4G1OA

Crystal structure of newcastle disease virus matrix protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
350
structure length
329
Chain Sequence
SALPSSNLLAFPIVLQQIAPQYRIQRLDSWTDSKEDSVFITTYGFIFQVGHELLSAAMLCLGSVPNVGDLVELARACLTMVVTCKKSATDTERMVFSVVQAPQVLQSCRVVANKYSSVNAVKHVKAPEKIPGSGTLEYKVNFVSLTVVPRKDVYKIPTAALKVSGSSLYNLALNVTIDVEVDPKSPLVKSLSKSDSGYYANLFLHIGLMSTVDKKGKKVTFDKLERKIRRLDLSVGLSDVLGPSVLVKARGARTRLLAPFFSSSGTACYPISNASPQVAKILWSQTARLRSVKVIIQAGTQRAVAVTADHEVTSTKIEKRHTIAKYNPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and assembly of a paramyxovirus matrix protein.
pubmed doi rcsb
source organism Newcastle disease virus
molecule tags Viral protein
molecule keywords Matrix protein
total genus 76
structure length 329
sequence length 350
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00661 Matrix Viral matrix protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.20.50 Mainly Beta Distorted Sandwich Topoisomerase I; domain 3 Topoisomerase I; domain 3 4g1oA01
2.70.20.60 Mainly Beta Distorted Sandwich Topoisomerase I; domain 3 Topoisomerase I; domain 3 4g1oA02
4G1GA 4G1LA 4G1OA
chains in the Genus database with same CATH superfamily
1H2DA 4LD8A 2GAJA 4D4TA 2VQPA 1CY6A 4HIYA 4G1OA 4G1GA 1MW8X 1CY9A 4HIUA 1CY2A 2YKDA 2O5EA 5D5HA 1CY1A 3TCQA 2GAIA 4RULA 1CY4A 4HIWA 4HITA 4HI5A 1CY8A 4CGYA 4LDBA 1ES6A 2O54A 2O59A 4LDDA 2O19A 4G1LA 3PWTA 1H2CA 1I7DA 1CYYA 4LDMA 5B0VA 4LP7A 3PX7A 4CHTA 1ECLA 1CY0A 1MW9X 2O5CA 4HI6A 4V23A 1D6MA 3F1JA 1CY7A
chains in the Genus database with same CATH topology
1H2DA 4LD8A 4D4TA 2VQPA 4HIYA 4G1OA 4G1GA 4HIUA 2YKDA 3TCQA 4HI5A 4HIWA 4HITA 4LDBA 1ES6A 4LDDA 4G1LA 1H2CA 5B0VA 4LDMA 4LP7A 4V23A 4HI6A 3F1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1G A;  4G1L A;  4G1O A; 
#chains in the Genus database with same CATH topology
 1H2D A;  4LD8 A;  2GAJ A;  4D4T A;  2VQP A;  1CY6 A;  4HIY A;  4G1O A;  4G1G A;  1MW8 X;  1CY9 A;  4HIU A;  1CY2 A;  2YKD A;  2O5E A;  5D5H A;  1CY1 A;  3TCQ A;  2GAI A;  4RUL A;  1CY4 A;  4HIW A;  4HIT A;  4HI5 A;  1CY8 A;  4CGY A;  4LDB A;  1ES6 A;  2O54 A;  2O59 A;  4LDD A;  2O19 A;  4G1L A;  3PWT A;  1H2C A;  1I7D A;  1CYY A;  4LDM A;  5B0V A;  4LP7 A;  3PX7 A;  4CHT A;  1ECL A;  1CY0 A;  1MW9 X;  2O5C A;  4HI6 A;  4V23 A;  1D6M A;  3F1J A;  1CY7 A; 
#chains in the Genus database with same CATH homology
 1H2D A;  4LD8 A;  4D4T A;  2VQP A;  4HIY A;  4G1O A;  4G1G A;  4HIU A;  2YKD A;  3TCQ A;  4HI5 A;  4HIW A;  4HIT A;  4LDB A;  1ES6 A;  4LDD A;  4G1L A;  1H2C A;  5B0V A;  4LDM A;  4LP7 A;  4V23 A;  4HI6 A;  3F1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...