The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
51
|
sequence length |
142
|
structure length |
142
|
Chain Sequence |
NFNRFTQRAKKAIDLAFESAKSLGHNIVGSEHILLGLLREEEGIAAKVLSKVGFTEAYLEGKIVDMEGKGEEISEDIVLSPRSKQILELSGMFANKLKTNYIGTEHILLAIIQEGEGIANKILNYAGVNDRTLAQLTIDMMG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the ATP-dependent Clp Protease ClpC from Clostridium difficile
rcsb |
| molecule keywords |
ATP-dependent Clp endopeptidase
|
| molecule tags |
Atp binding protein
|
| source organism |
Clostridium difficile
|
| total genus |
51
|
| structure length |
142
|
| sequence length |
142
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2008-12-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02861 | Clp_N | Clp amino terminal domain, pathogenicity island component |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Double Clp-N motif | Clp, N-terminal domain |
#chains in the Genus database with same CATH superfamily 3ZRJ A; 1R6Q A; 1R6C X; 1MBX A; 2K77 A; 1R6O A; 4Y0B A; 3WDC A; 4P15 A; 3WDB A; 5GUI A; 1KHY A; 4HH5 A; 4IOD A; 1K6K A; 1MBV A; 4Y0C A; 3WDD A; 2Y1Q A; 5HBN A; 1LZW B; 1MBU A; 1MG9 B; 3WDE A; 1QVR A; 4IRF A; 3FES A; 4HH6 A; 3ZRI A; 1R6B X; 4UQW A; 1KSF X; 3FH2 A; 2Y1R A; 3PXG A; #chains in the Genus database with same CATH topology 3ZRJ A; 1R6Q A; 1R6C X; 1MBX A; 2K77 A; 1R6O A; 4Y0B A; 3WDC A; 4P15 A; 3WDB A; 5GUI A; 1KHY A; 4HH5 A; 4IOD A; 1K6K A; 1MBV A; 4Y0C A; 3WDD A; 2Y1Q A; 5HBN A; 1LZW B; 1MBU A; 1MG9 B; 3WDE A; 1QVR A; 4IRF A; 3FES A; 4HH6 A; 3ZRI A; 1R6B X; 4UQW A; 1KSF X; 3FH2 A; 2Y1R A; 3PXG A; #chains in the Genus database with same CATH homology 3ZRJ A; 1R6Q A; 1R6C X; 1MBX A; 2K77 A; 1R6O A; 4Y0B A; 3WDC A; 4P15 A; 3WDB A; 5GUI A; 1KHY A; 4HH5 A; 4IOD A; 1K6K A; 1MBV A; 4Y0C A; 3WDD A; 2Y1Q A; 5HBN A; 1LZW B; 1MBU A; 1MG9 B; 3WDE A; 1QVR A; 4IRF A; 3FES A; 4HH6 A; 3ZRI A; 1R6B X; 4UQW A; 1KSF X; 3FH2 A; 2Y1R A; 3PXG A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...