2KY8A

Solution structure and dynamic analysis of chicken mbd2 methyl binding domain bound to a target methylated dna sequence
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
DKQGRTDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVDLSCFDFRTGKMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamic analysis of chicken MBD2 methyl binding domain bound to a target-methylated DNA sequence.
pubmed doi rcsb
molecule keywords Methyl-CpG-binding domain protein 2
molecule tags Transcription/dna
source organism Gallus gallus
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 2ky8A00
3VXVA 1D9NA 3VYQA 1IG4A 3VYBA 2MB7A 1UB1A 5BT2A 3VXXA 2MOEA 1QK9A 3C2IA 2KY8A 4LG7A
chains in the Genus database with same CATH superfamily
3VXVA 1D9NA 3VYQA 1IG4A 3VYBA 2MB7A 1UB1A 5BT2A 3VXXA 2MOEA 1QK9A 3C2IA 2KY8A 4LG7A
chains in the Genus database with same CATH topology
3VXVA 1D9NA 3VYQA 1IG4A 3VYBA 2MB7A 1UB1A 5BT2A 3VXXA 2MOEA 1QK9A 3C2IA 2KY8A 4LG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VXV A;  1D9N A;  3VYQ A;  1IG4 A;  3VYB A;  2MB7 A;  1UB1 A;  5BT2 A;  3VXX A;  2MOE A;  1QK9 A;  3C2I A;  2KY8 A;  4LG7 A; 
#chains in the Genus database with same CATH topology
 3VXV A;  1D9N A;  3VYQ A;  1IG4 A;  3VYB A;  2MB7 A;  1UB1 A;  5BT2 A;  3VXX A;  2MOE A;  1QK9 A;  3C2I A;  2KY8 A;  4LG7 A; 
#chains in the Genus database with same CATH homology
 3VXV A;  1D9N A;  3VYQ A;  1IG4 A;  3VYB A;  2MB7 A;  1UB1 A;  5BT2 A;  3VXX A;  2MOE A;  1QK9 A;  3C2I A;  2KY8 A;  4LG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...