4LG7A

Crystal structure mbd4 mbd domain in complex with methylated cpg dna
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
63
structure length
63
Chain Sequence
RKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure MBD4 MBD domain in complex with methylated CpG DNA
rcsb
molecule keywords Methyl-CpG-binding domain protein 4
molecule tags Hydrolase/dna
source organism Homo sapiens
total genus 10
structure length 63
sequence length 63
ec nomenclature ec 3.2.2.-:
pdb deposition date 2013-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 4lg7A00
3C2IA 1QK9A 1UB1A 5BT2A 2MB7A 1D9NA 3VYQA 3VYBA 2KY8A 4LG7A 2MOEA 3VXVA 3VXXA 1IG4A
chains in the Genus database with same CATH superfamily
3C2IA 1QK9A 1UB1A 5BT2A 2MB7A 1D9NA 3VYQA 3VYBA 2KY8A 4LG7A 2MOEA 3VXVA 3VXXA 1IG4A
chains in the Genus database with same CATH topology
3C2IA 1QK9A 1UB1A 5BT2A 2MB7A 1D9NA 3VYQA 3VYBA 2KY8A 4LG7A 2MOEA 3VXVA 3VXXA 1IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2I A;  1QK9 A;  1UB1 A;  5BT2 A;  2MB7 A;  1D9N A;  3VYQ A;  3VYB A;  2KY8 A;  4LG7 A;  2MOE A;  3VXV A;  3VXX A;  1IG4 A; 
#chains in the Genus database with same CATH topology
 3C2I A;  1QK9 A;  1UB1 A;  5BT2 A;  2MB7 A;  1D9N A;  3VYQ A;  3VYB A;  2KY8 A;  4LG7 A;  2MOE A;  3VXV A;  3VXX A;  1IG4 A; 
#chains in the Genus database with same CATH homology
 3C2I A;  1QK9 A;  1UB1 A;  5BT2 A;  2MB7 A;  1D9N A;  3VYQ A;  3VYB A;  2KY8 A;  4LG7 A;  2MOE A;  3VXV A;  3VXX A;  1IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...