2GU1A

Crystal structure of a zinc containing peptidase from vibrio cholerae
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
325
structure length
324
Chain Sequence
RIHYMVKVGDTLSGIFAQLGVPYSILQKILSVDLDHLQLDMIQPGEELELMMDDMGQLSRLIYHMSIVEKAIYTRENDGSFSYDFQEISGEWREILFSGEINGSFSVSARRVGLTSSQVANITQVMKDKIDFSRSLRADRFDILVKQQYLGEHNTGNSEIKAISFKLAKGDVSAFLAEDGRFYDRAGNSLERAFNRYPVDKAYRQITSGFNPKRKHPVTGRVVPHNGTDFATPIGAPVYSTGDGKVIVVRKHPYAGNYLVIEHNSVYKTRYLHLDKILVKKGQLVKRGQKIALAGATGRLTGPHLHFEVLVRNRPVDAMKADLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc peptidase
publication title Crystal structure of a putative lysostaphin peptidase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 79
structure length 324
sequence length 325
ec nomenclature ec 3.4.-.-:
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF04225 OapA Opacity-associated protein A LysM-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 2gu1A03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu1A02
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2gu1A01
2B44A 4RNZA 1GLAF 5B0HA 4BH5A 4LXCA 1F3ZA 1GLDF 3NYYA 2GPRA 2HSIA 1GGRA 2GU1A 1GLBF 1O2FA 3OURB 3SLUA 5KVPA 1GLCF 3UZ0B 3TUFB 1QWYA 2MP0B 2B0PA 4RNYA 1F3GA 1GLEF 3CSQA 4ZYBA 3IT7A 4JBWM 2B13A 1AX3A 1GPRA 3IT5A 4QPBA 2F3GA 4QP5A
chains in the Genus database with same CATH superfamily
1B27A 3MG2A 5CLKA 1RTUA 1AR0A 4KFEA 2KXGA 1I2FA 5AIHA 1BIRA 3PCSA 4FMDA 4R9KA 1FGQA 5KP4A 1O7HB 3S67A 3WMDA 3K7CA 2GU1A 1BGSA 1AQZA 3F8XA 1O2FA 1RCKA 4NREA 2CFWA 1GLCF 3LTBA 2L1SA 5D83A 3FG3A 1UUVB 3HIGA 2BU4A 3SEDA 3CC43 4RNYA 2XGNA 4XB5A 2OQEC 1JV2B 5IF6A 4XDVA 1UCIA 1K734 2HMKB 2LQVA 1YNVX 1AX3A 5ELJA 3ER7A 1BRIA 1EUIC 2W9QA 2W9PA 1T5YA 5IG0A 1YJW3 4XBXA 1RGFA 2WOFA 3X42A 1BNSA 1MOLA 1PFPA 1LOVA 3UL5A 1UUWB 2XGLA 3VGNA 5BVBA 4OK0A 4R9LA 2F86B 1EQKA 3NQYA 4HZBB 1VQ73 2QEX3 1YVSA 2F99A 2HSIA 1O7WB 3MYTA 4R80A 1BUJA 3A76A 2AADA 4KFDA 3AGOA 3OX9A 3WODG 3DGOA 1ISKA 3HK4A 4J9AA 1VQ53 3JUQA 3WHOA 3JUOA 2CG1A 4EYCA 2BT3A 1T2HA 1CEWI 3FF0A 1Q814 4XM4A 7GSPA 1E3VA 5AYSC 1BRJA 2SARA 3DMCA 3K63A 1STDA 3GZXB 1N8R4 1JBRA 3K0ZA 1W02A 4HOHA 1BAOA 1BSDA 1I70A 1VQK3 3UB1A 1QJGA 1UDII 2B44A 5B0HA 1WMOA 3G8ZA 3RDEA 5AEWB 1MWRA 1RKYA 4BH5A 6GSPA 4LXCA 4WHAA 1TRQA 1A2PA 2D42A 3F14A 3QK9A 1D6UA 1N5HA 3ZG0A 3HOHA 1US1A 1TFOA 2AAEA 1K41A 1OPYA 2WOHA 3Q90A 3KSPA 4R1KA 1LNHA 2SBLA 2GU3A 2JQ5A 1X1WA 1AVKA 3MSOA 5HGRA 4R4KA 3CC73 1VQ93 1EEJA 3HZPA 4GB5A 8RNTA 2B1XB 3SOYA 4N6UA 4HZ9B 3KIIA 1RGHA 1HYFA 1MWTA 3KSED 4FMCA 3CCV3 3BB9A 3JUNA 5TGNA 2W56A 4EV5A 1A2KA 3T8UA 5EEOA 3X40A 3DUKA 4MMZB 5AYRB 1PU4A 2CFDA 3I553 1OGZA 4OUQA 1DMQA 1JB2A 1FGMA 1FGRA 1UCKA 1TUHA 2GEXA 3MG1A 4CCVA 3H3HA 1FA3A 4K1VA 5KP3A 3CXC2 2XSOB 4WWUC 5AIFA 1GY5A 1UGHI 3AHSA 1BANA 4RBNA 1KQS2 4NHFA 2W0QA 2KF6A 2GXFA 2O9UX 4BL2A 5KVPA 1W6GA 5IERA 2H0GA 3NBJA 2F4YA 1QWYA 3CCM3 3O8YA 3T0UA 2J8XB 1W01A 2MP0B 1OHSA 2CFLA 4CJNA 5BXQA 3BNCA 3NUVA 1GLEF 2OTL3 2RBIA 2Z6BA 1B3SA 1LRAA 4IIAA 3I563 2ZHXB 3IT5A 1AVLA 1G02A 1Q42A 1GOYA 1IV9A 1RJOA 1STFI 1WMNA 1S5AA 1W4NA 3BNDA 3FLJA 3N8BA 3X3XA 4EXRA 1ZX2A 1LNIA 5DREA 3D9RA 4LMIA 2YFIB 1S723 4RNZA 3STDA 1BNJA 3CPOA 9RNTA 1VQM3 1I2GA 1LOWA 2C4BA 1DYUA 3PYJA 2XF3A 2E2UA 3GZYB 3U97A 1QAKA 3GSPA 2XFSA 3LZAA 3G4S3 1C54A 2P0XA 4HJLB 3WDGB 1OF5B 5D81A 1TP6A 3LOYA 3OWUA 2GBXB 4HM6B 5FGOA 1IVUA 4I4KA 1IQ8A 1W2ZA 3LT8A 1FUSA 1YVBI 2CWVA 3ECFA 3HX8A 2F5MA 3BNEA 1FGOA 1DMMA 3OW22 1N9JA 2ZDJA 2XR8B 1MGRA 2OQEA 4BTYA 3H51A 3FCSB 2Q07A 4HM4B 1W5ZA 1YJN3 5D82A 2LYXA 4G1MB 5AI1A 3F7XA 1JB5A 2P38A 2GEYA 3SXXA 5JPPA 3EC9A 1LVNA 1JKGA 3F9SA 1MGWA 1Q40A 1TFKA 1B2SA 3WA3A 2OOVC 1YIT3 3UJMA 3L0RA 3WOFB 5HOHA 3G0KA 1DMNA 1QMAA 2CHCA 2C10A 3FG4A 2F5WA 4N3VA 2P05A 5IENA 1SQWA 1E3RA 2RFRA 1RLSA 1GGRA 1ROAA 5JBSA 2BMRB 1CQSA 1RN7A 1W7CA 3CCJ3 4FCZA 2HMMB 3MPHA 5M1AA 3J7Yd 1RSNA 1TRPA 1BSEA 1RNTA 4LZIA 4HM2B 