2HSIA

Crystal structure of putative peptidase m23 from pseudomonas aeruginosa, new york structural genomics consortium
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
257
structure length
227
Chain Sequence
SFIMRLLNKPVPGGVAVVDLGEEGPPPRAFYQGKPVLVVREEGRRWIAVVGIPLSTKPGPQKLEVRAATGNHEERFSVGSKPEDLKRIERELAEQTAAYRRFSPGLPSNLMLDKPVDGPLSSPFPHSGLDFAVPAGTPIKAPAAGKVILIGDYFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIFIGAFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative peptidase M23
publication title Crystal Structure of M23 Peptidase from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 58
structure length 227
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18421 Peptidase_M23_N Peptidase family M23 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1590 Mainly Beta Sandwich Immunoglobulin-like Peptidoglycan hydrolase domains 2hsiA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 2hsiA02
4RNYA 5B0HA 2GU1A 1AX3A 3IT5A 4QPBA 2HSIA 3IT7A 1GLDF 1GLAF 1GLBF 4ZYBA 1GLEF 4BH5A 3TUFB 1F3GA 3SLUA 3NYYA 4QP5A 5KVPA 1F3ZA 2B13A 2F3GA 1GPRA 1QWYA 3UZ0B 2MP0B 2GPRA 2B44A 3CSQA 2B0PA 4JBWM 4LXCA 1O2FA 1GGRA 3OURB 4RNZA 1GLCF
chains in the Genus database with same CATH superfamily
1E28A 1QWNA 3BD5A 3FS9A 3X3FL 2Y36L 3ZDXE 5AYQA 4PPTA 3DJRA 3EKCA 4L18A 3C08L 3IPBA 1TDQA 4DKAA 3ZGHA 5K9QG 4B0MB 4MD4B 1JNNL 3K46A 1JZ3A 5JHDB 1N0LA 3DXAE 2AGJL 4PJGB 1T20B 4S0SD 5DQ9A 4HIEA 3IXAA 4JRXA 4BM7A 3RPIB 3HLKA 3RTQA 3VSTA 3WAKA 4KKAD 2J1XA 4F57L 2BVOA 2ZP8A 2MOQA 3IFLH 1TJGL 1ZA3B 5F7KC 3VFPB 1EX0A 1H5BB 3SD5A 3RL1A 2Z7UA 2IC2A 5D1ZB 2NNRA 5I76B 3HI5H 4MDRA 3II2A 3S98A 3LJ3A 1V3KA 4JRXD 3VNYA 3RTQD 1TKWB 1A8ZA 2V3FA 1A0QH 3GIZH 2XZCL 3NPSC 4XBPA 4KY2A 2LW3A 2FECI 4OB5H 2H3NA 1HQRA 3F62A 3NZUA 1CDHA 1JPFB 5EU7C 5AZ2H 5LBSL 