1QK9A

The solution structure of the domain from mecp2 that binds to methylated dna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
92
structure length
92
Chain Sequence
ASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSGSGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of the Domain from Mecp2 that Binds to Methylated DNA
pubmed doi rcsb
molecule keywords METHYL-CPG-BINDING PROTEIN 2
molecule tags Methyl-cpg-binding protein
source organism Homo sapiens
total genus 7
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1999-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01429 MBD Methyl-CpG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 1qk9A00
2KY8A 1QK9A 2MB7A 1IG4A 3VXXA 1D9NA 3VXVA 3VYBA 1UB1A 4LG7A 2MOEA 5BT2A 3VYQA 3C2IA
chains in the Genus database with same CATH superfamily
2KY8A 1QK9A 2MB7A 1IG4A 3VXXA 1D9NA 3VXVA 3VYBA 1UB1A 4LG7A 2MOEA 5BT2A 3VYQA 3C2IA
chains in the Genus database with same CATH topology
2KY8A 1QK9A 2MB7A 1IG4A 3VXXA 1D9NA 3VXVA 3VYBA 1UB1A 4LG7A 2MOEA 5BT2A 3VYQA 3C2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KY8 A;  1QK9 A;  2MB7 A;  1IG4 A;  3VXX A;  1D9N A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  2MOE A;  5BT2 A;  3VYQ A;  3C2I A; 
#chains in the Genus database with same CATH topology
 2KY8 A;  1QK9 A;  2MB7 A;  1IG4 A;  3VXX A;  1D9N A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  2MOE A;  5BT2 A;  3VYQ A;  3C2I A; 
#chains in the Genus database with same CATH homology
 2KY8 A;  1QK9 A;  2MB7 A;  1IG4 A;  3VXX A;  1D9N A;  3VXV A;  3VYB A;  1UB1 A;  4LG7 A;  2MOE A;  5BT2 A;  3VYQ A;  3C2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...