3VXVA

Crystal structure of methyl cpg binding domain of mbd4 in complex with the 5mcg/tg sequence
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
65
structure length
65
Chain Sequence
KPVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGETFLKPEDFNFTVLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of the versatile DNA recognition ability of the methyl-CpG binding domain of methyl-CpG binding domain protein 4
pubmed doi rcsb
molecule keywords Methyl-CpG-binding domain protein 4
molecule tags Hydrolase/dna
source organism Mus musculus
total genus 9
structure length 65
sequence length 65
ec nomenclature ec 3.2.2.-:
pdb deposition date 2012-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 3vxvA00
3VYBA 1UB1A 3VXVA 1D9NA 3VXXA 3C2IA 2KY8A 4LG7A 5BT2A 2MB7A 3VYQA 2MOEA 1QK9A 1IG4A
chains in the Genus database with same CATH superfamily
3VYBA 1UB1A 3VXVA 1D9NA 3VXXA 3C2IA 2KY8A 4LG7A 5BT2A 2MB7A 3VYQA 2MOEA 1QK9A 1IG4A
chains in the Genus database with same CATH topology
3VYBA 1UB1A 3VXVA 1D9NA 3VXXA 3C2IA 2KY8A 4LG7A 5BT2A 2MB7A 3VYQA 2MOEA 1QK9A 1IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYB A;  1UB1 A;  3VXV A;  1D9N A;  3VXX A;  3C2I A;  2KY8 A;  4LG7 A;  5BT2 A;  2MB7 A;  3VYQ A;  2MOE A;  1QK9 A;  1IG4 A; 
#chains in the Genus database with same CATH topology
 3VYB A;  1UB1 A;  3VXV A;  1D9N A;  3VXX A;  3C2I A;  2KY8 A;  4LG7 A;  5BT2 A;  2MB7 A;  3VYQ A;  2MOE A;  1QK9 A;  1IG4 A; 
#chains in the Genus database with same CATH homology
 3VYB A;  1UB1 A;  3VXV A;  1D9N A;  3VXX A;  3C2I A;  2KY8 A;  4LG7 A;  5BT2 A;  2MB7 A;  3VYQ A;  2MOE A;  1QK9 A;  1IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...