4DIXA 5D6CB 5DR5H 4P2RA 4ABUA 1XSOA 1CDGA 1H8LA 1XWVA 2W60A 4PSPA 1Z3GL 2PYFB 2VITB 1TJIL 4B0MM 1YEHH 2O5YH 3REWA 2A6JA 1E6JH 4XCEB 2CWRA 1UQSB 3IF1A 5FW6A 1C7TA 4B95C 3RZCB 2ADYA 4HGKC 4D9RD 4P2RD 2C9AA 5FYJL 3ZU8A 5IKCB 1EZVX 3RA7L 2DWEA 4FLRA 3MFFA 4EOWH 1K3ZA 4YHKH 3C2AH 2VN7A 3HZ3A 4UNTA 3IJSB 3QJTB 5DJYB 4XWGL 1G7JB 3G04B 2OPCA 2DQFB 1O5DT 5C0IB 3ZE0F 4H8VA 5C9JA 1OARL 2C8NA 4KOBA 3C6SB 4KHXL 3RVTC 3O3EB 4PGCA 5I18L 4QTHA 3BZFB 1BM7A 1AJ7L 3MBWB 2VXVL 4UBDC 4TUJB 5E6ZA 3IFPA 1GOFA 3MOQA 3ME0B 2Z1KA 1W15A 3Q3GB 4LSRH 1LXMA 1NUNB 2VE6A 4WNJA 2WCPA 3NQIA 1EXUB 3BP7A 3HMWL 3LKSB 4KRNA 5FW8A 2ADJB 5EF3A 1A6AB 3BOVA 4BKLB 4P9HC 3NA9L 3OXSB 4XHJD 3QP3A 3BISA 4LARH 1MJUL 3EF7A 3ASOB 3OGOE 4NQEE 4PJCB 3VB8A 3NFSL 1MJ8L 2UXFA 4YBQC 3Q1EA 1H6FA 4FERA 4POUB 3SE4C 2WYIA 2Y7SA 4YPJA 3SJVD 2FBJH 3QQ4B 3RX8A 3HR6A 3IJHB 1KIPA 5E5LA 5MHSE 5DUML 5CILH 3DX6B 1INQA 1AI1H 5I1KL 4OV5A 1XB6A 5T5FL 5T8IA 5IBUG 3U9WA 4FC3E 2EDHA 2JJSC 5D7JA 3IMWA 5E0QA 4A2LA 1NBYA 3N42F 2B0SL 3U4AA 2IDTA 1M7IA 3T3ME 5IHHA 3HC4L 1JIBA 4KXZH 3FQ2A 4PY8I 1E9PA 3S48A 4HUXA 7FABL 4HG4J 4N5UA 1OL0A 4RMWA 4ZPTA 1YNTB 5D7JD 3FSWA 3UGEA 3AXHA 3QHZL 3I74A 5I71B 1AGFB 2A4ZA 1ZT1B 2RFXB 4LLMB 4G8IA 4R97B 2C34A 5HI3C 3I3EA 3L3KA 3QW9A 5AKSA 3GSOA 5E4EB 5B1CA 4FQJL 5A7BA 3IMUA 5B22A 1ZLWK 4HJJL 4CW1A 1XZ0A 4NZTH 2IGLA 4KJPC 3B56A 4JPVH 4R4ND 3S5LA 3AQYA 4HCRA 3VFTB 3IXTA 4QR7A 3LIUA 4OSUH 1F4AA 1VZHA 5IHZA 3SYQA 3P0VL 4MX7A 2FYVA 1OB0A 4I9XA 4TSAH 3AW5A 4PJ7A 1TPXC 4M7LH 2X4PB 1QKZH 4KITB 3SDYH 5GZOC 2WQAA 2W92A 2ZCHH 1SEBA 5ITBL 4F8OA 3GUTA 2HTLC 4AYFA 3Q8EA 4HH9A 4XXDA 1GZPA 2NZ9C 3BI9X 3O8XD 4LCIH 2PP8A 4QRPE 5AQ0A 4JANA 1TR7A 3VO0A 1G1OA 4BFIB 1SGKA 4YEFA 3ECBA 2H6OA 3MBXL 2MH4A 2IOMA 2XACC 1I9JH 4FJ6A 5KSVB 3IN2A 3VRLE 5D7KE 4Y16A 3E80A 1N3NB 4E9VA 4H40A 3MLUL 5ANMB 3ZDYF 