2GU1A

Crystal structure of a zinc containing peptidase from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
325
structure length
324
Chain Sequence
RIHYMVKVGDTLSGIFAQLGVPYSILQKILSVDLDHLQLDMIQPGEELELMMDDMGQLSRLIYHMSIVEKAIYTRENDGSFSYDFQEISGEWREILFSGEINGSFSVSARRVGLTSSQVANITQVMKDKIDFSRSLRADRFDILVKQQYLGEHNTGNSEIKAISFKLAKGDVSAFLAEDGRFYDRAGNSLERAFNRYPVDKAYRQITSGFNPKRKHPVTGRVVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKILVKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKADLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Zinc peptidase
publication title Crystal structure of a putative lysostaphin peptidase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 79
structure length 324
sequence length 325
ec nomenclature ec 3.4.-.-:
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF04225 OapA Opacity-associated protein A LysM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 2gu1A03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu1A02
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu1A01
4RNZA 1GLBF 3IT5A 4ZYBA 2HSIA 2GPRA 2B0PA 2F3GA 3OURB 3UZ0B 4JBWM 2B44A 3NYYA 3TUFB 1F3ZA 1GLAF 1GLDF 4QPBA 1GLEF 3CSQA 2B13A 1GGRA 3IT7A 3SLUA 1QWYA 4LXCA 2GU1A 4QP5A 1GLCF 5KVPA 4BH5A 1GPRA 4RNYA 1O2FA 1AX3A 2MP0B 5B0HA 1F3GA
chains in the Genus database with same CATH superfamily
3GAXA 1QALA 2R4IA 2BU4A 1RGFA 5D82A 3WMDA 1TTOA 2UGIA 2HSIA 3WR2A 3BNEA 1B2ZA 6STDA 5AEUB 2KF5A 1RN1A 3SXXA 3AMOB 3RGAA 3IJEB 1BUQA 2C4BA 4RNTA 1FYSA 2MC8A 3EB8A 4FR9A 3D5GA 4FCJA 3G4S3 3DM8A 1K8A4 5EEOA 3MHEA 4EW5A 4N6V0 1PY3A 1CEWI 2Z77A 2Z76A 3B7CA 4WFOA 2F56A 2F98A 1ZX2A 4L7KA 3NBJA 1DETA 1I0VA 3KCHA 5LC6A 4HM0B 4BTWA 1T3BA 1AV4A 3MG3A 1CYVA 5LC7A 5M19A 2ML5A 3UNLA 3LZAA 5FGOA 3JVCA 4FMDA 3H3HA 3FF0A 3K7CA 1GD4A 2IYJA 1OGXA 3OW22 1UGHI 2IMJA 4R9LA 1YIT3 3DZLA 5IENA 1UW1A 3DUKA 1B21A 2ZL8A 1VQ63 4PEJA 2R41A 1VZZA 3X41A 2LYXA 1BRKA 1E3RA 1FUSA 3S5CA 1MWSA 1KWIA 4HKVB 1RTUA 1WTHA 4LZIA 4EBGA 2BMOB 3NBBA 3SOYA 3F14A 1DVDA 1RNTA 1GY5A 2I9WA 3I563 1ROVA 3NX0A 1IVVA 5BVBA 2P0MA 3HIIA 3X40A 1C54A 4RNZA 1LQGC 1O7NB 1T2IA 2IY2A 3LTBA 1Q40B 3PCRA 2SARA 4WYKA 2FNQA 3UL5A 2K3DA 4XBYA 1BNJA 3FH1A 5M1AA 1YGEA 4O02B 1IQ8A 3X3YA 3FKAA 1YJ93 1TRQA 1BRSA 1RSNA 3F40A 1NB5I 1FZUA 4CCVA 2LQVA 2P05A 3PCSA 1OPYA 1DMQA 1D6ZA 1UDII 1I2FA 1QAKA 1JN5A 2GEYA 1RGCA 1N8QA 2M7OA 1JRQA 1Z1SA 4HJLB 1JZDA 8RNTA 1CH0A 3FCSB 1WQLB 2QA43 2E2UA 5G2GA 1YJN3 1RNBA 2XGLA 4U13A 4I4KA 5AIHA 2PNCA 1AVLA 2CIUA 3UJMA 1O2FA 2GXFA 4KFFA 5IG0A 1RGLA 4X2OA 3BNBA 3S29A 3CCL3 5KP1A 4GSPA 4ZYBA 1DMMA 1QJGA 3AGOA 1EG9B 1RCKA 2B0PA 2KF6A 2KXGA 1ZS7A 3DY5A 1AY7A 2BNGA 3GZYB 4K1VA 3CD63 1Q864 3NUVA 5IW9A 1Q7HA 5EQLA 3SEDA 3MG1A 1LVNA 1FGOA 2BMQB 3DMCA 3LT8A 4O2HA 2GBXB 3EF8A 3KZTA 4QPBA 1GMRA 3QRDA 1KD14 4DKIA 5IEPA 5CLKA 3MPHA 4HM5B 1JBSA 1QVG2 3NV0B 2OWPA 4KFDA 1UCLA 4ZM8A 4CPKA 1RN4A 2CW9A 5D81A 3ZG5A 3CCS3 1IVUA 1W2B2 2HMMB 4N6MA 3WHOA 1PYLA 6GSPA 5IG5A 3D3LA 4HVNA 1N9JA 3ECFA 3GRDA 1OH0A 3LTDA 3FZWA 2IA7A 4CJNA 4OUQA 3SYUA 2CKFB 2OOVC 1YVBI 3FG4A 1PU4A 1ZO2A 2C11A 1MWTA 1B2XA 2GSPA 1VQ83 1G0TA 1BRIA 3EX9A 1C7HA 2ZHXB 1RKYA 1M904 3JUOA 1N5PA 1IT8A 3DH2A 1T2HA 3F9SA 3CCJ3 1ZGXA 1GOYA 1FA3A 1OHSA 3F8XA 5AEWB 2QEX3 3CCM3 5IEOA 4LYLB 4BU4A 1EQKA 1WNHA 1US1A 2KCDA 5AYSC 1LXEA 3QK9A 1TUHA 1W5ZA 1W01A 3NM7A 3EBTA 2XR8B 1JB2A 1EEJA 3D5IA 3LTAA 1N9EA 5IERA 3CNMA 1LQMB 1M1XB 1GD3A 3V98A 3NXJA 4N6OB 4XM4A 3J7Yd 3HI7A 4KZ1A 1BOXA 3NQZA 1X1UA 1JKGA 1GOUA 2B24B 1VQ93 2O3OA 2OTL3 4FCZA 4XDVA 3WODG 1W6CA 4O3VA 3B8LA 4J9AA 3WOEB 2CG0A 1D6UA 1RCLA 4MMYB 1YJW3 5JBSA 5G1LA 1SIHA 3CXC2 1HYFA 5IG3A 1STFI 1BNSA 1GGRA 1TRPA 1GMPA 2D42A 3SLUA 1SPUA 3EE1A 1BAOA 2CWTA 3CCQ3 1W6YA 3FG3A 4EXRA 1T5YA 2BMRB 5CF2A 2CFKA 2F86B 4OVMA 1VQM3 4OK0A 3ALAA 4N6LA 1OF5B 5BIRA 7RNTA 1I8VA 5D83A 1SJWA 3ER7A 2E2VA 5AIFA 1NO3A 4BL2A 4LMIA 1O7PB 2Y73A 