4LDDA

Crystal structure of ebola virus vp40 hexamer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
144
structure length
137
Chain Sequence
DTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPLPQYFTFDLTALKLITQPLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Rearrangement of Ebola Virus VP40 Begets Multiple Functions in the Virus Life Cycle.
pubmed doi rcsb
source organism Ebola virus
molecule tags Viral protein
molecule keywords Matrix protein VP40
total genus 27
structure length 137
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.20.20 Mainly Beta Distorted Sandwich Topoisomerase I; domain 3 Topoisomerase I; domain 3 4lddA00
3TCQA 1H2DA 4LD8A 4LDMA 1ES6A 4LDBA 5B0VA 1H2CA 4LDDA
chains in the Genus database with same CATH superfamily
3PWTA 4V23A 1CY8A 2GAIA 1ES6A 4LDBA 2O5CA 1CY1A 4HIWA 1H2CA 3F1JA 2O59A 1CY9A 1H2DA 4LD8A 4G1LA 4LDMA 2GAJA 4LP7A 4CGYA 1D6MA 4HI5A 1CYYA 5B0VA 5D5HA 1ECLA 1CY0A 2YKDA 1MW8X 1CY7A 4HIYA 4RULA 4CHTA 3PX7A 4HIUA 4G1GA 1CY4A 1CY6A 4LDDA 2O19A 2VQPA 4HITA 2O5EA 2O54A 3TCQA 4G1OA 4D4TA 1I7DA 1CY2A 1MW9X 4HI6A
chains in the Genus database with same CATH topology
1ES6A 4LDBA 4HIWA 1H2CA 3F1JA 1H2DA 4LD8A 4G1LA 4LDMA 4LP7A 4HI5A 5B0VA 2YKDA 4HIYA 4HIUA 4G1GA 4LDDA 2VQPA 4HITA 4HI6A 3TCQA 4G1OA 4D4TA 4V23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TCQ A;  1H2D A;  4LD8 A;  4LDM A;  1ES6 A;  4LDB A;  5B0V A;  1H2C A;  4LDD A; 
#chains in the Genus database with same CATH topology
 3PWT A;  4V23 A;  1CY8 A;  2GAI A;  1ES6 A;  4LDB A;  2O5C A;  1CY1 A;  4HIW A;  1H2C A;  3F1J A;  2O59 A;  1CY9 A;  1H2D A;  4LD8 A;  4G1L A;  4LDM A;  2GAJ A;  4LP7 A;  4CGY A;  1D6M A;  4HI5 A;  1CYY A;  5B0V A;  5D5H A;  1ECL A;  1CY0 A;  2YKD A;  1MW8 X;  1CY7 A;  4HIY A;  4RUL A;  4CHT A;  3PX7 A;  4HIU A;  4G1G A;  1CY4 A;  1CY6 A;  4LDD A;  2O19 A;  2VQP A;  4HIT A;  2O5E A;  2O54 A;  3TCQ A;  4G1O A;  4D4T A;  1I7D A;  1CY2 A;  1MW9 X;  4HI6 A; 
#chains in the Genus database with same CATH homology
 1ES6 A;  4LDB A;  4HIW A;  1H2C A;  3F1J A;  1H2D A;  4LD8 A;  4G1L A;  4LDM A;  4LP7 A;  4HI5 A;  5B0V A;  2YKD A;  4HIY A;  4HIU A;  4G1G A;  4LDD A;  2VQP A;  4HIT A;  4HI6 A;  3TCQ A;  4G1O A;  4D4T A;  4V23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...