 3RWJA 3RWJB 2DLTA 4OLWH 4PRIA 4PRIB 4N8CL 2LV4A 4P07A 4Z7UF 3H7BB 3H7BA 4TTGA 5HDBE 1BF8A 4NCC1 1RMFL 3I85A 4V33A 5FYKL 4KVCL 5HHNA 5HHNB 4DP9X 2ZX9A 4EQ2A 4Q6YA 1MJ7H 5DJXB 5DJXA 4JG5A 4URKA 4LLWA 1NLDL 3DLQR 2XWXA 2EUWA 1AE6L 1NCIA 1LO5B 1LO5A 1HZHH 4LDOB 4FQLH 5F8QC 5JQ6H 2KYIA 4FCHA 4O58H 4LVOC 5C9KA 4NI6A 1ZLWH 2V17H 4BE5A 5IBTH 5GGTA 5SWZB 5SWZA 4OY9A 3TV3H 2E0PA 4RGOH 2TSAA 4HSAC 5I71B 3BZDA 5IHWA 1FVEB 1FVEA 4M7KH 4AJYV 2ZX6A 4FQJH 1JYVA 5CJ8A 3MTXA 4HGWA 3C09B 4HGWB 5TD4A 4QNPE 2J1ZA 2W0LA 4QJ3B 2JLPA 3GJFB 3GJFA 4FHJA 3O0LA 1KCRL 1FORL 5GISH 4MQ7B 1JN6B 1JN6A 4MQ7A 1H3GA 3T2OA 4WGKA 1ODUA 4JB9H 1IT9H 3ISYA 1VJSA 2VXQH 4MB4A 3QQ4A 3QQ4B 4XMTA 1EDYA 1CDGA 3QVAA 3Q2VA 3HNVL 2X3CA 3MGOA 3MGOB 4RBPH 1YLBB 1KBPA 2FD6L 1G6RL 3UAEA 4DGIL 3HS9A 2PTVA 2J8OA 2W81C 3ETSA 3DVNB 3DVNA 5CMAA 5CMAB 4XMPL 2C7FA 4P2RE 1NBYA 1NBYB 4EKXA 1UCBH 5HYJE 4LSRL 1SXZA 1A6WL 2R0LH 3NFSH 4AGMA 1SLVA 4FNLH 2IOOA 2Q8BL 3HCVB 3HCVA 1KFAH 4N3TA 3OTTA 5D70H 3UYRH 2IOMA 3IFOA 3IFOB 4G8GB 4G8GA 1I3GL 5FAAA 3U0PB 3U0PA 1JXDA 1K9TA 1KYAA 3WOVA 5HP5A 1PZ2A 1N6QL 3RY6A 2WAHA 4CJ1A 1C1EH 3GM0A 4I89A 4LKXB 4LKXA 3SE3A 1DO6A 3UTQB 1YYLL 3UTQA 1QD0A 4RH4A 3DJZA 1A4BA 1G5GA 2WLNA 3G5XB 3G5XA 4FFZA 4QLRA 3N1MC 5C3LD 2H1PL 1GGIL 2JQAA 4GKSB 4GKSA 5F44A 3C5XA 1G7IA 1G7IB 1PX3A 2NY3D 2XX0A 2ZKXA 3SYCA 2XZQH 2DD8L 3Q48A 4HBCL 3AMLA 3ZKNC 4AEEA 4MJIE 4G9FB 4G9FA 3FL7A 2VLJE 1VEMA 2OJZL 1GGYA 1ACYL 3UJJH 4UQIM 4GW5B 3D85D 4GW5A 4HD5A 3F65A 5FOJA 4Y4FB 4Y4FA 1T0PB 2B77A 3VWKD 1OT4A 3GSNH 1F90L 3II3A 1FE8H 3BD5A 5HHMB 1WCQA 5DD5H 3B37A 3MJ8A 3MJ8B 1YN6B 1YN6A 4NJAH 1MWOA 3RTQB 3RTQA 3S4SG 3VUAA 3TT1H 1MPAH 4ZOEA 4R7DA 4R7DB 2COVD 4ERSL 1TSRA 2R29L 5DMGC 3DIDA 1CXFA 1M3JA 1IFGA 2WB7A 1KELL 3CFCL 4I88A 3AQYA 5CU9A 3GC3A 4MB5A 3TNMB 3TNMA 1MCCA 1PCXA 4DGVL 1C5BL 4LEXL 3NBNA 2GK2A 1AVAA 4ADIA 1L9PA 5HYIA 1EDQA 3WBDA 1Z0NA 2DEWX 3GXNA 4L3CA 