The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
286
|
structure length |
274
|
Chain Sequence |
LAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMSHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
A general binding mechanism for all human sulfatases by the formylglycine-generating enzyme
pubmed doi rcsb |
molecule tags |
Hydrolase activator, protein binding
|
source organism |
Homo sapiens
|
molecule keywords |
Sulfatase modifying factor 1
|
total genus |
80
|
structure length |
274
|
sequence length |
286
|
ec nomenclature |
ec
1.8.3.7: Formylglycine-generating enzyme. |
pdb deposition date | 2005-07-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
X | PF03781 | FGE-sulfatase | Sulfatase-modifying factor enzyme 1 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | paralog of FGE (formylglycine-generating enzyme) | paralog of FGE (formylglycine-generating enzyme) |
#chains in the Genus database with same CATH superfamily 2AIK X; 1YU0 A; 2HI8 X; 1YU1 A; 1YU4 A; 1Z70 X; 1YU3 A; 2AIJ X; 1Y1G X; 1Y1F X; 1Y1J X; 1Y1H X; 2Q17 A; 2AFT X; 2Y3C A; 1YU2 A; 1Y1I X; 2IOU A; 1Y1E X; 2AII X; 1Y4J A; 2HIB X; 2AFY X; #chains in the Genus database with same CATH topology 2AIK X; 1YU0 A; 2HI8 X; 1YU1 A; 1YU4 A; 1Z70 X; 1YU3 A; 2AIJ X; 1Y1G X; 1Y1F X; 1Y1J X; 1Y1H X; 2Q17 A; 2AFT X; 2Y3C A; 1YU2 A; 1Y1I X; 2IOU A; 1Y1E X; 2AII X; 1Y4J A; 2HIB X; 2AFY X; #chains in the Genus database with same CATH homology 2AIK X; 1YU0 A; 2HI8 X; 1YU1 A; 1YU4 A; 1Z70 X; 1YU3 A; 2AIJ X; 1Y1G X; 1Y1F X; 1Y1J X; 1Y1H X; 2Q17 A; 2AFT X; 2Y3C A; 1YU2 A; 1Y1I X; 2IOU A; 1Y1E X; 2AII X; 1Y4J A; 2HIB X; 2AFY X;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...