3G7TA 4HPHA 4OJFH 3WNOA 5IB4A 2GJZB 1F58H 2O6DA 3O6KL 3O2WH 3LS5H 3QORB 4KK8C 4M43L 3VTMA 3MA9H 1NMAH 3QJQB 1IUZA 1Q0YH 2QL1A 3K6SB 1D5MB 2PABA 2VKXA 1KYAA 4OF3A 5L6YH 4B7LA 4FG4A 1TVBB 4Y16D 3MJ7B 4C4UA 4PCTA 4C83A 3FQ4A 1JXGA 2FL5B 5HGAA 2P26A 1MCPL 1AHWA 2DLEA 3SZKC 4XXWA 2CUIA 5J12B 4W9KC 4F7CA 4MTMA 2A6DA 3FFCB 4UINL 4AGLA 3SYAA 1S7XB 3BPCB 4NO0D 2I9TA 4PJHE 4I0PC 1A22B 3WKML 4AY0A 1MFVA 4XN7A 3OAZH 4P2OA 4N9OB 4FNQA 4H8QA 3CDYA 1XCTB 1XCQA 3UBXI 4ANUA 3DX4A 3W3BA 3UZQA 2G60L 3PWVB 4JR9H 3DGGB 4RBPK 5IVXE 3LZOA 5EEZA 2VDPB 1P1ZB 2Z31A 1OTSD 5K69A 1BLIA 5CAYB 5C0ND 3CC1A 4P2OD 3US9A 2ZXWB 1AFVL 1U8MB 1F00I 5DHYB 3RDJA 5DRZA 4YSUA 1NMCC 5BRPA 3MX0B 2JF1A 3BXNB 4OQTH 2J5LB 1NCBL 4M9OA 5T3XL 5CNHA 1W72H 3APFA 3T1FA 1EJFA 1XH3B 3TWCL 4PLOB 1AANA 5C0CA 1OGTA 1U8KB 3QHFL 2CBTA 2VH5H 3D3VE 4YBLC 3QYMA 4YK4C 1T4WA 3BD4A 2UWEA 5EC1A 1WG3A 1EHAA 2B8OT 3EFFA 4NPJA 5HD8D 3VAEA 2XPZA 3ARDC 4UDUB 2C9PA 3WMPA 1IAOB 1JMZA 3E8UL 4QJ4B 5IGXH 1KJVB 1MZZA 1U8OA 1XCWA 4F8TA 5B38B 1TVDA 1KFAH 1W80A 5GISH 3ALPA 3CLFL 5DD5H 3KNBB 2VKWA 4YNYA 1CTMA 5FUOL 1EUUA 4G6FB 3RVWC 3IDJA 1G43A 1DQQB 4OLYL 3FTZA 2VMCA 3HAEG 4RNRA 2BS71 4PTUB 2VABB 4NRYB 3ZLQC 1X9LA 1DQDL 3ES6B 3DURA 2WGNB 1R5WB 2NNAA 4ZXBB 3ML8A 1Z66A 5EZLB 2OZ4A 2VRQA 2EDLA 3NP4A 2YMTA 5IEHA 2QVMA 5J6GA 5FYLL 4KU1A 1RIVH 5BJTB 1YAIA 1DQJB 3QWRA 2ITEA 3FCGA 2X4UB 4J4PC 4JO2L 5CWSB 4ZG1A 1BFVL 3S3SA 1E65A 3WJMB 3NEXA 2XWZA 1A6PA 1QP1A 5CGBA 5C2UB 3QAZB 5DJXB 4ALAH 1AKPA 3JTTA 2R1WA 1R3IH 3DVGA 4X6FB 1G7MB 4DP7X 4N8UA 5DJZA 5GGVL 4WTQA 3NACH 1UC6A 5TFSH 2JXMA 4OIFA 3UX9B 1U92A 4JFYB 4OLVH 2R23B 1FVDA 5I1DA 2BFVH 3EYVA 3Q1SL 4QOKB 1INEL 4N90E 5HHOA 2Q6WA 1HAUA 2R0KL 3BC9A 4M02A 5B1KA 4KJWD 1R24A 1AQKH 2F68X 5DFAA 3FN3A 3DHPA 2QQKH 4NNYB 2XN0A 4PGDB 1E50A 4WU5B 4OLUH 1KWGA 2FIRT 4QXVA 4FXTA 