1ES6A

Crystal structure of the matrix protein of ebola virus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
278
structure length
260
Chain Sequence
GDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDGALRPGISFHPKLRPILLPNKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the matrix protein VP40 from Ebola virus.
pubmed doi rcsb
source organism Ebola virus sp.
molecule tags Viral protein
molecule keywords MATRIX PROTEIN VP40
total genus 56
structure length 260
sequence length 278
ec nomenclature
pdb deposition date 2000-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.510.10 Mainly Beta Sandwich EV matrix protein fold EV matrix protein 1es6A02
2.70.20.20 Mainly Beta Distorted Sandwich Topoisomerase I; domain 3 Topoisomerase I; domain 3 1es6A01
1H2CA 1H2DA 4LDMA 1ES6A 4LDDA 5B0VA 4LD8A 4LDBA 3TCQA
chains in the Genus database with same CATH superfamily
4DDTA 1D6MA 1H2DA 4DDWA 4D4TA 1MW9X 1ECLA 4LP7A 4DDUA 2YKDA 2O54A 3PWTA 3TCQA 1CY8A 4HIUA 4LDDA 4G1LA 3PX7A 2O5EA 1CY1A 4HITA 1GL9B 1CY7A 1CY9A 2GAIA 4CHTA 4HIYA 1ES6A 4LDMA 5D5HA 5B0VA 1CY2A 4G1GA 2O5CA 4G1OA 4LD8A 4DDVA 3F1JA 1MW8X 4LDBA 1CYYA 1H2CA 4CGYA 1I7DA 4HIWA 1CY4A 4RULA 2VQPA 2GAJA 4HI6A 2O19A 1GKUB 4HI5A 1CY6A 1CY0A 2O59A 4V23A
chains in the Genus database with same CATH topology
1H2DA 4D4TA 4LP7A 3TCQA 4HIUA 4LDDA 4G1LA 4HITA 4HIYA 1ES6A 4LDMA 5B0VA 4G1GA 4G1OA 4LD8A 3F1JA 4LDBA 1H2CA 4HIWA 2VQPA 4HI6A 4HI5A 2YKDA 4V23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2C A;  1H2D A;  4LDM A;  1ES6 A;  4LDD A;  5B0V A;  4LD8 A;  4LDB A;  3TCQ A; 
#chains in the Genus database with same CATH topology
 4DDT A;  1D6M A;  1H2D A;  4DDW A;  4D4T A;  1MW9 X;  1ECL A;  4LP7 A;  4DDU A;  2YKD A;  2O54 A;  3PWT A;  3TCQ A;  1CY8 A;  4HIU A;  4LDD A;  4G1L A;  3PX7 A;  2O5E A;  1CY1 A;  4HIT A;  1GL9 B;  1CY7 A;  1CY9 A;  2GAI A;  4CHT A;  4HIY A;  1ES6 A;  4LDM A;  5D5H A;  5B0V A;  1CY2 A;  4G1G A;  2O5C A;  4G1O A;  4LD8 A;  4DDV A;  3F1J A;  1MW8 X;  4LDB A;  1CYY A;  1H2C A;  4CGY A;  1I7D A;  4HIW A;  1CY4 A;  4RUL A;  2VQP A;  2GAJ A;  4HI6 A;  2O19 A;  1GKU B;  4HI5 A;  1CY6 A;  1CY0 A;  2O59 A;  4V23 A; 
#chains in the Genus database with same CATH homology
 1H2D A;  4D4T A;  4LP7 A;  3TCQ A;  4HIU A;  4LDD A;  4G1L A;  4HIT A;  4HIY A;  1ES6 A;  4LDM A;  5B0V A;  4G1G A;  4G1O A;  4LD8 A;  3F1J A;  4LDB A;  1H2C A;  4HIW A;  2VQP A;  4HI6 A;  4HI5 A;  2YKD A;  4V23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...