3CU3A 5AYRB 1AQZA 4HZ9B 3MWZA 1WMPA 1ULJB 1WMNA 1VQO3 3G8ZA 1VQQA 3CPOA 3UB1A 1M1K4 4HYZA 3O8YA 1NWWA 2L4VA 4GB5A 1MGWA 1W2ZA 2W03A 1QMAA 1UGIA 3KSED 4J8TA 3T8UA 1JN5B 1R4CA 3S28A 4QP5A 1GLCF 2FGTA 2INXA 1IK3A 3V92A 1Q824 1YI23 1VQ53 5BXQA 4JRFA 1FUTA 1JBRA 2CHCA 1V74A 2XRXB 1Q814 3IMAB 1Q42A 3CMA3 1VQN3 1NU3A 2MF7A 3DXOA 5AIIA 8CHOA 1ULIB 1AR0A 4IT7A 2CH9A 3DGMA 1UUVB 3I553 5IG4A 1B20A 1A90A 1J2BA 1IVWA 3LXUX 5AI1A 3WOFB 3N8BA 2J8XB 2WO0A 3DGNA 3JUMA 3NM2A 1BSAA 1LNHA 3WDGB 3GZBA 1IYYA 3HK4A 3LOYA 4HM7B 5GSPA 1TFKA 1U8CB 2QGUA 2RNTA 4EC6A 3Q1CA 1QWYA 5RNTA 1QVF2 3EC9A 3FSDA 3NQYA 2HMLB 3VGNA 4BIRA 4HAAA 5CF1A 4L8OA 1K41A 2UUGC 4K90B 5KVPA 1BANA 3OWYA 2F5WA 4R9KA 4FMCA 1KC84 1E3VA 2V1LA 3LT9A 1N5HA 5M18A 1TIJA 1JB5A 1K28A 1RRLA 3DGOA 3OV4A 4N6NB 4Q53A 3T8NA 9RNTA 4K1UA 4H61A 2P38A 1BRNL 1I70A 3EN8A 2K0MA 2ZDJA 3KN4A 1L5GB 4AKZA 4GL6A 1GLAF 1IV9A 2HMKB 1NDOB 1E97A 1X1WA 1GLDF 1TJDA 2AADA 2RFRA 2UX0A 5DREA 4HM1B 3G0KA 3BB9A 4O8SA 1BU4A 4HOHA 4AEQA 2KRTA 3U1WA 1IDPA 3PGBA 3K5TA 1Q7Y4 4RBNA 5BU4A 1Q40A 2BHMA 2P0XA 1GPRA 3JUPA 2RGQA 2HMNB 3CPW2 1KSIA 1Q9EA 2E2TA 3K63A 1RGHA 4FMAA 1LOVA 2YFIB 3SOAA 1VQP3 3IT5A 1UCJA 1FW7A 2OCTA 1SIIA 1GSPA 1NNVA 1WMOA 2W6JH 1HKXA 1S723 1B2MA 2IUJA 1BVIA 1ROAA 3TUFB 4HM6B 2CWVA 1OUNA 2IUKA 1YNVX 2WGQA 2H0GA 3ZFZA 3LMLA 3N9HA 1JKGB 1W7CA 3Q2PA 3MSOA 3CC73 3CCE3 1K9M4 1KQS2 3I0YA 2Y74A 1ISKA 2BIRA 1MGRA 1MWUA 1RHLA 1RGAA 5TGNA 2CX0A 1RGKA 1NJI4 3DGLA 1O7GB 4IPBA 4N6UA 3X3ZA 2GU1A 4BL3A 2RBIA 3AGNA 1FGQA 3F7XA 7GSPA 3JUNA 1FGTA 1JZOA 2Q07A 1UCKA 1RN7A 2RSXA 2PZVA 2FXTA 1GS3A 1NB3I 5B0HA 1PFPA 3FLJA 5AIGA 3OXAA 3RDEA 2CK3H 1O7MB 1UI7A 1A2VA 3K0ZA 2GBWB 4HM8B 2WOFA 3K9MC 1BNRA 3KIIA 4R80A 1DE3A 3MG2A 4KVHA 1W6GA 3SVAA 3CME3 3NV0A 2OQEA 1FGRA 3E99A 2CX1A 3NBRA 3U97A 3BNCA 3FGYA 1EA2A 3AHWA 3D79A 2B13A 1RDSA 1X1YA 1HZ1A 2W56A 5ELUA 1UUWB 2C10A 4LGQA 2XGNA 1BSCA 1I2GA 1D6YA 1W02A 3AHSA 5FW5A 2YFJB 4EV2A 1YHQ3 3CC43 3V99A 1EKMA 1IU7A 1LOXA 3KSPA 4XDWA 3D9RA 2B1XB 1S5AA 5EVHA 2MP0B 3HX8A 1VQK3 1GY6A 4NHFA 2XH9A 1I3FA 3LYGA 1BNIA 3JUQA 4KFEA 3UZ0B 1FGMA 2WGOA 1B3SA 1OHOA 3NYYA 2BT3A 2F99A 4HM2B 3RGRA 4WYKB 1RGEA 2OQEC 3GSPA 5ELJA 2W9PA 3Q3FA 3CC23 1JNQA 2A15A 3EJVA 1MOLA 2BO9B 3HOHA 4J5KA 5KP3A 2CFLA 4EV5A 1ASKA 4R1KA 5A0OB 3LH4A 3GZXB 1MNLA 3EN1B 4NREA 1TFOA 2P09A 3D4AA 1CQSA 3KKGA 4RNYA 2GU3A 2XF3A 3KFQC 4MEIA 1UUGB 1OACA 4H3UA 4HZBB 1BRJA 1CYUA 4K61A 1K734 3A5EA 1F8NA 3AMOA 3F7SA 3FF2A 3FG1A 3KE7A 2AAEA 2H0IA 4I5QA 4AKYA 1BNGA 4NPBA 1YIJ3 2K54A 3OWUA 2Z7AA 4WWUC 1RMSA 5JPPA 3G713 3PXMA 1F3ZA 3S27A 3CCU3 2HMJB 3PYJA 1R4YA 4MMXB 3DGYA 1V57A 4HM3B 1GMQA 3VSYA 5HOHA 1W4NA 1DVCA 1GLEF 2XFTA 5I97A 3G6E3 1BSDA 2OTJ3 1OGZA 3T0UA 2CFGA 1B2SA 2W0QA 3OWSA 1OF5A 1V58A 4EYCA 3A76A 1OCVA 4FMBA 2W9QA 1B2UA 1TU5A 2RCDA 1TP6A 1BNFA 1BNEA 2ML6A 3CNXA 3EBYA 4G1MB 4X2HA 4XBXA 1AVKA 2F5MA 3SX1A 4BTYA 1I3IA 1FUWA 1YGWA 2STDA 4BTXA 1BSBA 1LOYA 3M8CA 4N3VA 1JV2B 1YVSA 3S67A 6RNTA 4R4KA 1OHPA 4L8PA 1RLSA 4J5GA 4LEHA 5JPUA 1RRHA 2JQ5A 3GWRA 2KF3A 1UI8A 1BRHA 4HBRA 1DMNA 2SBLA 1SARA 3BLZA 4CDLA 3CSQA 1BIRA 2W2CA 3TDGA 3BNDA 1A2PA 5IF6A 5CXOA 1IT7A 2CWUA 4KT3B 1Y4KA 2GEXA 5STDA 3ROBA 1BRGA 3VF1A 1W00A 4WHAA 1EUIC 1RJOA 1STDA 4XB5A 4BH5A 1LOWA 4N6TA 1VQL3 1AX3A 1IVXA 4QWTA 1BGSA 1SQWA 2XFSA 3URPA 3H51A 2L1SA 1A2KA 2OOVA 1BUJA 2H0HA 3CCR3 3HZPA 3WA2X 2GPRA 3F8HA 1GOVA 3OURB 3BU4A 4JBWM 3ZG0A 2B44A 1G96A 4JF8A 3EQQB 2F4YA 2YFLB 1GYBA 4ILFA 4RZMA 4WP5A 1IV7A 4STDA 1B27A 2XSOB 3B4OA 4FCMA 5DRVA 3IT7A 2CFDA 2KAAA 3PZWA 4IIAA 1DYUA 4LXCA 3STDA 1I2EA 3G16A 3HIGA 3L0RA 3WA3A 4HM4B 3X42A 7STDA 5HGRA 2W56B 4MJDA 1JJ22 1N8R4 2Z6BA 1X1XA 2CFWA 2O9UX 1UCIA 2CC3A 1I0XA 3CCV3 3NHXA 3PS8A 2XEPA 2JDIH 4LSOA 1GLBF 1JB4A 3UL6A 1O7WB 1QAFA 4TX4A 1JBTA 2F3GA 1LRAA 1HU9A 2KF4A 1M9GA 2W04A 1VQ73 2CG1A 3RNTA 2XSHB 1A67A 2HOHA 3B4PA 4GHOA 2ZA4A 3X3XA 1RGGA 1IQYA 2D1WA 3Q90A 2HMOB 1U5OA 4MMZB 1G02A 3BIRA 1LNIA 1GY7A 4ORLA 1O7HB 3EHCA 3GZRA 2YX9A 3OX9A 3IPTA 4XBTA 1MWRA 5KP4A 3LTCA 1VQ43 3MKIA 5G1KA 1BSEA 3MYTA 5CK6A 1IQXA 2QIYA 1F3GA 2WOHA 3N54B
