1IG4A

Solution structure of the methyl-cpg-binding domain of human mbd1 in complex with methylated dna
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the methyl-CpG binding domain of human MBD1 in complex with methylated DNA.
pubmed doi rcsb
molecule keywords 5'-D(*GP*TP*AP*TP*CP*(5CM)P*GP*GP*AP*TP*AP*C)-3'
molecule tags Transcription/dna
source organism Homo sapiens
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2001-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 1ig4A00
1D9NA 2KY8A 3VXVA 3VYBA 1UB1A 4LG7A 3C2IA 3VXXA 2MOEA 2MB7A 3VYQA 5BT2A 1IG4A 1QK9A
chains in the Genus database with same CATH superfamily
1D9NA 2KY8A 3VXVA 3VYBA 1UB1A 4LG7A 3C2IA 3VXXA 2MOEA 2MB7A 3VYQA 5BT2A 1IG4A 1QK9A
chains in the Genus database with same CATH topology
1D9NA 2KY8A 3VXVA 3VYBA 1UB1A 4LG7A 3C2IA 3VXXA 2MOEA 2MB7A 3VYQA 5BT2A 1IG4A 1QK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9N A;  2KY8 A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  3C2I A;  3VXX A;  2MOE A;  2MB7 A;  3VYQ A;  5BT2 A;  1IG4 A;  1QK9 A; 
#chains in the Genus database with same CATH topology
 1D9N A;  2KY8 A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  3C2I A;  3VXX A;  2MOE A;  2MB7 A;  3VYQ A;  5BT2 A;  1IG4 A;  1QK9 A; 
#chains in the Genus database with same CATH homology
 1D9N A;  2KY8 A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  3C2I A;  3VXX A;  2MOE A;  2MB7 A;  3VYQ A;  5BT2 A;  1IG4 A;  1QK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...