1SJWA 2YFJB 4J5GA 3IT7A 4CPKA 3NHXA 2L4VA 1B2MA 5IEOA 1GOVA 2F98A 4ZM8A 4O3VA 2GBWB 1W2B2 4HM0B 1W6YA 3NYYA 1VQQA 1B21A 1C7HA 3D4AA 3DGMA 4L8PA 1T2IA 1BNRA 2CC3A 3X3YA 1RGKA 5EVHA 3LTAA 4HBRA 1I0VA 3SLUA 1TJDA 4FMAA 1N8QA 2M7OA 4KZ1A 1A67A 3QRDA 3OWYA 4L7KA 1IU7A 1QALA 1DVDA 1LQMB 3CNMA 1GMRA 3KCHA 3M8CA 5IG3A 3WA2X 1Z1SA 3CME3 1YHQ3 1UUGB 3FGYA 4EBGA 3K9MC 1N5PA 1DETA 3I0YA 1VQO3 3NV0B 2FNQA 1GOUA 1GYBA 3GAXA 5RNTA 3BNBA 1F8NA 3NQZA 1EKMA 1IT7A 4QPBA 1L5GB 2KF5A 2RCDA 2KCDA 3CCQ3 3ROBA 3NM2A 3X3ZA 1VQ43 1V57A 1GLAF 1BNEA 1QAFA 5LC6A 2CH9A 3WR2A 5A0OB 1F3ZA 1JN5B 5AIIA 2Z77A 3HI7A 1BNFA 4JF8A 2PNCA 2XSHB 3OXAA 1GMPA 4FCJA 1X1XA 2RGQA 4Q53A 1WQLB 2HMLB 5M18A 4HYZA 3KZTA 1KC84 1F3GA 2HMOB 3DZLA 2W6JH 3VF1A 1LOXA 4ILFA 3D5GA 2BHMA 2FGTA 4I5QA 5GSPA 2UGIA 1W6CA 4GSPA 3D3LA 4TX4A 3V98A 4AKYA 1NU3A 2F3GA 2YX9A 4MEIA 4STDA 2INXA 3CNXA 1BRKA 2OWPA 1DE3A 1HU9A 3HIIA 1BRSA 3FZWA 4XBYA 1M904 1Q824 1IVWA 2K3DA 6STDA 1X1YA 1RMSA 1FZUA 2CFKA 1FUWA 1JZOA 1UI8A 3KN4A 1O7GB 3CCL3 4HKVB 3KFQC 3DH2A 2GSPA 3EBYA 1Q9EA 1VZZA 1DVCA 1IVVA 5ELUA 5G1LA 1OCVA 2CWTA 5IG5A 3PZWA 2IUJA 2WGQA 4L8OA 4BU4A 3OWSA 3BU4A 1ULIB 4WFOA 3U1WA 1Q7HA 1OGXA 2QA43 1YGEA 1D6ZA 4QWTA 4FCMA 1BRHA 3VSYA 1EA2A 1X1UA 3DM8A 3IJEB 1GY7A 2IUKA 3CCS3 4LYLB 1M1K4 1E97A 1RGLA 4J8TA 1O7PB 4JRFA 1BUQA 3DGNA 2BNGA 1VQP3 1M1XB 1OH0A 1U8CB 3OV4A 2OOVA 3EE1A 4HVNA 2KF4A 3X41A 2QIYA 1BOXA 2FXTA 1UW1A 1GLBF 1BVIA 2PZVA 4EV2A 1SARA 1BSBA 3LYGA 1VQN3 1IDPA 3TUFB 2BIRA 3MWZA 1VQ83 1FGTA 3GZBA 1I8VA 3V99A 3EBTA 4N6LA 3AMOB 4OVMA 3LT9A 4H3UA 3FH1A 3IPTA 4EW5A 1TTOA 2QGUA 3EJVA 2MC8A 1NWWA 2E2TA 2BO9B 4J5KA 3FKAA 1R4YA 3LXUX 3LMLA 1IK3A 1HKXA 4HM1B 1G96A 1RDSA 1OF5A 3G16A 1G0TA 1UGIA 3N54B 1TIJA 3KE7A 4ORLA 1YGWA 3FSDA 4WYKB 4EC6A 2Y74A 1O7NB 5BIRA 5BU4A 3B7CA 3Q2PA 2A15A 4X2OA 5M19A 1Q7Y4 4HM3B 2C11A 3D5IA 4K61A 1OHPA 3F7SA 2HOHA 2BMOB 3S28A 4CDLA 2IYJA 2MF7A 1UCLA 2B0PA 2R41A 1RGGA 4PEJA 1RGCA 1BRNL 3PXMA 1LQGC 3FG1A 1NB3I 1V58A 1A2VA 4N6OB 1UI7A 2OCTA 3B4PA 4MJDA 1CH0A 1W00A 3F8HA 3WOEB 1NB5I 1RGAA 3CU3A 2JDIH 2STDA 2WGOA 3CCU3 1JJ22 2CX0A 2OTJ3 1ULJB 7RNTA 2R4IA 4DKIA 1I0XA 4N6V0 1SPUA 3DY5A 1GLDF 1MWUA 2W03A 3LTDA 3NX0A 4FMBA 4LEHA 1GD4A 1LOYA 4FR9A 4RNTA 1ASKA 3RNTA 3CC23 1RHLA 4XBTA 2B24B 1K9M4 1BNIA 1RGEA 3CCR3 4WP5A 2CWUA 2CK3H 3PCRA 1AY7A 1IV7A 1B2ZA 4ZYBA 4H61A 3LH4A 4JBWM 1A90A 1MNLA 2B13A 1FUTA 5CK6A 3DXOA 3ZFZA 2F56A 4MMYB 3KKGA 5CF1A 3SX1A 5FW5A 2ZA4A 5IW9A 4AKZA 1EG9B 6RNTA 4QP5A 1I3FA 1PYLA 4MMXB 4GL6A 1K8A4 1IQYA 3PS8A 1CYUA 3EB8A 3TDGA 1M9GA 1KD14 1D6YA 3JVCA 3UL6A 1KSIA 2V1LA 1BU4A 2XRXB 2RSXA 3S27A 3URPA 5AIGA 3NV0A 2XEPA 4IT7A 1RN4A 1RN1A 2CX1A 3JUPA 2P0MA 3Q1CA 2H0HA 2I9WA 3PGBA 1IT8A 4KFFA 4BL3A 1IYYA 1WNHA 1FYSA 1OUNA 5JPUA 3BLZA 1YI23 3Q3FA 3MKIA 5G2GA 1SIIA 1NDOB 1NNVA 4BTWA 1GPRA 1LXEA 1SIHA 1AV4A 2IA7A 2UUGC 1JN5A 3MG3A 1YJ93 2K54A 1JBTA 4NPBA 3CD63 5LC7A 1GS3A 4LGQA 5I97A 4RZMA 1OACA 1RRHA 1RRLA 1KWIA 2BMQB 3DGYA 4KT3B 3EF8A 4O2HA 4AEQA 2W56B 1ZS7A 3NM7A 2CFGA 1JB4A 3S5CA 1VQ63 1CYVA 3IMAB 5IEPA 2YFLB 2D1WA 3OURB 1GD3A 1UCJA 1J2BA 2ML6A 2P09A 2KRTA 1Y4KA 1B2XA 3E99A 2IY2A 1BNGA 1JZDA 1ZGXA 1JNQA 3NXJA 4K1UA 3F40A 5AEUB 2H0IA 1BSAA 3EX9A 5G1KA 1O7MB 1I3IA 4N6NB 1FW7A 1RCLA 4K90B 3GWRA 1GMQA 1T3BA 2RNTA 5CF2A 1B20A 1IVXA 1B2UA 1GY6A 5EQLA 3G713 2W04A 3BIRA 5DRVA 3EQQB 3RGAA 1MWSA 4IPBA 4LSOA 4O02B 3EHCA 3FF2A 3ALAA 2UX0A 1ROVA 2ZL8A 3UZ0B 1YIJ3 2HMNB 3B8LA 3SOAA 1OHOA 1Q864 5IG4A 2CG0A 2WO0A 3A5EA 2Z7AA 3UNLA 1JRQA 3NBBA 1NO3A 1NJI4 3EN8A 2Z76A 3B4OA 2KF3A 3T8NA 3ZG5A 3AHWA 1I2EA 3K5TA 3GRDA 4N6TA 1BRGA 1N9EA 3SVAA 3GZRA 3CCE3 1RNBA 2CIUA 3G6E3 1VQL3 1WTHA 7STDA 4HM7B 2ML5A 2GPRA 1TU5A 1QVG2 4HAAA 1QVF2 1JKGB 5CXOA 1ZO2A 1HZ1A 1Q40B 2HMJB 3D79A 8CHOA 2CKFB 4BTXA 3AMOA 3JUMA 3CPW2 3EN1B 3N9HA 4O8SA 1K28A 1BSCA 4X2HA 2W2CA 3NBRA 4N6MA 2CW9A 1IQXA 2Y73A 1JBSA 2XH9A 3DGLA 3RGRA 2K0MA 4HM5B 5KP1A 3CSQA 1PY3A 1U5OA 1WMPA 3MHEA 5STDA 3SYUA 1R4CA 3AGNA 2E2VA 4U13A 3S29A 4WYKA 2XFTA 3LTCA 4GHOA 4XDWA 3V92A 1GSPA 1V74A 4BIRA 3CMA3 4HM8B 2IMJA 4KVHA 2KAAA 2O3OA