chains in the Genus database with same CATH topology
3GAXA 1QALA 2R4IA 5D82A 3WMDA 2HSIA 3BNEA 6STDA 5AEUB 3SXXA 3AMOB 3RGAA 3IJEB 1BUQA 2MC8A 3EB8A 4FR9A 4FCJA 3G4S3 3DM8A 1K8A4 5EEOA 3MHEA 4N6V0 1CEWI 2Z77A 2Z76A 3B7CA 4WFOA 2F98A 1ZX2A 4L7KA 3NBJA 5LC6A 4BTWA 4HM0B 1AV4A 3MG3A 1CYVA 5LC7A 2ML5A 3UNLA 3LZAA 5FGOA 3JVCA 4FMDA 3H3HA 3FF0A 3K7CA 1GD4A 1OGXA 3OW22 2IMJA 4R9LA 1YIT3 3DZLA 5IENA 1UW1A 3DUKA 2ZL8A 1VQ63 4PEJA 1VZZA 3X41A 2LYXA 1E3RA 3S5CA 1KWIA 4HKVB 1WTHA 4LZIA 4EBGA 2BMOB 3NBBA 3SOYA 3F14A 1DVDA 1GY5A 2I9WA 3I563 1ROVA 3NX0A 1IVVA 5BVBA 2P0MA 3HIIA 3X40A 4RNZA 1O7NB 4WYKA 3LTBA 1Q40B 3PCRA 3UL5A 2FNQA 4XBYA 3FH1A 1YGEA 4O02B 1IQ8A 3X3YA 3FKAA 1YJ93 3F40A 1NB5I 4CCVA 2LQVA 2P05A 3PCSA 1OPYA 1DMQA 1D6ZA 1QAKA 1JN5A 2GEYA 2M7OA 1N8QA 4HJLB 1JRQA 1Z1SA 3FCSB 1WQLB 2QA43 2E2UA 5G2GA 1YJN3 2XGLA 4U13A 4I4KA 5AIHA 2PNCA 1AVLA 2CIUA 3UJMA 1O2FA 2GXFA 4KFFA 5IG0A 4X2OA 3BNBA 3S29A 3CCL3 5KP1A 4ZYBA 1DMMA 1QJGA 1EG9B 2B0PA 2KXGA 3DY5A 4K1VA 3GZYB 2BNGA 3CD63 1Q864 3NUVA 5IW9A 5EQLA 3SEDA 3MG1A 1LVNA 1FGOA 2BMQB 3DMCA 3LT8A 4O2HA 2GBXB 3EF8A 3KZTA 4QPBA 3QRDA 1KD14 5IEPA 5CLKA 3MPHA 4HM5B 1QVG2 3NV0B 2OWPA 4KFDA 4ZM8A 2CW9A 5D81A 3CCS3 1IVUA 1W2B2 2HMMB 4N6MA 5IG5A 3D3LA 4HVNA 1N9JA 3ECFA 3GRDA 1OH0A 3LTDA 3FZWA 2IA7A 4OUQA 2CKFB 2OOVC 1YVBI 3FG4A 1PU4A 1ZO2A 2C11A 1VQ83 3EX9A 1C7HA 1RKYA 1M904 3JUOA 1N5PA 1IT8A 3F9SA 3CCJ3 1FA3A 1OHSA 3F8XA 5AEWB 2QEX3 3CCM3 5IEOA 1EQKA 1WNHA 1US1A 2KCDA 5AYSC 1LXEA 3QK9A 1TUHA 1W5ZA 1W01A 3NM7A 3EBTA 2XR8B 1JB2A 3LTAA 1N9EA 5IERA 3CNMA 1M1XB 1GD3A 3V98A 3NXJA 4N6OB 4XM4A 3J7Yd 3HI7A 4KZ1A 2OTL3 3NQZA 1JKGA 2B24B 1VQ93 2O3OA 4FCZA 4XDVA 3WODG 1W6CA 4O3VA 3B8LA 4J9AA 2CG0A 1D6UA 1YJW3 4MMYB 5JBSA 1SIHA 3CXC2 5IG3A 1STFI 1GGRA 2D42A 3SLUA 1SPUA 3EE1A 2CWTA 3CCQ3 1W6YA 3FG3A 4EXRA 1T5YA 2BMRB 5CF2A 2CFKA 2F86B 4OVMA 1VQM3 4OK0A 3ALAA 4N6LA 1OF5B 5D83A 1SJWA 3ER7A 2E2VA 5AIFA 1NO3A 4LMIA 1O7PB 2Y73A 3CU3A 5AYRB 4HZ9B 3MWZA 1WMPA 1ULJB 1WMNA 1VQO3 3G8ZA 1M1K4 3CPOA 3UB1A 4HYZA 3O8YA 1NWWA 2L4VA 4GB5A 1W2ZA 2W03A 1QMAA 3KSED 4J8TA 3T8UA 1JN5B 1R4CA 3S28A 4QP5A 1GLCF 2FGTA 2INXA 1IK3A 3V92A 1Q824 1YI23 1VQ53 5BXQA 4JRFA 2CHCA 1V74A 2XRXB 1Q814 3IMAB 1Q42A 3CMA3 1VQN3 1NU3A 2MF7A 3DXOA 5AIIA 8CHOA 1ULIB 1AR0A 4IT7A 2CH9A 3DGMA 1UUVB 3I553 5IG4A 1A90A 1J2BA 1IVWA 3LXUX 5AI1A 3WOFB 3N8BA 3DGNA 2WO0A 3JUMA 3NM2A 1LNHA 3WDGB 3GZBA 3HK4A 3LOYA 4HM7B 1TFKA 1U8CB 2QGUA 4EC6A 3Q1CA 1QWYA 1QVF2 3EC9A 3FSDA 3NQYA 2HMLB 3VGNA 5CF1A 4L8OA 1K41A 4K90B 5KVPA 3OWYA 4R9KA 4FMCA 1KC84 1E3VA 2V1LA 3LT9A 1N5HA 1TIJA 1JB5A 1K28A 1RRLA 3DGOA 3OV4A 4N6NB 4Q53A 3T8NA 4K1UA 4H61A 2P38A 3EN8A 2K0MA 2ZDJA 3KN4A 1L5GB 4AKZA 4GL6A 1GLAF 1IV9A 2HMKB 1NDOB 1E97A 2RFRA 1GLDF 2UX0A 3OWSA 5CXOA 5DREA 3WOEB 4HM1B 3G0KA 3BB9A 4O8SA 4AEQA 2KRTA 3U1WA 1IDPA 3PGBA 3K5TA 1Q7Y4 4RBNA 1Q40A 2BHMA 2P0XA 1GPRA 3JUPA 2RGQA 2HMNB 3CPW2 1KSIA 2E2TA 3K63A 4FMAA 2YFIB 3SOAA 1VQP3 3IT5A 2OCTA 1SIIA 2W6JH 1WMOA 1S723 1HKXA 2IUJA 1ROAA 3TUFB 4HM6B 2CWVA 1OUNA 2IUKA 2WGQA 1FUWA 3CC73 3LMLA 3N9HA 1JKGB 1W7CA 3Q2PA 3MSOA 3CCE3 1K9M4 1KQS2 3I0YA 2Y74A 1ISKA 5TGNA 1NJI4 3DGLA 1O7GB 4IPBA 4N6UA 3X3ZA 2GU1A 1FGQA 3F7XA 3JUNA 1FGTA 2Q07A 1RN7A 2RSXA 2PZVA 2FXTA 1GS3A 1NB3I 5B0HA 1PFPA 3FLJA 5AIGA 3OXAA 3RDEA 2CK3H 1O7MB 1UI7A 1A2VA 3K0ZA 2GBWB 4HM8B 2WOFA 3K9MC 3KIIA 4R80A 3MG2A 4KVHA 1W6GA 3SVAA 3CME3 3NV0A 2OQEA 1FGRA 3E99A 3NBRA 3U97A 3BNCA 3FGYA 1EA2A 2B13A 5ELUA 2W56A 1UUWB 2C10A 4LGQA 2XGNA 1W02A 5FW5A 1D6YA 4EV2A 1YHQ3 3CC43 2YFJB 3V99A 1EKMA 1IU7A 1LOXA 3KSPA 4XDWA 3D9RA 2B1XB 1S5AA 5EVHA 2MP0B 3HX8A 1VQK3 1GY6A 4NHFA 2XH9A 3LYGA 3JUQA 4KFEA 3UZ0B 1FGMA 2WGOA 1OHOA 3NYYA 2BT3A 2F99A 4HM2B 3RGRA 4WYKB 2OQEC 5ELJA 2W9PA 