The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELTRYLGPACDLTLFDFKQGILCYPAPK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription/dna
|
| source organism |
Homo sapiens
|
| publication title |
Solution structure of the methyl-CpG binding domain of human MBD1 in complex with methylated DNA.
pubmed doi rcsb |
| molecule keywords |
5'-D(*GP*TP*AP*TP*CP*(5CM)P*GP*GP*AP*TP*AP*C)-3'
|
| total genus |
6
|
| structure length |
75
|
| sequence length |
75
|
| ec nomenclature | |
| pdb deposition date | 2001-04-17 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Methyl-cpg-binding Protein 2; Chain A | Methyl-cpg-binding Protein 2; Chain A |
#chains in the Genus database with same CATH superfamily 3C2I A; 1IG4 A; 4LG7 A; 2MB7 A; 2KY8 A; 2MOE A; 1QK9 A; 3VYB A; 3VXV A; 3VYQ A; 5BT2 A; 1D9N A; 1UB1 A; 3VXX A; #chains in the Genus database with same CATH topology 3C2I A; 1IG4 A; 4LG7 A; 2MB7 A; 2KY8 A; 2MOE A; 1QK9 A; 3VYB A; 3VXV A; 3VYQ A; 5BT2 A; 1D9N A; 1UB1 A; 3VXX A; #chains in the Genus database with same CATH homology 3C2I A; 1IG4 A; 4LG7 A; 2MB7 A; 2KY8 A; 2MOE A; 1QK9 A; 3VYB A; 3VXV A; 3VYQ A; 5BT2 A; 1D9N A; 1UB1 A; 3VXX A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
