2MOEA

Solution structure of mbd4 methyl-cytosine binding domain bound to methylated dna
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
71
structure length
71
Chain Sequence
GSTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTVLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure and intramolecular exchange of methyl-cytosine binding domain protein 4 (MBD4) on DNA suggests a mechanism to scan for mCpG/TpG mismatches.
pubmed doi rcsb
molecule keywords Methyl-CpG-binding domain protein 4
molecule tags Hydrolase/dna
source organism Homo sapiens
total genus 6
structure length 71
sequence length 71
ec nomenclature ec 3.2.2.-:
pdb deposition date 2014-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 2moeA00
4LG7A 1D9NA 1IG4A 3VYBA 1UB1A 2KY8A 3VXXA 3VYQA 1QK9A 2MOEA 5BT2A 3C2IA 2MB7A 3VXVA
chains in the Genus database with same CATH superfamily
4LG7A 1D9NA 1IG4A 3VYBA 1UB1A 2KY8A 3VXXA 3VYQA 1QK9A 2MOEA 5BT2A 3C2IA 2MB7A 3VXVA
chains in the Genus database with same CATH topology
4LG7A 1D9NA 1IG4A 3VYBA 1UB1A 2KY8A 3VXXA 3VYQA 1QK9A 2MOEA 5BT2A 3C2IA 2MB7A 3VXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG7 A;  1D9N A;  1IG4 A;  3VYB A;  1UB1 A;  2KY8 A;  3VXX A;  3VYQ A;  1QK9 A;  2MOE A;  5BT2 A;  3C2I A;  2MB7 A;  3VXV A; 
#chains in the Genus database with same CATH topology
 4LG7 A;  1D9N A;  1IG4 A;  3VYB A;  1UB1 A;  2KY8 A;  3VXX A;  3VYQ A;  1QK9 A;  2MOE A;  5BT2 A;  3C2I A;  2MB7 A;  3VXV A; 
#chains in the Genus database with same CATH homology
 4LG7 A;  1D9N A;  1IG4 A;  3VYB A;  1UB1 A;  2KY8 A;  3VXX A;  3VYQ A;  1QK9 A;  2MOE A;  5BT2 A;  3C2I A;  2MB7 A;  3VXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...