3CC23 1JNQA 2A15A 3EJVA 1MOLA 2BO9B 5KP3A 2CFLA 4EV5A 1ASKA 4R1KA 5A0OB 3LH4A 3GZXB 1MNLA 3EN1B 4NREA 1TFOA 2P09A 1CQSA 3KKGA 4RNYA 2GU3A 2XF3A 3KFQC 4MEIA 1OACA 4H3UA 4HZBB 1CYUA 4K61A 1K734 1F8NA 3AMOA 3F7SA 3FF2A 3FG1A 3KE7A 4AKYA 1YIJ3 2K54A 3OWUA 2Z7AA 4WWUC 5JPPA 3G713 3PXMA 1F3ZA 3S27A 3CCU3 2HMJB 3PYJA 4MMXB 4HM3B 3VSYA 3G6E3 1W4NA 1DVCA 1GLEF 2XFTA 5I97A 2OTJ3 1OGZA 3T0UA 2CFGA 2W0QA 1OF5A 4EYCA 3A76A 1OCVA 4FMBA 2W9QA 1TU5A 2RCDA 1TP6A 4G1MB 2ML6A 3CNXA 3EBYA 4XBXA 4X2HA 3SX1A 1AVKA 4BTYA 2STDA 4BTXA 3M8CA 4N3VA 1JV2B 3S67A 4R4KA 1OHPA 4L8PA 4LEHA 5JPUA 1RRHA 2JQ5A 3GWRA 1UI8A 4HBRA 4CDLA 1DMNA 2SBLA 3BLZA 3CSQA 2W2CA 3TDGA 3BNDA 5IF6A 1IT7A 2CWUA 1Y4KA 2GEXA 5STDA 3ROBA 3VF1A 1W00A 4WHAA 1RJOA 1STDA 4XB5A 4BH5A 4N6TA 1VQL3 1AX3A 1IVXA 4QWTA 1SQWA 2XFSA 3H51A 1A2KA 2OOVA 3CCR3 3HZPA 3WA2X 2GPRA 3F8HA 3OURB 4JBWM 2B44A 1G96A 4JF8A 3EQQB 2YFLB 1GYBA 4RZMA 4WP5A 1IV7A 4STDA 2XSOB 3B4OA 4FCMA 5DRVA 3IT7A 2CFDA 3PZWA 4IIAA 1DYUA 4LXCA 3STDA 3G16A 3HIGA 3L0RA 3WA3A 4HM4B 3X42A 7STDA 5HGRA 2W56B 4MJDA 1JJ22 1N8R4 2Z6BA 2CFWA 2O9UX 2CC3A 3CCV3 3NHXA 3PS8A 2XEPA 2JDIH 4LSOA 1GLBF 1JB4A 3UL6A 1O7WB 1QAFA 4TX4A 2F3GA 1HU9A 1VQ73 1M9GA 2W04A 2CG1A 2XSHB 1A67A 3B4PA 3X3XA 1IQYA 2D1WA 3Q90A 2HMOB 1U5OA 4MMZB 4ORLA 1GY7A 1O7HB 3EHCA 3GZRA 2YX9A 3OX9A 3IPTA 4XBTA 1VQ43 5KP4A 3LTCA 3MKIA 3MYTA 5CK6A 1IQXA 2QIYA 1F3GA 2WOHA 3N54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNZ A;  1GLB F;  3IT5 A;  4ZYB A;  2HSI A;  2GPR A;  2B0P A;  2F3G A;  3OUR B;  3UZ0 B;  4JBW M;  2B44 A;  3NYY A;  3TUF B;  1F3Z A;  1GLA F;  1GLD F;  4QPB A;  1GLE F;  3CSQ A;  2B13 A;  1GGR A;  3IT7 A;  3SLU A;  1QWY A;  4LXC A;  2GU1 A;  4QP5 A;  1GLC F;  5KVP A;  4BH5 A;  1GPR A;  4RNY A;  1O2F A;  1AX3 A;  2MP0 B;  5B0H A;  1F3G A; 
#chains in the Genus database with same CATH topology
 3GAX A;  1QAL A;  2R4I A;  2BU4 A;  1RGF A;  5D82 A;  3WMD A;  1TTO A;  2UGI A;  2HSI A;  3WR2 A;  3BNE A;  1B2Z A;  6STD A;  5AEU B;  2KF5 A;  1RN1 A;  3SXX A;  3AMO B;  3RGA A;  3IJE B;  1BUQ A;  2C4B A;  4RNT A;  1FYS A;  2MC8 A;  3EB8 A;  4FR9 A;  3D5G A;  4FCJ A;  3G4S 3;  3DM8 A;  1K8A 4;  5EEO A;  3MHE A;  4EW5 A;  4N6V 0;  1PY3 A;  1CEW I;  2Z77 A;  2Z76 A;  3B7C A;  4WFO A;  2F56 A;  2F98 A;  1ZX2 A;  4L7K A;  3NBJ A;  1DET A;  1I0V A;  3KCH A;  5LC6 A;  4HM0 B;  4BTW A;  1T3B A;  1AV4 A;  3MG3 A;  1CYV A;  5LC7 A;  5M19 A;  2ML5 A;  3UNL A;  3LZA A;  5FGO A;  3JVC A;  4FMD A;  3H3H A;  3FF0 A;  3K7C A;  1GD4 A;  2IYJ A;  1OGX A;  3OW2 2;  1UGH I;  2IMJ A;  4R9L A;  1YIT 3;  3DZL A;  5IEN A;  1UW1 A;  3DUK A;  1B21 A;  2ZL8 A;  1VQ6 3;  4PEJ A;  2R41 A;  1VZZ A;  3X41 A;  2LYX A;  1BRK A;  1E3R A;  1FUS A;  3S5C A;  1MWS A;  1KWI A;  4HKV B;  1RTU A;  1WTH A;  4LZI A;  4EBG A;  2BMO B;  3NBB A;  3SOY A;  3F14 A;  1DVD A;  1RNT A;  1GY5 A;  2I9W A;  3I56 3;  1ROV A;  3NX0 A;  1IVV A;  5BVB A;  2P0M A;  3HII A;  3X40 A;  1C54 A;  4RNZ A;  1LQG C;  1O7N B;  1T2I A;  2IY2 A;  3LTB A;  1Q40 B;  3PCR A;  2SAR A;  4WYK A;  2FNQ A;  3UL5 A;  2K3D A;  4XBY A;  1BNJ A;  3FH1 A;  5M1A A;  1YGE A;  4O02 B;  1IQ8 A;  3X3Y A;  3FKA A;  1YJ9 3;  1TRQ A;  1BRS A;  1RSN A;  3F40 A;  1NB5 I;  1FZU A;  4CCV A;  2LQV A;  2P05 A;  3PCS A;  1OPY A;  1DMQ A;  1D6Z A;  1UDI I;  1I2F A;  1QAK A;  1JN5 A;  2GEY A;  1RGC A;  1N8Q A;  2M7O A;  1JRQ A;  1Z1S A;  4HJL B;  1JZD A;  8RNT A;  1CH0 A;  3FCS B;  1WQL B;  2QA4 3;  2E2U A;  5G2G A;  1YJN 3;  1RNB A;  2XGL A;  4U13 A;  4I4K A;  5AIH A;  2PNC A;  1AVL A;  2CIU A;  3UJM A;  1O2F A;  2GXF A;  4KFF A;  5IG0 A;  1RGL A;  4X2O A;  3BNB A;  3S29 A;  3CCL 3;  5KP1 A;  4GSP A;  4ZYB A;  1DMM A;  1QJG A;  3AGO A;  1EG9 B;  1RCK A;  2B0P A;  2KF6 A;  2KXG A;  1ZS7 A;  3DY5 A;  1AY7 A;  2BNG A;  3GZY B;  4K1V A;  3CD6 3;  1Q86 4;  3NUV A;  5IW9 A;  1Q7H A;  5EQL A;  