chains in the Genus database with same CATH topology
3MG2A 5CLKA 1AR0A 4KFEA 2KXGA 5AIHA 3PCSA 4FMDA 4R9KA 1FGQA 5KP4A 1O7HB 3S67A 3WMDA 3K7CA 2GU1A 3F8XA 1O2FA 4NREA 2CFWA 1GLCF 3LTBA 5D83A 3FG3A 1UUVB 3HIGA 3CC43 3SEDA 4RNYA 2XGNA 4XB5A 2OQEC 1JV2B 5IF6A 4XDVA 1K734 2HMKB 2LQVA 1AX3A 5ELJA 3ER7A 2W9PA 2W9QA 1T5YA 5IG0A 1YJW3 4XBXA 2WOFA 3X42A 1MOLA 1PFPA 3UL5A 1UUWB 2XGLA 3VGNA 5BVBA 4OK0A 4R9LA 2F86B 3NQYA 4HZBB 1VQ73 2QEX3 2F99A 2HSIA 1O7WB 3MYTA 4R80A 3A76A 4KFDA 3OX9A 3WODG 3DGOA 1ISKA 3HK4A 4J9AA 1VQ53 3JUQA 3JUOA 2CG1A 4EYCA 2BT3A 3FF0A 1CEWI 1Q814 4XM4A 1E3VA 5AYSC 3DMCA 3K63A 1STDA 3GZXB 1N8R4 3K0ZA 1W02A 1VQK3 3UB1A 1QJGA 2B44A 5B0HA 1WMOA 3G8ZA 3RDEA 5AEWB 1RKYA 4BH5A 4LXCA 4WHAA 2D42A 3F14A 3QK9A 1D6UA 1N5HA 1US1A 1TFOA 1K41A 1OPYA 2WOHA 3Q90A 3KSPA 4R1KA 1LNHA 2SBLA 2GU3A 2JQ5A 1AVKA 3MSOA 5HGRA 4R4KA 3CC73 1VQ93 4GB5A 3HZPA 2B1XB 3SOYA 4N6UA 4HZ9B 3KIIA 4FMCA 3KSED 3CCV3 3BB9A 3JUNA 5TGNA 2W56A 4EV5A 1A2KA 3T8UA 5EEOA 3X40A 3DUKA 4MMZB 5AYRB 1PU4A 2CFDA 3I553 1OGZA 4OUQA 1DMQA 1JB2A 1FGMA 1FGRA 2GEXA 1TUHA 3MG1A 4CCVA 3H3HA 1FA3A 4K1VA 5KP3A 3CXC2 2XSOB 4WWUC 5AIFA 1GY5A 4RBNA 1KQS2 4NHFA 2W0QA 2GXFA 2O9UX 5KVPA 1W6GA 5IERA 3NBJA 1QWYA 3CCM3 3O8YA 3T0UA 1W01A 2MP0B 1OHSA 2CFLA 5BXQA 3BNCA 3NUVA 1GLEF 2OTL3 2Z6BA 4IIAA 3I563 3IT5A 1AVLA 1Q42A 1STFI 1RJOA 1IV9A 1WMNA 3BNDA 3X3XA 1S5AA 1W4NA 3FLJA 3N8BA 4EXRA 1ZX2A 5DREA 3D9RA 4LMIA 2YFIB 1S723 4RNZA 3STDA 3CPOA 1VQM3 1DYUA 3PYJA 2XF3A 2E2UA 3GZYB 3U97A 1QAKA 2XFSA 3LZAA 3G4S3 2P0XA 4HJLB 3WDGB 1OF5B 5D81A 1TP6A 3LOYA 3OWUA 2GBXB 4HM6B 1IVUA 4I4KA 1IQ8A 1W2ZA 3LT8A 1YVBI 2CWVA 3ECFA 3HX8A 3BNEA 1FGOA 1DMMA 3OW22 1N9JA 2ZDJA 2XR8B 4BTYA 2OQEA 3H51A 3FCSB 2Q07A 4HM4B 1W5ZA 1YJN3 5D82A 2LYXA 4G1MB 5AI1A 3F7XA 1JB5A 2P38A 2GEYA 3SXXA 5JPPA 3EC9A 1LVNA 1JKGA 3F9SA 1Q40A 3WA3A 1TFKA 2OOVC 1YIT3 3UJMA 3L0RA 3WOFB 3G0KA 1DMNA 1QMAA 2CHCA 2C10A 3FG4A 4N3VA 2P05A 5IENA 1SQWA 1E3RA 2RFRA 1GGRA 1ROAA 5JBSA 2BMRB 1CQSA 1RN7A 1W7CA 3CCJ3 4FCZA 2HMMB 3MPHA 3J7Yd 4LZIA 4HM2B 1SJWA 2YFJB 3IT7A 3NHXA 2L4VA 5IEOA 2F98A 4ZM8A 4O3VA 2GBWB 1W2B2 4HM0B 1W6YA 3NYYA 1C7HA 3DGMA 4L8PA 2CC3A 3X3YA 5EVHA 3LTAA 4HBRA 3SLUA 4FMAA 1N8QA 2M7OA 4KZ1A 1A67A 3QRDA 3OWYA 4L7KA 1IU7A 1QALA 1DVDA 3CNMA 1EQKA 1YHQ3 3M8CA 5IG3A 3WA2X 1Z1SA 3CME3 3FGYA 4EBGA 3K9MC 1N5PA 3I0YA 1VQO3 3NV0B 2FNQA 1GYBA 3GAXA 3BNBA 1F8NA 3NQZA 1EKMA 1IT7A 4QPBA 1L5GB 2RCDA 2KCDA 3CCQ3 3ROBA 3NM2A 3X3ZA 1VQ43 1GLAF 1QAFA 5LC6A 2CH9A 5A0OB 1F3ZA 1JN5B 5AIIA 2Z77A 3HI7A 4JF8A 2PNCA 2XSHB 3OXAA 4FCJA 2RGQA 4Q53A 1WQLB 2HMLB 4HYZA 3KZTA 1KC84 1F3GA 2HMOB 3DZLA 2W6JH 3VF1A 1LOXA 2BHMA 2FGTA 3V98A 1W6CA 3D3LA 4TX4A 4AKYA 1NU3A 2F3GA 2YX9A 4MEIA 4STDA 2INXA 3CNXA 2OWPA 1HU9A 3HIIA 4XBYA 3FZWA 1M904 1Q824 1IVWA 6STDA 1FUWA 2CFKA 1UI8A 3KN4A 1O7GB 3CCL3 4HKVB 3KFQC 3EBYA 1VZZA 1DVCA 1IVVA 5ELUA 1OCVA 2CWTA 5IG5A 3PZWA 2IUJA 2WGQA 4L8OA 3OWSA 1ULIB 4WFOA 3U1WA 2QA43 1OGXA 1YGEA 1D6ZA 4QWTA 4FCMA 3VSYA 1EA2A 3DM8A 3IJEB 1GY7A 2IUKA 3CCS3 1M1K4 1E97A 1BUQA 4J8TA 1O7PB 4JRFA 3DGNA 2BNGA 1VQP3 1M1XB 1OH0A 1U8CB 3OV4A 2OOVA 3EE1A 4HVNA 3X41A 2QIYA 2FXTA 1UW1A 1GLBF 2PZVA 4EV2A 3LYGA 1VQN3 1IDPA 3TUFB 3MWZA 1VQ83 1FGTA 3GZBA 3V99A 3EBTA 4N6LA 3AMOB 4OVMA 3LT9A 4H3UA 3FH1A 3IPTA 2QGUA 3EJVA 2MC8A 1NWWA 2E2TA 2BO9B 3FKAA 3LXUX 3LMLA 1IK3A 1HKXA 4HM1B 1G96A 1OF5A 3G16A 3N54B 1TIJA 3KE7A 4ORLA 3FSDA 4WYKB 4EC6A 2Y74A 1O7NB 3B7CA 3Q2PA 2A15A 4X2OA 1Q7Y4 4HM3B 2C11A 4K61A 1OHPA 3F7SA 2BMOB 3S28A 4CDLA 2MF7A 2B0PA 4PEJA 3PXMA 3FG1A 4N6OB 1NB3I 1A2VA 1UI7A 2OCTA 3B4PA 4MJDA 3WOEB 1W00A 3F8HA 1NB5I 3CU3A 2JDIH 2STDA 2WGOA 3CCU3 1JJ22 2OTJ3 1ULJB 2R4IA 4N6V0 1SPUA 3DY5A 1GLDF 3LTDA 2W03A 4LEHA 3NX0A 4FMBA 5FGOA 1GD4A 