4L3CB 3AROA 4L3AA 3FOMB 3FOMA 4GI8A 3OSKA 1A66A 3IXAB 3IXAA 1NUGA 2TRHA 2WXLA 3BVTA 3W5MA 1A3QA 2I7SA 3L1FA 1GMIA 3BN9D 1DVTA 1AQKL 4LLQA 4LLQB 3QDJB 3QDJA 1MFNA 5DLLA 1J10A 4FQXC 3TO2B 3TO2A 2QZ5A 2NX5D 2JVUA 3VI3E 4ONFL 4B53A 3QEGL 4BUGA 2IG2L 2MKLC 4PJIB 4PJIA 4JM2F 4LSSH 1JGDA 1JGDB 3T1WA 1HJBC 1ZANL 4PW3A 2Z8WC 5KSBA 5KSBB 1D6VH 3P2DA 4DQAA 1A7OL 1BXXA 2A6IA 2A6IB 3BSZL 3KS0H 4X7EC 5LBGA 4JPVL 5JIDA 1RAMA 3O4OB 3RDTD 4BZ1L 4MD5A 4MD5B 3V0WH 3DX7B 3DX7A 4GSXA 4J3OF 1WE5A 3H6AA 1ZLWK 5LNDA 1YNTF 1JGLH 2F7QA 4RESB 1D6EB 1D6EA 5DVLA 1XEDA 4DP1X 3ZE0E 1GGCH 4DH2A 4OFVA 3L5IA 1P7QA 1P7QB 5I6PA 1IQWH 2ZKMX 3MYJB 2R23A 2R23B 3MYJA 1F86A 3V4PL 4ODTL 4NB7A 1JL8A 2D73A 3DVFA 4FHBD 4L2YA 1ZSDB 1ZSDA 2B1AL 2K0RA 1RPKA 1UATA 1KY7A 1WQVT 2LU4A 2RD0A 3CXDL 3HNTH 3G3LA 4KY1H 4X5LA 3CVIH 3HE6A 3HE6B 5D72L 4RBPK 1SF5A 3MXWH 3MV7A 3MV7B 4GQZA 4N4YB 1GH7A 3FSAA 1F4AA 3SOTA 1DQIA 1YECL 4PJ7F 4GYBA 3PYCA 3HAEH 3CVHH 5IJKC 4Y9BA 4LAJH 3G6DL 5EZIH 3KVPA 3G5YB 3G5YA 4UNIA 1HCZA 2EEDA 3K0WA 2CHZA 2YRZA 3VD1A 3VG0L 3MBWA 3MBWB 4HQQL 4CJ0A 5KS9E 3KXFE 4JN1H 3I3BA 4L5FH 4KQ3H 3I2CH 5F1KC 2ESVD 4LGSB 3MRJB 3MRJA 5KJ4A 5KVDH 3WTSA 2X9ZA 3LN4A 3LN4B 4RSYA 1VGEH 3TWCH 3WL9A 2F7RA 3WL9B 2AXGB 2AXGA 4PJGA 4PJGB 5KANI 5MP6L 1B0GB 1B0GA 4M3KB 2F0CA 4CVUA 3BWUF 4LSPL 1TQSA 3ARBB 3ARBA 5J8OA 4HUCA 1WZ1H 4PCTA 2WKOF 3VWKC 4HHAA 4HHAB 2ZP9A 5JOEA 2WD0A 4HXAL 4QHLA 4QHLB 4K0OA 2D4DA 1N3NA 1N3NB 4LRIC 2WO3B 4C56A 1OSEA 4WY7H 4C56B 2AK1L 2Z7YA 2DDQH 2FJGA 2FJGB 3ASOB 2EKSA 2EKSB 1FFPA 1FFPB 2E86A 3CHXA 3E9UA 3QJQB 4WNJA 4WUUA 4WUUB 4H1LH 1LO3L 5E7BA 5H37H 4PRIE 5D8JH 1Y07A 4J3VA 5KG9B 5KG9A 1V8HA 1FG9C 4PRHE 5KYUA 5KYUB 2XU9A 5M95B 4KKLD 1NKRA 1DFBL 4P4KB 1ERNA 4P4KA 2HCZX 4O4YH 4ZFQA 3QUXD 3JYCA 4UOJA 5AOKA 3Q43A 3AITA 1L9NA 3GS4A 1HHHA 1HHHB 2Y22A 5T1KA 1JRHH 4QYAA 5T1KB 1AOZA 3MCLL 1T7XA 5DO2D 1PEWA 1BA9A 1ITCA 2DLFL 3GSUA 3GSUB 5C0CE 