3SED A;  3MG1 A;  1LVN A;  1FGO A;  2BMQ B;  3DMC A;  3LT8 A;  4O2H A;  2GBX B;  3EF8 A;  3KZT A;  4QPB A;  1GMR A;  3QRD A;  1KD1 4;  4DKI A;  5IEP A;  5CLK A;  3MPH A;  4HM5 B;  1JBS A;  1QVG 2;  3NV0 B;  2OWP A;  4KFD A;  1UCL A;  4ZM8 A;  4CPK A;  1RN4 A;  2CW9 A;  5D81 A;  3ZG5 A;  3CCS 3;  1IVU A;  1W2B 2;  2HMM B;  4N6M A;  3WHO A;  1PYL A;  6GSP A;  5IG5 A;  3D3L A;  4HVN A;  1N9J A;  3ECF A;  3GRD A;  1OH0 A;  3LTD A;  3FZW A;  2IA7 A;  4CJN A;  4OUQ A;  3SYU A;  2CKF B;  2OOV C;  1YVB I;  3FG4 A;  1PU4 A;  1ZO2 A;  2C11 A;  1MWT A;  1B2X A;  2GSP A;  1VQ8 3;  1G0T A;  1BRI A;  3EX9 A;  1C7H A;  2ZHX B;  1RKY A;  1M90 4;  3JUO A;  1N5P A;  1IT8 A;  3DH2 A;  1T2H A;  3F9S A;  3CCJ 3;  1ZGX A;  1GOY A;  1FA3 A;  1OHS A;  3F8X A;  5AEW B;  2QEX 3;  3CCM 3;  5IEO A;  4LYL B;  4BU4 A;  1EQK A;  1WNH A;  1US1 A;  2KCD A;  5AYS C;  1LXE A;  3QK9 A;  1TUH A;  1W5Z A;  1W01 A;  3NM7 A;  3EBT A;  2XR8 B;  1JB2 A;  1EEJ A;  3D5I A;  3LTA A;  1N9E A;  5IER A;  3CNM A;  1LQM B;  1M1X B;  1GD3 A;  3V98 A;  3NXJ A;  4N6O B;  4XM4 A;  3J7Y d;  3HI7 A;  4KZ1 A;  1BOX A;  3NQZ A;  1X1U A;  1JKG A;  1GOU A;  2B24 B;  1VQ9 3;  2O3O A;  2OTL 3;  4FCZ A;  4XDV A;  3WOD G;  1W6C A;  4O3V A;  3B8L A;  4J9A A;  3WOE B;  2CG0 A;  1D6U A;  1RCL A;  4MMY B;  1YJW 3;  5JBS A;  5G1L A;  1SIH A;  3CXC 2;  1HYF A;  5IG3 A;  1STF I;  1BNS A;  1GGR A;  1TRP A;  1GMP A;  2D42 A;  3SLU A;  1SPU A;  3EE1 A;  1BAO A;  2CWT A;  3CCQ 3;  1W6Y A;  3FG3 A;  4EXR A;  1T5Y A;  2BMR B;  5CF2 A;  2CFK A;  2F86 B;  4OVM A;  1VQM 3;  4OK0 A;  3ALA A;  4N6L A;  1OF5 B;  5BIR A;  7RNT A;  1I8V A;  5D83 A;  1SJW A;  3ER7 A;  2E2V A;  5AIF A;  1NO3 A;  4BL2 A;  4LMI A;  1O7P B;  2Y73 A;  3CU3 A;  5AYR B;  1AQZ A;  4HZ9 B;  3MWZ A;  1WMP A;  1ULJ B;  1WMN A;  1VQO 3;  3G8Z A;  1VQQ A;  3CPO A;  3UB1 A;  1M1K 4;  4HYZ A;  3O8Y A;  1NWW A;  2L4V A;  4GB5 A;  1MGW A;  1W2Z A;  2W03 A;  1QMA A;  1UGI A;  3KSE D;  4J8T A;  3T8U A;  1JN5 B;  1R4C A;  3S28 A;  4QP5 A;  1GLC F;  2FGT A;  2INX A;  1IK3 A;  3V92 A;  1Q82 4;  1YI2 3;  1VQ5 3;  5BXQ A;  4JRF A;  1FUT A;  1JBR A;  2CHC A;  1V74 A;  2XRX B;  1Q81 4;  3IMA B;  1Q42 A;  3CMA 3;  1VQN 3;  1NU3 A;  2MF7 A;  3DXO A;  5AII A;  8CHO A;  1ULI B;  1AR0 A;  4IT7 A;  2CH9 A;  3DGM A;  1UUV B;  3I55 3;  5IG4 A;  1B20 A;  1A90 A;  1J2B A;  1IVW A;  3LXU X;  5AI1 A;  3WOF B;  3N8B A;  2J8X B;  2WO0 A;  3DGN A;  3JUM A;  3NM2 A;  1BSA A;  1LNH A;  3WDG B;  3GZB A;  1IYY A;  3HK4 A;  3LOY A;  4HM7 B;  5GSP A;  1TFK A;  1U8C B;  2QGU A;  2RNT A;  4EC6 A;  3Q1C A;  1QWY A;  5RNT A;  1QVF 2;  3EC9 A;  3FSD A;  3NQY A;  2HML B;  3VGN A;  4BIR A;  4HAA A;  5CF1 A;  4L8O A;  1K41 A;  2UUG C;  4K90 B;  5KVP A;  1BAN A;  3OWY A;  2F5W A;  4R9K A;  4FMC A;  1KC8 4;  1E3V A;  2V1L A;  3LT9 A;  1N5H A;  5M18 A;  1TIJ A;  1JB5 A;  1K28 A;  1RRL A;  3DGO A;  3OV4 A;  4N6N B;  4Q53 A;  3T8N A;  9RNT A;  4K1U A;  4H61 A;  2P38 A;  1BRN L;  1I70 A;  3EN8 A;  2K0M A;  2ZDJ A;  3KN4 A;  1L5G B;  4AKZ A;  4GL6 A;  1GLA F;  1IV9 A;  2HMK B;  1NDO B;  1E97 A;  1X1W A;  1GLD F;  1TJD A;  2AAD A;  2RFR A;  2UX0 A;  5DRE A;  4HM1 B;  3G0K A;  3BB9 A;  4O8S A;  1BU4 A;  4HOH A;  4AEQ A;  2KRT A;  3U1W A;  1IDP A;  3PGB A;  3K5T A;  1Q7Y 4;  4RBN A;  5BU4 A;  1Q40 A;  2BHM A;  2P0X A;  1GPR A;  3JUP A;  2RGQ A;  2HMN B;  3CPW 2;  1KSI A;  1Q9E A;  2E2T A;  3K63 A;  1RGH A;  4FMA A;  1LOV A;  2YFI B;  3SOA A;  1VQP 3;  3IT5 A;  1UCJ A;  1FW7 A;  2OCT A;  1SII A;  1GSP A;  1NNV A;  1WMO A;  2W6J H;  1HKX A;  1S72 3;  1B2M A;  2IUJ A;  1BVI A;  1ROA A;  3TUF B;  4HM6 B;  2CWV A;  1OUN A;  2IUK A;  1YNV X;  2WGQ A;  2H0G A;  3ZFZ A;  3LML A;  3N9H A;  1JKG B;  1W7C A;  3Q2P A;  3MSO A;  3CC7 3;  3CCE 3;  1K9M 4;  1KQS 2;  3I0Y A;  2Y74 A;  1ISK A;  2BIR A;  1MGR A;  1MWU A;  1RHL A;  1RGA