4HI5A

Crystal structure of f37a mutant of borna disease virus matrix protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
140
structure length
135
Chain Sequence
SKHSYVELKDKVIVPGWPTLMLEIDFVNQALNIPFLSVKEPLQLPREKKLTDYFTIDVEPAGHSLVNIYFQIDDFLLLTLNSLSVYKDPIRKYMFLRLNKEQSKHAINAAFNVFSYRLRNIGVGPLGPDIRSSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Matrix protein variants provide support for alternative borna disease virus infection pathway
rcsb
source organism Borna disease virus
molecule tags Viral protein
molecule keywords Matrix protein
total genus 26
structure length 135
sequence length 140
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16520 BDV_M ssRNA-binding matrix protein of Bornaviridae
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.20.40 Mainly Beta Distorted Sandwich Topoisomerase I; domain 3 Topoisomerase I; domain 3 4hi5A00
4HIUA 3F1JA 4HIYA 4HI6A 4HIWA 4HI5A 4HITA
chains in the Genus database with same CATH superfamily
4HIUA 3F1JA 4G1OA 2O59A 4LD8A 4G1GA 1CY1A 4HI5A 1D6MA 1CYYA 4G1LA 3TCQA 1H2CA 1MW9X 4V23A 4HIYA 4CGYA 1CY2A 1MW8X 1CY7A 4HITA 2O54A 2VQPA 1ECLA 2GAJA 4D4TA 2O19A 4CHTA 4HIWA 1CY9A 2YKDA 5D5HA 4RULA 1H2DA 2O5EA 1CY4A 4LP7A 5B0VA 2GAIA 3PWTA 1CY0A 4LDMA 4LDDA 2O5CA 1CY8A 1CY6A 4HI6A 4LDBA 3PX7A 1ES6A 1I7DA
chains in the Genus database with same CATH topology
4HIUA 3F1JA 4G1OA 4LD8A 4G1GA 4HI5A 4G1LA 3TCQA 1H2CA 4V23A 4HIYA 4HITA 2VQPA 4D4TA 4HIWA 2YKDA 1H2DA 4LP7A 5B0VA 4LDMA 4LDDA 4HI6A 4LDBA 1ES6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIU A;  3F1J A;  4HIY A;  4HI6 A;  4HIW A;  4HI5 A;  4HIT A; 
#chains in the Genus database with same CATH topology
 4HIU A;  3F1J A;  4G1O A;  2O59 A;  4LD8 A;  4G1G A;  1CY1 A;  4HI5 A;  1D6M A;  1CYY A;  4G1L A;  3TCQ A;  1H2C A;  1MW9 X;  4V23 A;  4HIY A;  4CGY A;  1CY2 A;  1MW8 X;  1CY7 A;  4HIT A;  2O54 A;  2VQP A;  1ECL A;  2GAJ A;  4D4T A;  2O19 A;  4CHT A;  4HIW A;  1CY9 A;  2YKD A;  5D5H A;  4RUL A;  1H2D A;  2O5E A;  1CY4 A;  4LP7 A;  5B0V A;  2GAI A;  3PWT A;  1CY0 A;  4LDM A;  4LDD A;  2O5C A;  1CY8 A;  1CY6 A;  4HI6 A;  4LDB A;  3PX7 A;  1ES6 A;  1I7D A; 
#chains in the Genus database with same CATH homology
 4HIU A;  3F1J A;  4G1O A;  4LD8 A;  4G1G A;  4HI5 A;  4G1L A;  3TCQ A;  1H2C A;  4V23 A;  4HIY A;  4HIT A;  2VQP A;  4D4T A;  4HIW A;  2YKD A;  1H2D A;  4LP7 A;  5B0V A;  4LDM A;  4LDD A;  4HI6 A;  4LDB A;  1ES6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...