5I73C 2VDQH 3BIKB 3BIKA 3N42F 4ONGL 5KJRH 2LOEA 1X4YA 4WJKB 1L9RA 3HB3B 1ZK9A 3KJ4C 2ZP0T 2G2RA 5C3IA 2HKFH 5CUSH 3VXME 3A67L 1CF1A 1PZ5B 1PZ5A 2XJKA 3SJVD 3FUDA 4F7TA 4F7TB 4Y16B 4Y16A 1GTNA 4EZJA 4FYRA 4UDUB 4UDUA 2COQA 4A2MA 3WEXA 3WEXB 4OGAD 4ZZKA 3HBQA 3QXDA 3QXDB 3GIZL 2Z35B 2Z35A 2ADFH 3R0MA 1IAIM 2XWTB 2XWTA 1ZE3H 3VFGH 1R34A 4TQPA 1ZTMA 1WISA 1UOLA 2FWUA 3L4VA 3BJLA 3QORA 4GQ9H 3ZGIA 3BQUA 1CFNA 1CFNB 1L0XA 3BAKA 3BQUB 4X6DE 1IX2A 1JVKA 3BIBX 3VMOA 4F9LC 3JWOL 4X99B 4X99A 2CO4A 5E99H 3SKNA 3SKNB 1EDHA 3FC8A 5AW4B 3VXTB 3VXTA 4M6MH 5LCVL 1G1OA 1OVZA 1TEFA 2NXYC 3LNHA 1U6AL 3CZLA 1M56B 5E2JA 2DICA 4X6BA 4X6BB 2VDKH 3QIBC 4U7MA 2A73A 2A73B 4WK2B 4YHZL 3GUTA 1I8KB 1I8KA 4KXDA 3GUTB 1F6LL 4G82A 3KPNB 3KPNA 1NCAH 1X5GA 4M7ZB 4O02B 4O02A 4G8GE 1UADC 2Y1VA 4FXKA 4FXKB 2GJ6D 3GEFA 2D7OA 5SX5K 4OI7A 5CIPH 1COBA 2J4WH 2BX5A 5ALBH 1JG9A 1QFWL 3CXFA 3D4YA 5GGSY 2X4RB 2X4RA 3QUMA 3QUMB 5T3ZH 3WI9A 4O51A 4O51B 2E8YA 4I77L 5DVPA 5JIPA 4DPAX 1NCOA 2P4AB 5EOCJ 3PHAA 1SOKA 1WV7T 1IGFL 1FG2A 1FG2B 4U1JB 1L9MA 3FU7B 3FU7A 4U1JA 3STZA 3CFMA 3STZB 3U2SA 3U2SB 2OMXB 2OMXA 3HBPA 1FAKT 3LIZL 4LHUA 4LHUB 3HAEG 3NJXA 5BZWB 5BZWA 1CDCA 5HHQB 3ZE2B 5HHQA 1XDYA 4HPOH 1KB5L 2PXYC 3U30C 1SDAB 4JDEA 4JDEB 4OLUH 5CSGA 4FA7B 3GMLB 3GMLA 4PJCF 4AYGA 1KC5H 1XCWA 3DO3A 3LCYA 4NBYB 1D5XB 1D5XA 5D7JA 5D7JB 4YXLL 3TO4B 3TO4A 1A14H 3F7YA 3F7YB 5AVXB 3RPIA 3RPIB 1DJWA 4NO0D 1MRFH 3CQPA 2FATL 2DWYA 1S7TB 1S7TA 5DUPH 4ALAH 5E6IC 5C0RH 2EUXA 2ZWKA 4ZPVA 4ZPVB 5I0YA 1IKNA 5MENB 5MENA 4FLHA 3QUYD 4KKLC 1CXEA 3DOHA 1ZHKB 1ZHKA 5ILTH 2D9CA 5L88L 4B9IA 5IK3A 4J6IA 5IK3B 1A47A 4PM1A 5I82A 3QDJE 4P46A 4P46B 5D7HA 1CLOH 3U36A 3U36B 1NIFA 2CJUH 3BEWB 3BEWA 3MJ9H 1R5WA 3GS7A 3MODH 1L0QA 4Z7VE 5CM1A 1DQLH 3MV9A 3MV9B 4I0PA 4I0PB 3HG5A 4BFFA 5AVWB 4NKQB 3ZZLA 3LQAC 3M7OA 1T5WA 1T5WB 3VW3H 3HE7C 5ABZA 2O5XH 2WBXA 4FC3E 5CZRA 4IGBA 4IGBB 4XNZC 