3L5WA 3MRBA 4LLVA 4JCMA 4YIQB 4ZOCA 5HHOD 2WMPA 2C1PB 3J8F7 4OUOA 4UZUA 2Z9TA 2WWMD 4G7QB 4WK0B 4UUJB 5I6KA 3BVXA 5DJ6A 2QGEA 4LCCA 2E9WA 3KS0H 2D7QA 3VFWA 4G59C 1HXYB 2GC7C 3VG9C 2CK0H 3I02A 3AM8A 2J7LA 1SFHA 4XO4A 3G5XA 3GS7A 4Q58C 1CDUA 5IBTH 1WDAA 1UJ3A 4TUKH 4WVRA 3MKGA 5JLZA 3U79A 3GJFB 2GSGB 5IJBC 3C9NA 3FFOA 2RQEA 5LN4A 4ORZC 3V0IA 1QYGL 2GT9B 3GDCA 2H2SC 4GRWH 4W9ZA 4LRIA 4JQIL 3QI9C 4Y2DD 4TNEA 3ATDA 3QPQC 2DQGL 4R2GD 2YBRB 5C08D 4KAQL 4DZ8B 2VMDA 1AVAA 3N04A 1OAQH 4FKKA 5CLWA 2HJFB 4OCWL 1VFUA 1TVHB 2XN1A 3LH2H 4XPAH 1SJVA 5KSUB 2X09A 4Q4IA 5T1KB 2A9MH 3JVGC 3NIDE 2WLLB 4XH2A 4JFVA 5A16B 3OC8A 1ZANL 1R5IA 5ICXB 1Q9LA 3NESA 2NXYC 4Y9CA 1CXFA 2CBPA 1JK8A 2CD0A 2Y36H 3DVNA 3VWKC 4EN3C 1TFHA 3NCYP 1EDHA 4HS6A 4ECNA 3C08H 1E0OB 5AUMB 1AZBA 1JNNH 2UXVA 3TU6A 1AD0B 2AGJH 1HSBA 1R47A 4K8RH 3MV7A 5LLIC 2VZTA 1A8JH 4PJBA 4F57H 5D93C 2UZYB 4HZLA 4MVBC 4PWIA 4LAJH 5D55A 3RFZC 3EOBA 4LBEA 3UGXA 2WINB 4ZMPA 5IK3B 1CD0A 5CD3A 4EDXA 2Y3AA 5KVDL 4QPEA 2IANE 2B59A 1IQWL 2QSQA 4EI6A 1JPST 3ARFB 1DCEA 1FHGA 1MLCA 2EYSA 2XZCH 3V6FB 3E1F1 1S8DA 2GTZA 2P24A 3WXVH 3UABA 2WWKO 4QGTA 3QK0A 5LBSH 4EVNA 1L9NA 2HKFL 4HU8A 3P9MA 3BKCL 5JZ7C 2VSCA 4YH6A 1FHNA 3FSZA 1Z3GH 1TJIH 5EUOF 1DBAL 1LTXA 4JZJB 1QFOA 4U31A 3P1VA 4NN5C 1MJJA 2DIAA 2V8MA 4M8RA 5DVMA 1G87A 5FYJH 2JH2A 2WSDA 2GCYB 3RA7H 2ZXCA 3B9KC 1U8IA 4MS6A 1DHKA 3BRFA 4OZ4A 4BK5A 1QRNA 1LK2A 4XWGH 1WLHA 1K6QL 1VADA 1DBJH 5DFVC 1VGEL 2EYTB 4X4ME 1OARH 2BO0A 4Q7DA 4HV8A 3EW3B 3ZVVA 1DVQA 4JFEE 5I18H 2AJ3B 3IKKA 2GY5A 1AR1B 2NXZC 5CLYA 2FJHA 4HETA 1AJ7H 2VXVH 1ZMYA 4DO4A 1ORQA 4IIQA 5EU6A 5I6XC 1KG0A 4S1DC 3VACA 3GRGA 3IPEA 4MD5A 2QADD 1QFUL 2NT1A 3HMWH 3CPLB 1EEYB 2ZXAA 4I48B 1I7ZA 3AB0C 6TAAA 1JXFA 4JAMB 3NA9H 4LSVL 1Y0LB 5DJCA 4O2CB 5EU6D 2PPDA 4ZOBA 5BS0B 3NFSH 1MJ8H 2YKKA 3QO0B 1HWHB 3KL5A 