A;  5TGN A;  2CX0 A;  1RGK A;  1NJI 4;  3DGL A;  1O7G B;  4IPB A;  4N6U A;  3X3Z A;  2GU1 A;  4BL3 A;  2RBI A;  3AGN A;  1FGQ A;  3F7X A;  7GSP A;  3JUN A;  1FGT A;  1JZO A;  2Q07 A;  1UCK A;  1RN7 A;  2RSX A;  2PZV A;  2FXT A;  1GS3 A;  1NB3 I;  5B0H A;  1PFP A;  3FLJ A;  5AIG A;  3OXA A;  3RDE A;  2CK3 H;  1O7M B;  1UI7 A;  1A2V A;  3K0Z A;  2GBW B;  4HM8 B;  2WOF A;  3K9M C;  1BNR A;  3KII A;  4R80 A;  1DE3 A;  3MG2 A;  4KVH A;  1W6G A;  3SVA A;  3CME 3;  3NV0 A;  2OQE A;  1FGR A;  3E99 A;  2CX1 A;  3NBR A;  3U97 A;  3BNC A;  3FGY A;  1EA2 A;  3AHW A;  3D79 A;  2B13 A;  1RDS A;  1X1Y A;  1HZ1 A;  2W56 A;  5ELU A;  1UUW B;  2C10 A;  4LGQ A;  2XGN A;  1BSC A;  1I2G A;  1D6Y A;  1W02 A;  3AHS A;  5FW5 A;  2YFJ B;  4EV2 A;  1YHQ 3;  3CC4 3;  3V99 A;  1EKM A;  1IU7 A;  1LOX A;  3KSP A;  4XDW A;  3D9R A;  2B1X B;  1S5A A;  5EVH A;  2MP0 B;  3HX8 A;  1VQK 3;  1GY6 A;  4NHF A;  2XH9 A;  1I3F A;  3LYG A;  1BNI A;  3JUQ A;  4KFE A;  3UZ0 B;  1FGM A;  2WGO A;  1B3S A;  1OHO A;  3NYY A;  2BT3 A;  2F99 A;  4HM2 B;  3RGR A;  4WYK B;  1RGE A;  2OQE C;  3GSP A;  5ELJ A;  2W9P A;  3Q3F A;  3CC2 3;  1JNQ A;  2A15 A;  3EJV A;  1MOL A;  2BO9 B;  3HOH A;  4J5K A;  5KP3 A;  2CFL A;  4EV5 A;  1ASK A;  4R1K A;  5A0O B;  3LH4 A;  3GZX B;  1MNL A;  3EN1 B;  4NRE A;  1TFO A;  2P09 A;  3D4A A;  1CQS A;  3KKG A;  4RNY A;  2GU3 A;  2XF3 A;  3KFQ C;  4MEI A;  1UUG B;  1OAC A;  4H3U A;  4HZB B;  1BRJ A;  1CYU A;  4K61 A;  1K73 4;  3A5E A;  1F8N A;  3AMO A;  3F7S A;  3FF2 A;  3FG1 A;  3KE7 A;  2AAE A;  2H0I A;  4I5Q A;  4AKY A;  1BNG A;  4NPB A;  1YIJ 3;  2K54 A;  3OWU A;  2Z7A A;  4WWU C;  1RMS A;  5JPP A;  3G71 3;  3PXM A;  1F3Z A;  3S27 A;  3CCU 3;  2HMJ B;  3PYJ A;  1R4Y A;  4MMX B;  3DGY A;  1V57 A;  4HM3 B;  1GMQ A;  3VSY A;  5HOH A;  1W4N A;  1DVC A;  1GLE F;  2XFT A;  5I97 A;  3G6E 3;  1BSD A;  2OTJ 3;  1OGZ A;  3T0U A;  2CFG A;  1B2S A;  2W0Q A;  3OWS A;  1OF5 A;  1V58 A;  4EYC A;  3A76 A;  1OCV A;  4FMB A;  2W9Q A;  1B2U A;  1TU5 A;  2RCD A;  1TP6 A;  1BNF A;  1BNE A;  2ML6 A;  3CNX A;  3EBY A;  4G1M B;  4X2H A;  4XBX A;  1AVK A;  2F5M A;  3SX1 A;  4BTY A;  1I3I A;  1FUW A;  1YGW A;  2STD A;  4BTX A;  1BSB A;  1LOY A;  3M8C A;  4N3V A;  1JV2 B;  1YVS A;  3S67 A;  6RNT A;  4R4K A;  1OHP A;  4L8P A;  1RLS A;  4J5G A;  4LEH A;  5JPU A;  1RRH A;  2JQ5 A;  3GWR A;  2KF3 A;  1UI8 A;  1BRH A;  4HBR A;  1DMN A;  2SBL A;  1SAR A;  3BLZ A;  4CDL A;  3CSQ A;  1BIR A;  2W2C A;  3TDG A;  3BND A;  1A2P A;  5IF6 A;  5CXO A;  1IT7 A;  2CWU A;  4KT3 B;  1Y4K A;  2GEX A;  5STD A;  3ROB A;  1BRG A;  3VF1 A;  1W00 A;  4WHA A;  1EUI C;  1RJO A;  1STD A;  4XB5 A;  4BH5 A;  1LOW A;  4N6T A;  1VQL 3;  1AX3 A;  1IVX A;  4QWT A;  1BGS A;  1SQW A;  2XFS A;  3URP A;  3H51 A;  2L1S A;  1A2K A;  2OOV A;  1BUJ A;  2H0H A;  3CCR 3;  3HZP A;  3WA2 X;  2GPR A;  3F8H A;  1GOV A;  3OUR B;  3BU4 A;  4JBW M;  3ZG0 A;  2B44 A;  1G96 A;  4JF8 A;  3EQQ B;  2F4Y A;  2YFL B;  1GYB A;  4ILF A;  4RZM A;  4WP5 A;  1IV7 A;  4STD A;  1B27 A;  2XSO B;  3B4O A;  4FCM A;  5DRV A;  3IT7 A;  2CFD A;  2KAA A;  3PZW A;  4IIA A;  1DYU A;  4LXC A;  3STD A;  1I2E A;  3G16 A;  3HIG A;  3L0R A;  3WA3 A;  4HM4 B;  3X42 A;  7STD A;  5HGR A;  2W56 B;  4MJD A;  1JJ2 2;  1N8R 4;  2Z6B A;  1X1X A;  2CFW A;  2O9U X;  1UCI A;  2CC3 A;  1I0X A;  3CCV 3;  3NHX A;  3PS8 A;  2XEP A;  2JDI H;  4LSO A;  1GLB F;  1JB4 A;  3UL6 A;  1O7W B;  1QAF A;  4TX4 A;  1JBT A;  2F3G A;  1LRA A;  1HU9 A;  2KF4 A;  1M9G A;  2W04 A;  1VQ7 3;  2CG1 A;  3RNT A;  2XSH B;  1A67 A;  2HOH A;  3B4P A;  4GHO A;  2ZA4 A;  3X3X A;  1RGG A;  1IQY A;  2D1W A;  3Q90 A;  2HMO B;  1U5O A;  4MMZ B;  1G02 A;  3BIR A;  1LNI A;  1GY7 A;  4ORL A;  1O7H B;  3EHC A;  3GZR A;  2YX9 A;  3OX9 A;  3IPT A;  4XBT A;  1MWR A;  5KP4 A;  3LTC A;  1VQ4 3;  3MKI A;  5G1K A;  1BSE A;  3MYT A;  5CK6 A;  1IQX A;  2QIY A;  1F3G A;  2WOH A;  3N54 B; 