4FR9A 3CC23 1ASKA 4XBTA 2B24B 1K9M4 3CCR3 4WP5A 2CWUA 2CK3H 3PCRA 1IV7A 4ZYBA 4H61A 3LH4A 4JBWM 1A90A 1MNLA 2B13A 5CK6A 3DXOA 4MMYB 3KKGA 5CF1A 3SX1A 5FW5A 5IW9A 4AKZA 1EG9B 4QP5A 4MMXB 4GL6A 1K8A4 1IQYA 3PS8A 1CYUA 3EB8A 3TDGA 1M9GA 1KD14 1D6YA 3JVCA 3UL6A 1KSIA 2V1LA 2XRXB 2RSXA 3S27A 5AIGA 3NV0A 2XEPA 4IT7A 3Q1CA 3JUPA 2P0MA 2I9WA 4KFFA 3PGBA 1IT8A 1WNHA 1OUNA 5JPUA 3BLZA 1YI23 5G2GA 3MKIA 1SIIA 1NDOB 4BTWA 1GPRA 1LXEA 1SIHA 1AV4A 2IA7A 3MG3A 1JN5A 1YJ93 2K54A 3CD63 5LC7A 1GS3A 4LGQA 5I97A 4RZMA 1OACA 1RRHA 1RRLA 1KWIA 2BMQB 3EF8A 4O2HA 4AEQA 2W56B 3NM7A 2CFGA 1JB4A 3S5CA 1VQ63 1CYVA 3IMAB 5IEPA 2YFLB 2D1WA 3OURB 1GD3A 1J2BA 2ML6A 2P09A 2KRTA 1Y4KA 3E99A 1JNQA 3NXJA 4K1UA 3F40A 5AEUB 3EX9A 1O7MB 4N6NB 4K90B 3GWRA 5CF2A 1IVXA 1GY6A 5EQLA 3G713 2W04A 5DRVA 3EQQB 3RGAA 4IPBA 4LSOA 4O02B 3EHCA 3FF2A 3ALAA 2UX0A 1ROVA 2ZL8A 3UZ0B 1YIJ3 2HMNB 3B8LA 3SOAA 1OHOA 1Q864 5IG4A 2CG0A 2WO0A 2Z7AA 3UNLA 1JRQA 3NBBA 1NO3A 1NJI4 3EN8A 2Z76A 3B4OA 3T8NA 3K5TA 3GRDA 4N6TA 3SVAA 1N9EA 3GZRA 3CCE3 2CIUA 3G6E3 1VQL3 1WTHA 7STDA 4HM7B 2ML5A 2GPRA 1TU5A 1QVG2 1QVF2 1JKGB 5CXOA 1ZO2A 8CHOA 1Q40B 2HMJB 2CKFB 4BTXA 3AMOA 3JUMA 3CPW2 3EN1B 3N9HA 4O8SA 1K28A 4X2HA 2W2CA 3NBRA 4N6MA 2CW9A 1IQXA 2Y73A 2XH9A 3DGLA 3RGRA 2K0MA 4HM5B 5KP1A 3CSQA 1U5OA 5STDA 1WMPA 3MHEA 1R4CA 2E2VA 4U13A 3S29A 4WYKA 2XFTA 3LTCA 4XDWA 3V92A 3CMA3 1V74A 4HM8B 2IMJA 4KVHA 2O3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B44 A;  4RNZ A;  1GLA F;  5B0H A;  4BH5 A;  4LXC A;  1F3Z A;  1GLD F;  3NYY A;  2GPR A;  2HSI A;  1GGR A;  2GU1 A;  1GLB F;  1O2F A;  3OUR B;  3SLU A;  5KVP A;  1GLC F;  3UZ0 B;  3TUF B;  1QWY A;  2MP0 B;  2B0P A;  4RNY A;  1F3G A;  1GLE F;  3CSQ A;  4ZYB A;  3IT7 A;  4JBW M;  2B13 A;  1AX3 A;  1GPR A;  3IT5 A;  4QPB A;  2F3G A;  4QP5 A; 
#chains in the Genus database with same CATH topology
 1B27 A;  3MG2 A;  5CLK A;  1RTU A;  1AR0 A;  4KFE A;  2KXG A;  1I2F A;  5AIH A;  1BIR A;  3PCS A;  4FMD A;  4R9K A;  1FGQ A;  5KP4 A;  1O7H B;  3S67 A;  3WMD A;  3K7C A;  2GU1 A;  1BGS A;  1AQZ A;  3F8X A;  1O2F A;  1RCK A;  4NRE A;  2CFW A;  1GLC F;  3LTB A;  2L1S A;  5D83 A;  3FG3 A;  1UUV B;  3HIG A;  2BU4 A;  3SED A;  3CC4 3;  4RNY A;  2XGN A;  4XB5 A;  2OQE C;  1JV2 B;  5IF6 A;  4XDV A;  1UCI A;  1K73 4;  2HMK B;  2LQV A;  1YNV X;  1AX3 A;  5ELJ A;  3ER7 A;  1BRI A;  1EUI C;  2W9Q A;  2W9P A;  1T5Y A;  5IG0 A;  1YJW 3;  4XBX A;  1RGF A;  2WOF A;  3X42 A;  1BNS A;  1MOL A;  1PFP A;  1LOV A;  3UL5 A;  1UUW B;  2XGL A;  3VGN A;  5BVB A;  4OK0 A;  4R9L A;  2F86 B;  1EQK A;  3NQY A;  4HZB B;  1VQ7 3;  2QEX 3;  1YVS A;  2F99 A;  2HSI A;  1O7W B;  3MYT A;  4R80 A;  1BUJ A;  3A76 A;  2AAD A;  4KFD A;  3AGO A;  3OX9 A;  3WOD G;  3DGO A;  1ISK A;  3HK4 A;  4J9A A;  1VQ5 3;  3JUQ A;  3WHO A;  3JUO A;  2CG1 A;  4EYC A;  2BT3 A;  1T2H A;  1CEW I;  3FF0 A;  1Q81 4;  4XM4 A;  7GSP A;  1E3V A;  5AYS C;  1BRJ A;  2SAR A;  3DMC A;  3K63 A;  1STD A;  3GZX B;  1N8R 4;  1JBR A;  3K0Z A;  1W02 A;  4HOH A;  1BAO A;  1BSD A;  1I70 A;  1VQK 3;  3UB1 A;  1QJG A;  1UDI I;  2B44 A;  5B0H A;  1WMO A;  3G8Z A;  3RDE A;  5AEW B;  1MWR A;  1RKY A;  4BH5 A;  6GSP A;  4LXC A;  4WHA A;  1TRQ A;  1A2P A;  2D42 A;  3F14 A;  3QK9 A;  1D6U A;  1N5H A;  3ZG0 A;  3HOH A;  1US1 A;  1TFO A;  2AAE A;  1K41 A;  1OPY A;  2WOH A;  3Q90 A;  3KSP A;  4R1K A;  1LNH A;  2SBL A;  2GU3 A;  2JQ5 A;  1X1W A;  1AVK A;  3MSO A;  5HGR A;  4R4K A;  3CC7 3;  1VQ9 3;  1EEJ A;  3HZP A;  4GB5 A;  8RNT A;  2B1X B;  3SOY A;  4N6U A;  4HZ9 B;  3KII A;  1RGH A;  1HYF A;  1MWT A;  3KSE D;  4FMC A;  3CCV 3;  3BB9 A;  3JUN A;  5TGN A;  2W56 A;  4EV5 A;  1A2K A;  3T8U A;  5EEO A;  3X40 A;  3DUK A;  4MMZ B;  5AYR B;  1PU4 A;  2CFD A;  3I55 3;  1OGZ A;  4OUQ A;  1DMQ A;  1JB2 A;  1FGM A;  1FGR A;  1UCK A;  1TUH A;  2GEX A;  3MG1 A;  4CCV A;  3H3H A;  1FA3 A;  