3SQOL 5DCCA 4PUBL 3D33A 5T5FL 3FSZA 5TJWK 1IZKA 4OH2A 1W8OA 2WXRA 1USZA 5T1MA 4Z3HA 4R4ND 4GAGL 4EIUA 4KKPA 4L1BA 3W37A 3UAJC 2QLVB 3GYRA 1RZFH 4YHKL 3ZTEA 4TVUA 1U0QA 1E90A 1KJ3H 1HHKB 1HHKA 1S3KL 1S7UB 1S7UA 2IPTL 4XVUD 5CGTA 1BG1A 4EI5B 1DYZA 2P5EE 4J3OH 5IW3A 5TDPA 2NQDA 5TDPB 1JPSL 4EI5A 4A68A 1EQWA 4X4YB 4X4YA 2WUBL 4PS8A 1KXTA 2VLRB 2VLRA 1BBDH 4M6NH 3D3VB 1B0RB 1B0RA 2VR5A 2HKHL 3D3VA 5EZJB 5EZJA 3W0WB 3W0WA 3U0WL 3WENA 4X5WA 3DRQB 3DRQA 4X5WB 3FZUC 2YD6A 2EO1A 1OAYH 3H55A 2OAAA 4OCLC 2JJVA 4XRCB 4XRCA 1TG8A 1MW2A 3W39A 4WI5A 3W39B 4XMXA 1MCIA 2AQNA 2DRUA 2IBZX 3GLZA 3HI6L 4OZIF 3P54A 4Z6AT 2WUCH 4XCFL 2AJYL 4BELD 4X8XA 6CGTA 3BZ4A 3BZ4B 4AYMC 3ECUA 5C09E 3FCTB 3FCTA 1UM5L 5DC4B 3L3HB 3FFOA 3L3HA 3VM7A 4P4RA 4P4RB 3BUPA 3RIKA 4MA3A 4MA3B 1MNUL 4U1GB 3TBSA 3TBSB 5BS0B 3WHE0 5BS0A 5BZDA 5BZDB 3IKKA 3LXCA 5T1LB 5T1LA 1B9KA 3RI5K 3ML8A 3OC8A 4NN6C 4OVVA 4ZRGA 2YZ8A 5HDOA 1A0QL 5JPMC 3F64A 2NZ1A 4K5OA 2P49B 1TSHA 1UFUA 4XZ4A 3QT2A 3CX2A 1MI5B 1MI5A 2YS4A 5EBLA 5EBLB 4AX3A 2VDMB 3HS0B 3HS0A 5ISZA 5ISZB 1GSMA 4RFEA 4RFEB 2EEBA 1WEJL 5IVOA 1HL4A 2YPLB 2PTTB 2PTTA 2YPLA 3DK0A 1CS6A 4X9IA 1T89C 2ZOLB 2ZOLA 4QXGH 2V2TA 3PUCA 2V2TB 2BZDA 5DD0H 5J11B 1FAIL 3D25B 2V5MA 2FIRT 3D25A 4KTYA 1I9IL 1NCTA 1RU9H 4JFWA 4UBDC 2ROYA 3D07A 1HNYA 3S35X 3VRLE 4N0YL 4ZJ9A 3ME0A 1OE3A 2MOGA 3EH2A 1EXGA 2O5YH 3QUYC 3R8QA 1OAUH 3FQYA 4LRNL 5BXFB 5BXFA 3MRMB 3MRMA 5PAZA 2GEEA 3QDGA 3QDGB 3PFQA 1NKGA 2WJ5A 3H4HA 3PP4H 5E1QA 1LWHA 3ZE1E 5DHYA 5DHYB 1IEHA 4NGHH 4FP8L 1BWWA 4E2OA 2C4XA 4OW6A 2NPLX 2YAFA 4MASA 3S98A 3ETBJ 3SYQA 4PRDA 4PRDB 3IU3A 3IU3B 2CGZA 4I2XB 4I2XA 4ETYA 2X4UA 2X4UB 4WCYL 3AG4B 2ORBH 5KSAD 4RFOH 2BP0A 2BP0B 4UZGA 4TRPH 4W9DC 4WFFE 2UUDK 1CDHA 2WOBA 3UXFA 5AW9B 3U4EA 3U4EB 5J6HB 5J6HA 4MJ5A 4MJ5B 1I8IA 1I8IB 2BNRA 2BNRB 3FCUB 4JO2L 4R4NC 4YVNA 7PAZA 2EXSA 1A02N 4ZFOB 4ZFOA 2WC7A 4Y4HC 1GPOH 3G5VB 3G5VA 4NUJA