#chains in the Genus database with same CATH homology
 3GAX A;  1QAL A;  2R4I A;  5D82 A;  3WMD A;  2HSI A;  3BNE A;  6STD A;  5AEU B;  3SXX A;  3AMO B;  3RGA A;  3IJE B;  1BUQ A;  2MC8 A;  3EB8 A;  4FR9 A;  4FCJ A;  3G4S 3;  3DM8 A;  1K8A 4;  5EEO A;  3MHE A;  4N6V 0;  1CEW I;  2Z77 A;  2Z76 A;  3B7C A;  4WFO A;  2F98 A;  1ZX2 A;  4L7K A;  3NBJ A;  5LC6 A;  4BTW A;  4HM0 B;  1AV4 A;  3MG3 A;  1CYV A;  5LC7 A;  2ML5 A;  3UNL A;  3LZA A;  5FGO A;  3JVC A;  4FMD A;  3H3H A;  3FF0 A;  3K7C A;  1GD4 A;  1OGX A;  3OW2 2;  2IMJ A;  4R9L A;  1YIT 3;  3DZL A;  5IEN A;  1UW1 A;  3DUK A;  2ZL8 A;  1VQ6 3;  4PEJ A;  1VZZ A;  3X41 A;  2LYX A;  1E3R A;  3S5C A;  1KWI A;  4HKV B;  1WTH A;  4LZI A;  4EBG A;  2BMO B;  3NBB A;  3SOY A;  3F14 A;  1DVD A;  1GY5 A;  2I9W A;  3I56 3;  1ROV A;  3NX0 A;  1IVV A;  5BVB A;  2P0M A;  3HII A;  3X40 A;  4RNZ A;  1O7N B;  4WYK A;  3LTB A;  1Q40 B;  3PCR A;  3UL5 A;  2FNQ A;  4XBY A;  3FH1 A;  1YGE A;  4O02 B;  1IQ8 A;  3X3Y A;  3FKA A;  1YJ9 3;  3F40 A;  1NB5 I;  4CCV A;  2LQV A;  2P05 A;  3PCS A;  1OPY A;  1DMQ A;  1D6Z A;  1QAK A;  1JN5 A;  2GEY A;  2M7O A;  1N8Q A;  4HJL B;  1JRQ A;  1Z1S A;  3FCS B;  1WQL B;  2QA4 3;  2E2U A;  5G2G A;  1YJN 3;  2XGL A;  4U13 A;  4I4K A;  5AIH A;  2PNC A;  1AVL A;  2CIU A;  3UJM A;  1O2F A;  2GXF A;  4KFF A;  5IG0 A;  4X2O A;  3BNB A;  3S29 A;  3CCL 3;  5KP1 A;  4ZYB A;  1DMM A;  1QJG A;  1EG9 B;  2B0P A;  2KXG A;  3DY5 A;  4K1V A;  3GZY B;  2BNG A;  3CD6 3;  1Q86 4;  3NUV A;  5IW9 A;  5EQL A;  3SED A;  3MG1 A;  1LVN A;  1FGO A;  2BMQ B;  3DMC A;  3LT8 A;  4O2H A;  2GBX B;  3EF8 A;  3KZT A;  4QPB A;  3QRD A;  1KD1 4;  5IEP A;  5CLK A;  3MPH A;  4HM5 B;  1QVG 2;  3NV0 B;  2OWP A;  4KFD A;  4ZM8 A;  2CW9 A;  5D81 A;  3CCS 3;  1IVU A;  1W2B 2;  2HMM B;  4N6M A;  5IG5 A;  3D3L A;  4HVN A;  1N9J A;  3ECF A;  3GRD A;  1OH0 A;  3LTD A;  3FZW A;  2IA7 A;  4OUQ A;  2CKF B;  2OOV C;  1YVB I;  3FG4 A;  1PU4 A;  1ZO2 A;  2C11 A;  1VQ8 3;  3EX9 A;  1C7H A;  1RKY A;  1M90 4;  3JUO A;  1N5P A;  1IT8 A;  3F9S A;  3CCJ 3;  1FA3 A;  1OHS A;  3F8X A;  5AEW B;  2QEX 3;  3CCM 3;  5IEO A;  1EQK A;  1WNH A;  1US1 A;  2KCD A;  5AYS C;  1LXE A;  3QK9 A;  1TUH A;  1W5Z A;  1W01 A;  3NM7 A;  3EBT A;  2XR8 B;  1JB2 A;  3LTA A;  1N9E A;  5IER A;  3CNM A;  1M1X B;  1GD3 A;  3V98 A;  3NXJ A;  4N6O B;  4XM4 A;  3J7Y d;  3HI7 A;  4KZ1 A;  2OTL 3;  3NQZ A;  1JKG A;  2B24 B;  1VQ9 3;  2O3O A;  4FCZ A;  4XDV A;  3WOD G;  1W6C A;  4O3V A;  3B8L A;  4J9A A;  2CG0 A;  1D6U A;  1YJW 3;  4MMY B;  5JBS A;  1SIH A;  3CXC 2;  5IG3 A;  1STF I;  1GGR A;  2D42 A;  3SLU A;  1SPU A;  3EE1 A;  2CWT A;  3CCQ 3;  1W6Y A;  3FG3 A;  4EXR A;  1T5Y A;  2BMR B;  5CF2 A;  2CFK A;  2F86 B;  4OVM A;  1VQM 3;  4OK0 A;  3ALA A;  4N6L A;  1OF5 B;  5D83 A;  1SJW A;  3ER7 A;  2E2V A;  5AIF A;  1NO3 A;  4LMI A;  1O7P B;  2Y73 A;  3CU3 A;  5AYR B;  4HZ9 B;  3MWZ A;  1WMP A;  1ULJ B;  1WMN A;  1VQO 3;  3G8Z A;  1M1K 4;  3CPO A;  3UB1 A;  4HYZ A;  3O8Y A;  1NWW A;  2L4V A;  4GB5 A;  1W2Z A;  2W03 A;  1QMA A;  3KSE D;  4J8T A;  3T8U A;  1JN5 B;  1R4C A;  3S28 A;  4QP5 A;  1GLC F;  2FGT A;  2INX A;  1IK3 A;  3V92 A;  1Q82 4;  1YI2 3;  1VQ5 3;  5BXQ A;  4JRF A;  2CHC A;  1V74 A;  2XRX B;  1Q81 4;  3IMA B;  1Q42 A;  3CMA 3;  1VQN 3;  1NU3 A;  2MF7 A;  3DXO A;  5AII A;  8CHO A;  1ULI B;  1AR0 A;  4IT7 A;  2CH9 A;  3DGM A;  1UUV B;  3I55 3;  5IG4 A;  1A90 A;  1J2B A;  1IVW A;  3LXU X;  5AI1 A;  3WOF B;  3N8B A;  3DGN A;  2WO0 A;  3JUM A;  3NM2 A;  1LNH A;  3WDG B;  3GZB A;  3HK4 A;  3LOY A;  4HM7 B;  1TFK A;  1U8C B;  2QGU A;  4EC6 A;  3Q1C A;  1QWY A;  1QVF 2;  3EC9 A;  3FSD A;  3NQY A;  2HML B;  3VGN A;  5CF1 A;  4L8O A;  1K41 A;  4K90 B;  5KVP A;  3OWY A;  4R9K A;  4FMC A;  1KC8 4;  1E3V A;  2V1L A;  3LT9 A;  1N5H