4K1V A;  5KP3 A;  3CXC 2;  2XSO B;  4WWU C;  5AIF A;  1GY5 A;  1UGH I;  3AHS A;  1BAN A;  4RBN A;  1KQS 2;  4NHF A;  2W0Q A;  2KF6 A;  2GXF A;  2O9U X;  4BL2 A;  5KVP A;  1W6G A;  5IER A;  2H0G A;  3NBJ A;  2F4Y A;  1QWY A;  3CCM 3;  3O8Y A;  3T0U A;  2J8X B;  1W01 A;  2MP0 B;  1OHS A;  2CFL A;  4CJN A;  5BXQ A;  3BNC A;  3NUV A;  1GLE F;  2OTL 3;  2RBI A;  2Z6B A;  1B3S A;  1LRA A;  4IIA A;  3I56 3;  2ZHX B;  3IT5 A;  1AVL A;  1G02 A;  1Q42 A;  1GOY A;  1IV9 A;  1RJO A;  1STF I;  1WMN A;  1S5A A;  1W4N A;  3BND A;  3FLJ A;  3N8B A;  3X3X A;  4EXR A;  1ZX2 A;  1LNI A;  5DRE A;  3D9R A;  4LMI A;  2YFI B;  1S72 3;  4RNZ A;  3STD A;  1BNJ A;  3CPO A;  9RNT A;  1VQM 3;  1I2G A;  1LOW A;  2C4B A;  1DYU A;  3PYJ A;  2XF3 A;  2E2U A;  3GZY B;  3U97 A;  1QAK A;  3GSP A;  2XFS A;  3LZA A;  3G4S 3;  1C54 A;  2P0X A;  4HJL B;  3WDG B;  1OF5 B;  5D81 A;  1TP6 A;  3LOY A;  3OWU A;  2GBX B;  4HM6 B;  5FGO A;  1IVU A;  4I4K A;  1IQ8 A;  1W2Z A;  3LT8 A;  1FUS A;  1YVB I;  2CWV A;  3ECF A;  3HX8 A;  2F5M A;  3BNE A;  1FGO A;  1DMM A;  3OW2 2;  1N9J A;  2ZDJ A;  2XR8 B;  1MGR A;  2OQE A;  4BTY A;  3H51 A;  3FCS B;  2Q07 A;  4HM4 B;  1W5Z A;  1YJN 3;  5D82 A;  2LYX A;  4G1M B;  5AI1 A;  3F7X A;  1JB5 A;  2P38 A;  2GEY A;  3SXX A;  5JPP A;  3EC9 A;  1LVN A;  1JKG A;  3F9S A;  1MGW A;  1Q40 A;  1TFK A;  1B2S A;  3WA3 A;  2OOV C;  1YIT 3;  3UJM A;  3L0R A;  3WOF B;  5HOH A;  3G0K A;  1DMN A;  1QMA A;  2CHC A;  2C10 A;  3FG4 A;  2F5W A;  4N3V A;  2P05 A;  5IEN A;  1SQW A;  1E3R A;  2RFR A;  1RLS A;  1GGR A;  1ROA A;  5JBS A;  2BMR B;  1CQS A;  1RN7 A;  1W7C A;  3CCJ 3;  4FCZ A;  2HMM B;  3MPH A;  5M1A A;  3J7Y d;  1RSN A;  1TRP A;  1BSE A;  1RNT A;  4LZI A;  4HM2 B;  1SJW A;  2YFJ B;  4J5G A;  3IT7 A;  4CPK A;  3NHX A;  2L4V A;  1B2M A;  5IEO A;  1GOV A;  2F98 A;  4ZM8 A;  4O3V A;  2GBW B;  1W2B 2;  4HM0 B;  1W6Y A;  3NYY A;  1VQQ A;  1B21 A;  1C7H A;  3D4A A;  3DGM A;  4L8P A;  1T2I A;  1BNR A;  2CC3 A;  3X3Y A;  1RGK A;  5EVH A;  3LTA A;  4HBR A;  1I0V A;  3SLU A;  1TJD A;  4FMA A;  1N8Q A;  2M7O A;  4KZ1 A;  1A67 A;  3QRD A;  3OWY A;  4L7K A;  1IU7 A;  1QAL A;  1DVD A;  1LQM B;  3CNM A;  1GMR A;  3KCH A;  3M8C A;  5IG3 A;  3WA2 X;  1Z1S A;  3CME 3;  1YHQ 3;  1UUG B;  3FGY A;  4EBG A;  3K9M C;  1N5P A;  1DET A;  3I0Y A;  1VQO 3;  3NV0 B;  2FNQ A;  1GOU A;  1GYB A;  3GAX A;  5RNT A;  3BNB A;  1F8N A;  3NQZ A;  1EKM A;  1IT7 A;  4QPB A;  1L5G B;  2KF5 A;  2RCD A;  2KCD A;  3CCQ 3;  3ROB A;  3NM2 A;  3X3Z A;  1VQ4 3;  1V57 A;  1GLA F;  1BNE A;  1QAF A;  5LC6 A;  2CH9 A;  3WR2 A;  5A0O B;  1F3Z A;  1JN5 B;  5AII A;  2Z77 A;  3HI7 A;  1BNF A;  4JF8 A;  2PNC A;  2XSH B;  3OXA A;  1GMP A;  4FCJ A;  1X1X A;  2RGQ A;  4Q53 A;  1WQL B;  2HML B;  5M18 A;  4HYZ A;  3KZT A;  1KC8 4;  1F3G A;  2HMO B;  3DZL A;  2W6J H;  3VF1 A;  1LOX A;  4ILF A;  3D5G A;  2BHM A;  2FGT A;  4I5Q A;  5GSP A;  2UGI A;  1W6C A;  4GSP A;  3D3L A;  4TX4 A;  3V98 A;  4AKY A;  1NU3 A;  2F3G A;  2YX9 A;  4MEI A;  4STD A;  2INX A;  3CNX A;  1BRK A;  2OWP A;  1DE3 A;  1HU9 A;  3HII A;  1BRS A;  3FZW A;  4XBY A;  1M90 4;  1Q82 4;  1IVW A;  2K3D A;  6STD A;  1X1Y A;  1RMS A;  1FZU A;  2CFK A;  1FUW A;  1JZO A;  1UI8 A;  3KN4 A;  1O7G B;  3CCL 3;  4HKV B;  3KFQ C;  3DH2 A;  2GSP A;  3EBY A;  1Q9E A;  1VZZ A;  1DVC A;  1IVV A;  5ELU A;  5G1L A;  1OCV A;  2CWT A;  5IG5 A;  3PZW A;  2IUJ A;  2WGQ A;  4L8O A;  4BU4 A;  3OWS A;  3BU4 A;  1ULI B;  4WFO A;  3U1W A;  1Q7H A;  1OGX A;  2QA4 3;  1YGE A;  1D6Z A;  4QWT A;  4FCM A;  1BRH A;  3VSY A;  1EA2 A;  1X1U A;  3DM8 A;  3IJE B;  1GY7 A;  2IUK A;  3CCS 3;  4LYL B;  1M1K 4;  1E97 A;  1RGL A;  4J8T A;  1O7P B;  4JRF A;  1BUQ A;  3DGN A;  2BNG A;  1VQP 3;  1M1X B;  1OH0 A;  1U8C B;  3OV4 A;  2OOV A;  3EE1 A;  4HVN A;  2KF4 A;  3X41 A;  2QIY A;  1BOX A;  2FXT A;  1UW1 A;  1GLB