1D9NA

Solution structure of the methyl-cpg-binding domain of the methylation-dependent transcriptional repressor mbd1/pcm1
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
75
structure length
75
Chain Sequence
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the methyl-CpG-binding domain of the methylation-dependent transcriptional repressor MBD1.
pubmed doi rcsb
molecule keywords METHYL-CPG-BINDING PROTEIN MBD1
molecule tags Gene regulation
source organism Homo sapiens
total genus 4
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 1d9nA00
1UB1A 3VYQA 5BT2A 3C2IA 1IG4A 2MOEA 2KY8A 3VYBA 3VXXA 1D9NA 2MB7A 3VXVA 1QK9A 4LG7A
chains in the Genus database with same CATH superfamily
1UB1A 3VYQA 5BT2A 3C2IA 1IG4A 2MOEA 2KY8A 3VYBA 3VXXA 1D9NA 2MB7A 3VXVA 1QK9A 4LG7A
chains in the Genus database with same CATH topology
1UB1A 3VYQA 5BT2A 3C2IA 1IG4A 2MOEA 2KY8A 3VYBA 3VXXA 1D9NA 2MB7A 3VXVA 1QK9A 4LG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UB1 A;  3VYQ A;  5BT2 A;  3C2I A;  1IG4 A;  2MOE A;  2KY8 A;  3VYB A;  3VXX A;  1D9N A;  2MB7 A;  3VXV A;  1QK9 A;  4LG7 A; 
#chains in the Genus database with same CATH topology
 1UB1 A;  3VYQ A;  5BT2 A;  3C2I A;  1IG4 A;  2MOE A;  2KY8 A;  3VYB A;  3VXX A;  1D9N A;  2MB7 A;  3VXV A;  1QK9 A;  4LG7 A; 
#chains in the Genus database with same CATH homology
 1UB1 A;  3VYQ A;  5BT2 A;  3C2I A;  1IG4 A;  2MOE A;  2KY8 A;  3VYB A;  3VXX A;  1D9N A;  2MB7 A;  3VXV A;  1QK9 A;  4LG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...