3VYBA

Crystal structure of methyl cpg binding domain of mbd4 in complex with the 5mcg/hmcg sequence
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
63
Chain Sequence
PVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGETFLKPEDFNFTVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the versatile DNA recognition ability of the methyl-CpG binding domain of methyl-CpG binding domain protein 4
pubmed doi rcsb
molecule keywords Methyl-CpG-binding domain protein 4
molecule tags Hydrolase/dna
source organism Mus musculus
total genus 9
structure length 63
sequence length 63
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 3vybA00
5BT2A 3VYBA 3VYQA 1IG4A 2MB7A 3VXVA 3VXXA 1QK9A 1UB1A 4LG7A 3C2IA 2MOEA 1D9NA 2KY8A
chains in the Genus database with same CATH superfamily
5BT2A 3VYBA 3VYQA 1IG4A 2MB7A 3VXVA 3VXXA 1QK9A 1UB1A 4LG7A 3C2IA 2MOEA 1D9NA 2KY8A
chains in the Genus database with same CATH topology
5BT2A 3VYBA 3VYQA 1IG4A 2MB7A 3VXVA 3VXXA 1QK9A 1UB1A 4LG7A 3C2IA 2MOEA 1D9NA 2KY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BT2 A;  3VYB A;  3VYQ A;  1IG4 A;  2MB7 A;  3VXV A;  3VXX A;  1QK9 A;  1UB1 A;  4LG7 A;  3C2I A;  2MOE A;  1D9N A;  2KY8 A; 
#chains in the Genus database with same CATH topology
 5BT2 A;  3VYB A;  3VYQ A;  1IG4 A;  2MB7 A;  3VXV A;  3VXX A;  1QK9 A;  1UB1 A;  4LG7 A;  3C2I A;  2MOE A;  1D9N A;  2KY8 A; 
#chains in the Genus database with same CATH homology
 5BT2 A;  3VYB A;  3VYQ A;  1IG4 A;  2MB7 A;  3VXV A;  3VXX A;  1QK9 A;  1UB1 A;  4LG7 A;  3C2I A;  2MOE A;  1D9N A;  2KY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...