F;  1BVI A;  2PZV A;  4EV2 A;  1SAR A;  1BSB A;  3LYG A;  1VQN 3;  1IDP A;  3TUF B;  2BIR A;  3MWZ A;  1VQ8 3;  1FGT A;  3GZB A;  1I8V A;  3V99 A;  3EBT A;  4N6L A;  3AMO B;  4OVM A;  3LT9 A;  4H3U A;  3FH1 A;  3IPT A;  4EW5 A;  1TTO A;  2QGU A;  3EJV A;  2MC8 A;  1NWW A;  2E2T A;  2BO9 B;  4J5K A;  3FKA A;  1R4Y A;  3LXU X;  3LML A;  1IK3 A;  1HKX A;  4HM1 B;  1G96 A;  1RDS A;  1OF5 A;  3G16 A;  1G0T A;  1UGI A;  3N54 B;  1TIJ A;  3KE7 A;  4ORL A;  1YGW A;  3FSD A;  4WYK B;  4EC6 A;  2Y74 A;  1O7N B;  5BIR A;  5BU4 A;  3B7C A;  3Q2P A;  2A15 A;  4X2O A;  5M19 A;  1Q7Y 4;  4HM3 B;  2C11 A;  3D5I A;  4K61 A;  1OHP A;  3F7S A;  2HOH A;  2BMO B;  3S28 A;  4CDL A;  2IYJ A;  2MF7 A;  1UCL A;  2B0P A;  2R41 A;  1RGG A;  4PEJ A;  1RGC A;  1BRN L;  3PXM A;  1LQG C;  3FG1 A;  1NB3 I;  1V58 A;  1A2V A;  4N6O B;  1UI7 A;  2OCT A;  3B4P A;  4MJD A;  1CH0 A;  1W00 A;  3F8H A;  3WOE B;  1NB5 I;  1RGA A;  3CU3 A;  2JDI H;  2STD A;  2WGO A;  3CCU 3;  1JJ2 2;  2CX0 A;  2OTJ 3;  1ULJ B;  7RNT A;  2R4I A;  4DKI A;  1I0X A;  4N6V 0;  1SPU A;  3DY5 A;  1GLD F;  1MWU A;  2W03 A;  3LTD A;  3NX0 A;  4FMB A;  4LEH A;  1GD4 A;  1LOY A;  4FR9 A;  4RNT A;  1ASK A;  3RNT A;  3CC2 3;  1RHL A;  4XBT A;  2B24 B;  1K9M 4;  1BNI A;  1RGE A;  3CCR 3;  4WP5 A;  2CWU A;  2CK3 H;  3PCR A;  1AY7 A;  1IV7 A;  1B2Z A;  4ZYB A;  4H61 A;  3LH4 A;  4JBW M;  1A90 A;  1MNL A;  2B13 A;  1FUT A;  5CK6 A;  3DXO A;  3ZFZ A;  2F56 A;  4MMY B;  3KKG A;  5CF1 A;  3SX1 A;  5FW5 A;  2ZA4 A;  5IW9 A;  4AKZ A;  1EG9 B;  6RNT A;  4QP5 A;  1I3F A;  1PYL A;  4MMX B;  4GL6 A;  1K8A 4;  1IQY A;  3PS8 A;  1CYU A;  3EB8 A;  3TDG A;  1M9G A;  1KD1 4;  1D6Y A;  3JVC A;  3UL6 A;  1KSI A;  2V1L A;  1BU4 A;  2XRX B;  2RSX A;  3S27 A;  3URP A;  5AIG A;  3NV0 A;  2XEP A;  4IT7 A;  1RN4 A;  1RN1 A;  2CX1 A;  3JUP A;  2P0M A;  3Q1C A;  2H0H A;  2I9W A;  3PGB A;  1IT8 A;  4KFF A;  4BL3 A;  1IYY A;  1WNH A;  1FYS A;  1OUN A;  5JPU A;  3BLZ A;  1YI2 3;  3Q3F A;  3MKI A;  5G2G A;  1SII A;  1NDO B;  1NNV A;  4BTW A;  1GPR A;  1LXE A;  1SIH A;  1AV4 A;  2IA7 A;  2UUG C;  1JN5 A;  3MG3 A;  1YJ9 3;  2K54 A;  1JBT A;  4NPB A;  3CD6 3;  5LC7 A;  1GS3 A;  4LGQ A;  5I97 A;  4RZM A;  1OAC A;  1RRH A;  1RRL A;  1KWI A;  2BMQ B;  3DGY A;  4KT3 B;  3EF8 A;  4O2H A;  4AEQ A;  2W56 B;  1ZS7 A;  3NM7 A;  2CFG A;  1JB4 A;  3S5C A;  1VQ6 3;  1CYV A;  3IMA B;  5IEP A;  2YFL B;  2D1W A;  3OUR B;  1GD3 A;  1UCJ A;  1J2B A;  2ML6 A;  2P09 A;  2KRT A;  1Y4K A;  1B2X A;  3E99 A;  2IY2 A;  1BNG A;  1JZD A;  1ZGX A;  1JNQ A;  3NXJ A;  4K1U A;  3F40 A;  5AEU B;  2H0I A;  1BSA A;  3EX9 A;  5G1K A;  1O7M B;  1I3I A;  4N6N B;  1FW7 A;  1RCL A;  4K90 B;  3GWR A;  1GMQ A;  1T3B A;  2RNT A;  5CF2 A;  1B20 A;  1IVX A;  1B2U A;  1GY6 A;  5EQL A;  3G71 3;  2W04 A;  3BIR A;  5DRV A;  3EQQ B;  3RGA A;  1MWS A;  4IPB A;  4LSO A;  4O02 B;  3EHC A;  3FF2 A;  3ALA A;  2UX0 A;  1ROV A;  2ZL8 A;  3UZ0 B;  1YIJ 3;  2HMN B;  3B8L A;  3SOA A;  1OHO A;  1Q86 4;  5IG4 A;  2CG0 A;  2WO0 A;  3A5E A;  2Z7A A;  3UNL A;  1JRQ A;  3NBB A;  1NO3 A;  1NJI 4;  3EN8 A;  2Z76 A;  3B4O A;  2KF3 A;  3T8N A;  3ZG5 A;  3AHW A;  1I2E A;  3K5T A;  3GRD A;  4N6T A;  1BRG A;  1N9E A;  3SVA A;  3GZR A;  3CCE 3;  1RNB A;  2CIU A;  3G6E 3;  1VQL 3;  1WTH A;  7STD A;  4HM7 B;  2ML5 A;  2GPR A;  1TU5 A;  1QVG 2;  4HAA A;  1QVF 2;  1JKG B;  5CXO A;  1ZO2 A;  1HZ1 A;  1Q40 B;  2HMJ B;  3D79 A;  8CHO A;  2CKF B;  4BTX A;  3AMO A;  3JUM A;  3CPW 2;  3EN1 B;  3N9H A;  4O8S A;  1K28 A;  1BSC A;  4X2H A;  2W2C A;  3NBR A;  4N6M A;  2CW9 A;  1IQX A;  2Y73 A;  1JBS A;  2XH9 A;  3DGL A;  3RGR A;  2K0M A;  4HM5 B;  5KP1 A;  3CSQ A;  1PY3 A;  1U5O A;  1WMP A;  3MHE A;  5STD A;  3SYU A;  1R4C A;  3AGN A;  2E2V A;  4U13 A;  3S29 A;  4WYK A;  2XFT A;  3LTC A;  4GHO A;  4XDW A;  3V92 A;  1GSP A;  1V74 A;  4BIR A;  3CMA 3;  4HM8 B;  2IMJ A;  4KVH A;  2KAA A;  2O3O A; 
