The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
182
|
structure length |
182
|
Chain Sequence |
APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the LasA virulence factor from Pseudomonas aeruginosa: substrate specificity and mechanism of M23 metallopeptidases.
pubmed doi rcsb |
| molecule keywords |
Protease lasA
|
| molecule tags |
Hydrolase
|
| total genus |
46
|
| structure length |
182
|
| sequence length |
182
|
| chains with identical sequence |
B, E, G
|
| ec nomenclature |
ec
3.4.24.-: |
| pdb deposition date | 2009-08-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01551 | Peptidase_M23 | Peptidase family M23 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Distorted Sandwich | Glucose Permease (Domain IIA) | Glucose Permease (Domain IIA) |
#chains in the Genus database with same CATH superfamily 4ZYB A; 2F3G A; 2B13 A; 3NYY A; 5B0H A; 1F3Z A; 3IT5 A; 4QP5 A; 3UZ0 B; 1O2F A; 4LXC A; 4QPB A; 2MP0 B; 1F3G A; 1GLE F; 2B44 A; 3IT7 A; 4RNY A; 3TUF B; 1GGR A; 2B0P A; 3CSQ A; 4JBW M; 1GLD F; 1GPR A; 4RNZ A; 2GPR A; 1GLA F; 1AX3 A; 3SLU A; 1GLB F; 1QWY A; 1GLC F; 2GU1 A; 2HSI A; 3OUR B; 5KVP A; 4BH5 A; #chains in the Genus database with same CATH topology 4ZYB A; 2F3G A; 2B13 A; 3NYY A; 5B0H A; 1F3Z A; 3IT5 A; 4QP5 A; 3UZ0 B; 1O2F A; 4LXC A; 4QPB A; 2MP0 B; 1F3G A; 1GLE F; 2B44 A; 3IT7 A; 4RNY A; 3TUF B; 1GGR A; 2B0P A; 3CSQ A; 4JBW M; 1GLD F; 1GPR A; 4RNZ A; 2GPR A; 1GLA F; 1AX3 A; 3SLU A; 1GLB F; 1QWY A; 1GLC F; 2GU1 A; 2HSI A; 3OUR B; 5KVP A; 4BH5 A; #chains in the Genus database with same CATH homology 4ZYB A; 2F3G A; 2B13 A; 3NYY A; 5B0H A; 1F3Z A; 3IT5 A; 4QP5 A; 3UZ0 B; 1O2F A; 4LXC A; 4QPB A; 2MP0 B; 1F3G A; 1GLE F; 2B44 A; 3IT7 A; 4RNY A; 3TUF B; 1GGR A; 2B0P A; 3CSQ A; 4JBW M; 1GLD F; 1GPR A; 4RNZ A; 2GPR A; 1GLA F; 1AX3 A; 3SLU A; 1GLB F; 1QWY A; 1GLC F; 2GU1 A; 2HSI A; 3OUR B; 5KVP A; 4BH5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...