5BT2A

Mecp2 mbd domain (a140v) in complex with methylated dna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
GPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIVYFEKVGDTSLDPNDFDFTVTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A/T Run Geometry of B-form DNA Is Independent of Bound Methyl-CpG Binding Domain, Cytosine Methylation and Flanking Sequence
doi rcsb
molecule keywords Methyl-CpG-binding protein 2
molecule tags Dna binding protein/dna
source organism Homo sapiens
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2015-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01429 MBD Methyl-CpG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 5bt2A01
3VXXA 4LG7A 1IG4A 2KY8A 5BT2A 1D9NA 3VYQA 3VXVA 2MB7A 2MOEA 1UB1A 3VYBA 3C2IA 1QK9A
chains in the Genus database with same CATH superfamily
3VXXA 4LG7A 1IG4A 2KY8A 5BT2A 1D9NA 3VYQA 3VXVA 2MB7A 2MOEA 1UB1A 3VYBA 3C2IA 1QK9A
chains in the Genus database with same CATH topology
3VXXA 4LG7A 1IG4A 2KY8A 5BT2A 1D9NA 3VYQA 3VXVA 2MB7A 2MOEA 1UB1A 3VYBA 3C2IA 1QK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VXX A;  4LG7 A;  1IG4 A;  2KY8 A;  5BT2 A;  1D9N A;  3VYQ A;  3VXV A;  2MB7 A;  2MOE A;  1UB1 A;  3VYB A;  3C2I A;  1QK9 A; 
#chains in the Genus database with same CATH topology
 3VXX A;  4LG7 A;  1IG4 A;  2KY8 A;  5BT2 A;  1D9N A;  3VYQ A;  3VXV A;  2MB7 A;  2MOE A;  1UB1 A;  3VYB A;  3C2I A;  1QK9 A; 
#chains in the Genus database with same CATH homology
 3VXX A;  4LG7 A;  1IG4 A;  2KY8 A;  5BT2 A;  1D9N A;  3VYQ A;  3VXV A;  2MB7 A;  2MOE A;  1UB1 A;  3VYB A;  3C2I A;  1QK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...