#chains in the Genus database with same CATH homology
 3MG2 A;  5CLK A;  1AR0 A;  4KFE A;  2KXG A;  5AIH A;  3PCS A;  4FMD A;  4R9K A;  1FGQ A;  5KP4 A;  1O7H B;  3S67 A;  3WMD A;  3K7C A;  2GU1 A;  3F8X A;  1O2F A;  4NRE A;  2CFW A;  1GLC F;  3LTB A;  5D83 A;  3FG3 A;  1UUV B;  3HIG A;  3CC4 3;  3SED A;  4RNY A;  2XGN A;  4XB5 A;  2OQE C;  1JV2 B;  5IF6 A;  4XDV A;  1K73 4;  2HMK B;  2LQV A;  1AX3 A;  5ELJ A;  3ER7 A;  2W9P A;  2W9Q A;  1T5Y A;  5IG0 A;  1YJW 3;  4XBX A;  2WOF A;  3X42 A;  1MOL A;  1PFP A;  3UL5 A;  1UUW B;  2XGL A;  3VGN A;  5BVB A;  4OK0 A;  4R9L A;  2F86 B;  3NQY A;  4HZB B;  1VQ7 3;  2QEX 3;  2F99 A;  2HSI A;  1O7W B;  3MYT A;  4R80 A;  3A76 A;  4KFD A;  3OX9 A;  3WOD G;  3DGO A;  1ISK A;  3HK4 A;  4J9A A;  1VQ5 3;  3JUQ A;  3JUO A;  2CG1 A;  4EYC A;  2BT3 A;  3FF0 A;  1CEW I;  1Q81 4;  4XM4 A;  1E3V A;  5AYS C;  3DMC A;  3K63 A;  1STD A;  3GZX B;  1N8R 4;  3K0Z A;  1W02 A;  1VQK 3;  3UB1 A;  1QJG A;  2B44 A;  5B0H A;  1WMO A;  3G8Z A;  3RDE A;  5AEW B;  1RKY A;  4BH5 A;  4LXC A;  4WHA A;  2D42 A;  3F14 A;  3QK9 A;  1D6U A;  1N5H A;  1US1 A;  1TFO A;  1K41 A;  1OPY A;  2WOH A;  3Q90 A;  3KSP A;  4R1K A;  1LNH A;  2SBL A;  2GU3 A;  2JQ5 A;  1AVK A;  3MSO A;  5HGR A;  4R4K A;  3CC7 3;  1VQ9 3;  4GB5 A;  3HZP A;  2B1X B;  3SOY A;  4N6U A;  4HZ9 B;  3KII A;  4FMC A;  3KSE D;  3CCV 3;  3BB9 A;  3JUN A;  5TGN A;  2W56 A;  4EV5 A;  1A2K A;  3T8U A;  5EEO A;  3X40 A;  3DUK A;  4MMZ B;  5AYR B;  1PU4 A;  2CFD A;  3I55 3;  1OGZ A;  4OUQ A;  1DMQ A;  1JB2 A;  1FGM A;  1FGR A;  2GEX A;  1TUH A;  3MG1 A;  4CCV A;  3H3H A;  1FA3 A;  4K1V A;  5KP3 A;  3CXC 2;  2XSO B;  4WWU C;  5AIF A;  1GY5 A;  4RBN A;  1KQS 2;  4NHF A;  2W0Q A;  2GXF A;  2O9U X;  5KVP A;  1W6G A;  5IER A;  3NBJ A;  1QWY A;  3CCM 3;  3O8Y A;  3T0U A;  1W01 A;  2MP0 B;  1OHS A;  2CFL A;  5BXQ A;  3BNC A;  3NUV A;  1GLE F;  2OTL 3;  2Z6B A;  4IIA A;  3I56 3;  3IT5 A;  1AVL A;  1Q42 A;  1STF I;  1RJO A;  1IV9 A;  1WMN A;  3BND A;  3X3X A;  1S5A A;  1W4N A;  3FLJ A;  3N8B A;  4EXR A;  1ZX2 A;  5DRE A;  3D9R A;  4LMI A;  2YFI B;  1S72 3;  4RNZ A;  3STD A;  3CPO A;  1VQM 3;  1DYU A;  3PYJ A;  2XF3 A;  2E2U A;  3GZY B;  3U97 A;  1QAK A;  2XFS A;  3LZA A;  3G4S 3;  2P0X A;  4HJL B;  3WDG B;  1OF5 B;  5D81 A;  1TP6 A;  3LOY A;  3OWU A;  2GBX B;  4HM6 B;  1IVU A;  4I4K A;  1IQ8 A;  1W2Z A;  3LT8 A;  1YVB I;  2CWV A;  3ECF A;  3HX8 A;  3BNE A;  1FGO A;  1DMM A;  3OW2 2;  1N9J A;  2ZDJ A;  2XR8 B;  4BTY A;  2OQE A;  3H51 A;  3FCS B;  2Q07 A;  4HM4 B;  1W5Z A;  1YJN 3;  5D82 A;  2LYX A;  4G1M B;  5AI1 A;  3F7X A;  1JB5 A;  2P38 A;  2GEY A;  3SXX A;  5JPP A;  3EC9 A;  1LVN A;  1JKG A;  3F9S A;  1Q40 A;  3WA3 A;  1TFK A;  2OOV C;  1YIT 3;  3UJM A;  3L0R A;  3WOF B;  3G0K A;  1DMN A;  1QMA A;  2CHC A;  2C10 A;  3FG4 A;  4N3V A;  2P05 A;  5IEN A;  1SQW A;  1E3R A;  2RFR A;  1GGR A;  1ROA A;  5JBS A;  2BMR B;  1CQS A;  1RN7 A;  1W7C A;  3CCJ 3;  4FCZ A;  2HMM B;  3MPH A;  3J7Y d;  4LZI A;  4HM2 B;  1SJW A;  2YFJ B;  3IT7 A;  3NHX A;  2L4V A;  5IEO A;  2F98 A;  4ZM8 A;  4O3V A;  2GBW B;  1W2B 2;  4HM0 B;  1W6Y A;  3NYY A;  1C7H A;  3DGM A;  4L8P A;  2CC3 A;  3X3Y A;  5EVH A;  3LTA A;  4HBR A;  3SLU A;  4FMA A;  1N8Q A;  2M7O A;  4KZ1 A;  1A67 A;  3QRD A;  3OWY A;  4L7K A;  1IU7 A;  1QAL A;  1DVD A;  3CNM A;  1EQK A;  1YHQ 3;  3M8C A;  5IG3 A;  3WA2 X;  1Z1S A;  3CME 3;  3FGY A;  4EBG A;  3K9M C;  1N5P A;  3I0Y A;  1VQO 3;  3NV0 B;  2FNQ A;  1GYB A;  3GAX A;  3BNB A;  1F8N A;  3NQZ A;  1EKM A;  1IT7 A;  4QPB A;  1L5G B;  2RCD A;  2KCD A;  3CCQ 3;  3ROB A;  3NM2 A;  3X3Z A;  1VQ4 3;  1GLA F;  1QAF A;  5LC6 A;  2CH9 A;  5A0O B;  1F3Z A;  1JN5 B;  5AII A;  2Z77 A;  3HI7 A;  4JF8 A;  2PNC A;  2XSH B;  3OXA A;  4FCJ A;  2RGQ A;  4Q53 A;  1WQL B;  