The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
72
|
structure length |
72
|
Chain Sequence |
RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIMYFEKVGDTSLDPNDFDFTVTGR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription regulator
|
molecule keywords |
Methyl-CpG-binding protein 2
|
publication title |
MeCP2 binding to DNA depends upon hydration at methyl-CpG
pubmed doi rcsb |
source organism |
Homo sapiens
|
total genus |
10
|
structure length |
72
|
sequence length |
72
|
ec nomenclature | |
pdb deposition date | 2008-01-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01429 | MBD | Methyl-CpG binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Methyl-cpg-binding Protein 2; Chain A | Methyl-cpg-binding Protein 2; Chain A |
#chains in the Genus database with same CATH superfamily 3VXX A; 2MB7 A; 1IG4 A; 2MOE A; 1D9N A; 5BT2 A; 3VYQ A; 3C2I A; 3VXV A; 2KY8 A; 1QK9 A; 4LG7 A; 1UB1 A; 3VYB A; #chains in the Genus database with same CATH topology 3VXX A; 2MB7 A; 1IG4 A; 2MOE A; 1D9N A; 5BT2 A; 3VYQ A; 3C2I A; 3VXV A; 2KY8 A; 1QK9 A; 4LG7 A; 1UB1 A; 3VYB A; #chains in the Genus database with same CATH homology 3VXX A; 2MB7 A; 1IG4 A; 2MOE A; 1D9N A; 5BT2 A; 3VYQ A; 3C2I A; 3VXV A; 2KY8 A; 1QK9 A; 4LG7 A; 1UB1 A; 3VYB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...