A;  1TIJ A;  1JB5 A;  1K28 A;  1RRL A;  3DGO A;  3OV4 A;  4N6N B;  4Q53 A;  3T8N A;  4K1U A;  4H61 A;  2P38 A;  3EN8 A;  2K0M A;  2ZDJ A;  3KN4 A;  1L5G B;  4AKZ A;  4GL6 A;  1GLA F;  1IV9 A;  2HMK B;  1NDO B;  1E97 A;  2RFR A;  1GLD F;  2UX0 A;  3OWS A;  5CXO A;  5DRE A;  3WOE B;  4HM1 B;  3G0K A;  3BB9 A;  4O8S A;  4AEQ A;  2KRT A;  3U1W A;  1IDP A;  3PGB A;  3K5T A;  1Q7Y 4;  4RBN A;  1Q40 A;  2BHM A;  2P0X A;  1GPR A;  3JUP A;  2RGQ A;  2HMN B;  3CPW 2;  1KSI A;  2E2T A;  3K63 A;  4FMA A;  2YFI B;  3SOA A;  1VQP 3;  3IT5 A;  2OCT A;  1SII A;  2W6J H;  1WMO A;  1S72 3;  1HKX A;  2IUJ A;  1ROA A;  3TUF B;  4HM6 B;  2CWV A;  1OUN A;  2IUK A;  2WGQ A;  1FUW A;  3CC7 3;  3LML A;  3N9H A;  1JKG B;  1W7C A;  3Q2P A;  3MSO A;  3CCE 3;  1K9M 4;  1KQS 2;  3I0Y A;  2Y74 A;  1ISK A;  5TGN A;  1NJI 4;  3DGL A;  1O7G B;  4IPB A;  4N6U A;  3X3Z A;  2GU1 A;  1FGQ A;  3F7X A;  3JUN A;  1FGT A;  2Q07 A;  1RN7 A;  2RSX A;  2PZV A;  2FXT A;  1GS3 A;  1NB3 I;  5B0H A;  1PFP A;  3FLJ A;  5AIG A;  3OXA A;  3RDE A;  2CK3 H;  1O7M B;  1UI7 A;  1A2V A;  3K0Z A;  2GBW B;  4HM8 B;  2WOF A;  3K9M C;  3KII A;  4R80 A;  3MG2 A;  4KVH A;  1W6G A;  3SVA A;  3CME 3;  3NV0 A;  2OQE A;  1FGR A;  3E99 A;  3NBR A;  3U97 A;  3BNC A;  3FGY A;  1EA2 A;  2B13 A;  5ELU A;  2W56 A;  1UUW B;  2C10 A;  4LGQ A;  2XGN A;  1W02 A;  5FW5 A;  1D6Y A;  4EV2 A;  1YHQ 3;  3CC4 3;  2YFJ B;  3V99 A;  1EKM A;  1IU7 A;  1LOX A;  3KSP A;  4XDW A;  3D9R A;  2B1X B;  1S5A A;  5EVH A;  2MP0 B;  3HX8 A;  1VQK 3;  1GY6 A;  4NHF A;  2XH9 A;  3LYG A;  3JUQ A;  4KFE A;  3UZ0 B;  1FGM A;  2WGO A;  1OHO A;  3NYY A;  2BT3 A;  2F99 A;  4HM2 B;  3RGR A;  4WYK B;  2OQE C;  5ELJ A;  2W9P A;  3CC2 3;  1JNQ A;  2A15 A;  3EJV A;  1MOL A;  2BO9 B;  5KP3 A;  2CFL A;  4EV5 A;  1ASK A;  4R1K A;  5A0O B;  3LH4 A;  3GZX B;  1MNL A;  3EN1 B;  4NRE A;  1TFO A;  2P09 A;  1CQS A;  3KKG A;  4RNY A;  2GU3 A;  2XF3 A;  3KFQ C;  4MEI A;  1OAC A;  4H3U A;  4HZB B;  1CYU A;  4K61 A;  1K73 4;  1F8N A;  3AMO A;  3F7S A;  3FF2 A;  3FG1 A;  3KE7 A;  4AKY A;  1YIJ 3;  2K54 A;  3OWU A;  2Z7A A;  4WWU C;  5JPP A;  3G71 3;  3PXM A;  1F3Z A;  3S27 A;  3CCU 3;  2HMJ B;  3PYJ A;  4MMX B;  4HM3 B;  3VSY A;  3G6E 3;  1W4N A;  1DVC A;  1GLE F;  2XFT A;  5I97 A;  2OTJ 3;  1OGZ A;  3T0U A;  2CFG A;  2W0Q A;  1OF5 A;  4EYC A;  3A76 A;  1OCV A;  4FMB A;  2W9Q A;  1TU5 A;  2RCD A;  1TP6 A;  4G1M B;  2ML6 A;  3CNX A;  3EBY A;  4XBX A;  4X2H A;  3SX1 A;  1AVK A;  4BTY A;  2STD A;  4BTX A;  3M8C A;  4N3V A;  1JV2 B;  3S67 A;  4R4K A;  1OHP A;  4L8P A;  4LEH A;  5JPU A;  1RRH A;  2JQ5 A;  3GWR A;  1UI8 A;  4HBR A;  4CDL A;  1DMN A;  2SBL A;  3BLZ A;  3CSQ A;  2W2C A;  3TDG A;  3BND A;  5IF6 A;  1IT7 A;  2CWU A;  1Y4K A;  2GEX A;  5STD A;  3ROB A;  3VF1 A;  1W00 A;  4WHA A;  1RJO A;  1STD A;  4XB5 A;  4BH5 A;  4N6T A;  1VQL 3;  1AX3 A;  1IVX A;  4QWT A;  1SQW A;  2XFS A;  3H51 A;  1A2K A;  2OOV A;  3CCR 3;  3HZP A;  3WA2 X;  2GPR A;  3F8H A;  3OUR B;  4JBW M;  2B44 A;  1G96 A;  4JF8 A;  3EQQ B;  2YFL B;  1GYB A;  4RZM A;  4WP5 A;  1IV7 A;  4STD A;  2XSO B;  3B4O A;  4FCM A;  5DRV A;  3IT7 A;  2CFD A;  3PZW A;  4IIA A;  1DYU A;  4LXC A;  3STD A;  3G16 A;  3HIG A;  3L0R A;  3WA3 A;  4HM4 B;  3X42 A;  7STD A;  5HGR A;  2W56 B;  4MJD A;  1JJ2 2;  1N8R 4;  2Z6B A;  2CFW A;  2O9U X;  2CC3 A;  3CCV 3;  3NHX A;  3PS8 A;  2XEP A;  2JDI H;  4LSO A;  1GLB F;  1JB4 A;  3UL6 A;  1O7W B;  1QAF A;  4TX4 A;  2F3G A;  1HU9 A;  1VQ7 3;  1M9G A;  2W04 A;  2CG1 A;  2XSH B;  1A67 A;  3B4P A;  3X3X A;  1IQY A;  2D1W A;  3Q90 A;  2HMO B;  1U5O A;  4MMZ B;  4ORL A;  1GY7 A;  1O7H B;  3EHC A;  3GZR A;  2YX9 A;  3OX9 A;  3IPT A;  4XBT A;  1VQ4 3;  5KP4 A;  3LTC A;  3MKI A;  3MYT A;  5CK6 A;  1IQX A;  2QIY A;  1F3G A;  2WOH A;  3N54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...