2HML B;  4HYZ A;  3KZT A;  1KC8 4;  1F3G A;  2HMO B;  3DZL A;  2W6J H;  3VF1 A;  1LOX A;  2BHM A;  2FGT A;  3V98 A;  1W6C A;  3D3L A;  4TX4 A;  4AKY A;  1NU3 A;  2F3G A;  2YX9 A;  4MEI A;  4STD A;  2INX A;  3CNX A;  2OWP A;  1HU9 A;  3HII A;  4XBY A;  3FZW A;  1M90 4;  1Q82 4;  1IVW A;  6STD A;  1FUW A;  2CFK A;  1UI8 A;  3KN4 A;  1O7G B;  3CCL 3;  4HKV B;  3KFQ C;  3EBY A;  1VZZ A;  1DVC A;  1IVV A;  5ELU A;  1OCV A;  2CWT A;  5IG5 A;  3PZW A;  2IUJ A;  2WGQ A;  4L8O A;  3OWS A;  1ULI B;  4WFO A;  3U1W A;  2QA4 3;  1OGX A;  1YGE A;  1D6Z A;  4QWT A;  4FCM A;  3VSY A;  1EA2 A;  3DM8 A;  3IJE B;  1GY7 A;  2IUK A;  3CCS 3;  1M1K 4;  1E97 A;  1BUQ A;  4J8T A;  1O7P B;  4JRF A;  3DGN A;  2BNG A;  1VQP 3;  1M1X B;  1OH0 A;  1U8C B;  3OV4 A;  2OOV A;  3EE1 A;  4HVN A;  3X41 A;  2QIY A;  2FXT A;  1UW1 A;  1GLB F;  2PZV A;  4EV2 A;  3LYG A;  1VQN 3;  1IDP A;  3TUF B;  3MWZ A;  1VQ8 3;  1FGT A;  3GZB A;  3V99 A;  3EBT A;  4N6L A;  3AMO B;  4OVM A;  3LT9 A;  4H3U A;  3FH1 A;  3IPT A;  2QGU A;  3EJV A;  2MC8 A;  1NWW A;  2E2T A;  2BO9 B;  3FKA A;  3LXU X;  3LML A;  1IK3 A;  1HKX A;  4HM1 B;  1G96 A;  1OF5 A;  3G16 A;  3N54 B;  1TIJ A;  3KE7 A;  4ORL A;  3FSD A;  4WYK B;  4EC6 A;  2Y74 A;  1O7N B;  3B7C A;  3Q2P A;  2A15 A;  4X2O A;  1Q7Y 4;  4HM3 B;  2C11 A;  4K61 A;  1OHP A;  3F7S A;  2BMO B;  3S28 A;  4CDL A;  2MF7 A;  2B0P A;  4PEJ A;  3PXM A;  3FG1 A;  4N6O B;  1NB3 I;  1A2V A;  1UI7 A;  2OCT A;  3B4P A;  4MJD A;  3WOE B;  1W00 A;  3F8H A;  1NB5 I;  3CU3 A;  2JDI H;  2STD A;  2WGO A;  3CCU 3;  1JJ2 2;  2OTJ 3;  1ULJ B;  2R4I A;  4N6V 0;  1SPU A;  3DY5 A;  1GLD F;  3LTD A;  2W03 A;  4LEH A;  3NX0 A;  4FMB A;  5FGO A;  1GD4 A;  4FR9 A;  3CC2 3;  1ASK A;  4XBT A;  2B24 B;  1K9M 4;  3CCR 3;  4WP5 A;  2CWU A;  2CK3 H;  3PCR A;  1IV7 A;  4ZYB A;  4H61 A;  3LH4 A;  4JBW M;  1A90 A;  1MNL A;  2B13 A;  5CK6 A;  3DXO A;  4MMY B;  3KKG A;  5CF1 A;  3SX1 A;  5FW5 A;  5IW9 A;  4AKZ A;  1EG9 B;  4QP5 A;  4MMX B;  4GL6 A;  1K8A 4;  1IQY A;  3PS8 A;  1CYU A;  3EB8 A;  3TDG A;  1M9G A;  1KD1 4;  1D6Y A;  3JVC A;  3UL6 A;  1KSI A;  2V1L A;  2XRX B;  2RSX A;  3S27 A;  5AIG A;  3NV0 A;  2XEP A;  4IT7 A;  3Q1C A;  3JUP A;  2P0M A;  2I9W A;  4KFF A;  3PGB A;  1IT8 A;  1WNH A;  1OUN A;  5JPU A;  3BLZ A;  1YI2 3;  5G2G A;  3MKI A;  1SII A;  1NDO B;  4BTW A;  1GPR A;  1LXE A;  1SIH A;  1AV4 A;  2IA7 A;  3MG3 A;  1JN5 A;  1YJ9 3;  2K54 A;  3CD6 3;  5LC7 A;  1GS3 A;  4LGQ A;  5I97 A;  4RZM A;  1OAC A;  1RRH A;  1RRL A;  1KWI A;  2BMQ B;  3EF8 A;  4O2H A;  4AEQ A;  2W56 B;  3NM7 A;  2CFG A;  1JB4 A;  3S5C A;  1VQ6 3;  1CYV A;  3IMA B;  5IEP A;  2YFL B;  2D1W A;  3OUR B;  1GD3 A;  1J2B A;  2ML6 A;  2P09 A;  2KRT A;  1Y4K A;  3E99 A;  1JNQ A;  3NXJ A;  4K1U A;  3F40 A;  5AEU B;  3EX9 A;  1O7M B;  4N6N B;  4K90 B;  3GWR A;  5CF2 A;  1IVX A;  1GY6 A;  5EQL A;  3G71 3;  2W04 A;  5DRV A;  3EQQ B;  3RGA A;  4IPB A;  4LSO A;  4O02 B;  3EHC A;  3FF2 A;  3ALA A;  2UX0 A;  1ROV A;  2ZL8 A;  3UZ0 B;  1YIJ 3;  2HMN B;  3B8L A;  3SOA A;  1OHO A;  1Q86 4;  5IG4 A;  2CG0 A;  2WO0 A;  2Z7A A;  3UNL A;  1JRQ A;  3NBB A;  1NO3 A;  1NJI 4;  3EN8 A;  2Z76 A;  3B4O A;  3T8N A;  3K5T A;  3GRD A;  4N6T A;  3SVA A;  1N9E A;  3GZR A;  3CCE 3;  2CIU A;  3G6E 3;  1VQL 3;  1WTH A;  7STD A;  4HM7 B;  2ML5 A;  2GPR A;  1TU5 A;  1QVG 2;  1QVF 2;  1JKG B;  5CXO A;  1ZO2 A;  8CHO A;  1Q40 B;  2HMJ B;  2CKF B;  4BTX A;  3AMO A;  3JUM A;  3CPW 2;  3EN1 B;  3N9H A;  4O8S A;  1K28 A;  4X2H A;  2W2C A;  3NBR A;  4N6M A;  2CW9 A;  1IQX A;  2Y73 A;  2XH9 A;  3DGL A;  3RGR A;  2K0M A;  4HM5 B;  5KP1 A;  3CSQ A;  1U5O A;  5STD A;  1WMP A;  3MHE A;  1R4C A;  2E2V A;  4U13 A;  3S29 A;  4WYK A;  2XFT A;  3LTC A;  4XDW A;  3V92 A;  3CMA 3;  1V74 A;  4HM8 B;  2IMJ A;  4KVH A;  2O3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...