2X2JA 4ANKA 3NCXA 1SFDA 4JN1L 1NANI 1GIGL 4AUYA 3H2WA 3BUQA 5DUMH 5EF2A 3W56A 4WI6A 3VI4E 4YZFF 4WJ5A 1I8LC 3DUSA 3FRUA 3B2UC 4IEFB 5ICUA 3L3IA 2A74B 3CFQA 5FM5M 4POZC 3ARBB 1TMCB 5JPNB 2YHGA 4F91B 3V7AE 2QMJA 5I1CL 4LASL 4XOEA 5F3HA 2BSEA 4URKA 3HC4H 3TURA 3QIUB 4WUKL 5HYIA 2HLFD 4JFWA 1XIWB 2B9BA 4KH9A 7FABH 1S9XA 2QGDA 1EJ8A 3O2DA 4ZFOA 1CFSB 1AGEA 2B0PA 2WWOA 3P3UA 2KLRA 3QHZH 3DRQB 2BSED 3QFJE 3WG7B 5JMRA 2Y1YA 4PJEE 2PF6A 3EOTL 2YXWA 2Z34A 3OKNA 5DUBB 5F3FA 4PGEA 1EGJH 3QC6X 2KMWA 3VW3L 4D0CA 4MNGE 4PB0L 5F2FA 1U8PB 2GJ6A 5D2NA 2EUZA 3V4PH 3ZYIA 3AROA 1OAZL 5FGSA 2AEOA 4P2YA 3QDGA 5D5ME 3VXNA 4J3OC 5JPMB 1FH5L 2MRYA 4GKNB 3P0VH 1SLVA 1N8OE 1UWXK 3KPPA 4UT9A 3PQYB 2CDGA 1IGML 3B8YA 3WTXA 1D6VL 1V5JA 3TBSB 1T1ZA 4KGLA 5DVLA 2PTTA 3BUIA 2X1PA 2VB5A 3QDGD 2O72A 5ITBH 1Y18B 3JQOB 4K0OA 4C55A 1FPTH 3MCKB 3TC9A 1RZJH 2W9EL 5T1DL 1ESOA 1IBBA 1GYVA 3MYZA 4RDQG 2W5PA 3QGVA 4D0DA 3ARXA 3ZZSA 1FL6A 3SGKC 3QJHB 3L2LA 1YEKL 5EMYA 3GSUA 1NPJA 3KLAA 1LDSA 3HZVB 4B7IA 5LQBL 4XZUA 5I74C 3RPBA 2PWEA 2NNXA 1B0GB 2VDQB 5D1ZC 2XC8A 3KVPA 2I24N 4FQ2L 4HUWA 4K71B 3MLUH 4DK3A 5BO0D 4KROB 1BZQK 2AQQA 3HG2A 5IIEB 4GRMA 1OB1B 2GUOB 3RNQB 1GS7A 3UTQA 2JKSA 4DPAX 1G7QB 3L5HA 3O6KH 3LV3B 3FQRA 4M43H 1BWWA 4JPKH 5ILTL 2P46B 1KGCD 3FU7B 2BDNL 1JWSA 3FYEB 4ZW3A 5GS1A 1FL5A 5ABDE 1I7UB 5GS0L 1L6XA 1F13A 4U2YA 4JLRB 1MCPH 5MERB 3ZX1A 2X7LA 1A7QL 1DL7H 5DD1L 1DJYA 2IH1B 1BAWA 1HYRC 3D85D 1DLFL 5FCSH 3DECA 4LIQH 4JRYB 2DEWX 3D25B 2GK0A 2DLHA 2IBGA 5F88B 3QHTC 4YJZL 1W9XA 3QZMA 5CZRA 2OKMA 1RZKL 1OSYA 1PX8A 2G60H 1DSYA 5E8EA 5BW7C 5KSBB 2FB4L 1UOWA 3CMOL 4PJ9C 1BVOA 2C9QA 3C09C 2GJRA 3LXCA 1JZIA 5C0BD 4MXQD 1PZUB 2IH3A 1H6UA 4XPHL 2ZG3A 2ARJA 5A6IA 2LTQB 4NFDA 4L1HA 3ZDXB 4MA8L 5DDHB 5BMFL 3VCLA 3UTPD 3BZ5A 4ZW5A 2W59A 1NCBH 5K9JL 3HZKA 2CUHA 43C9A 3TWCH 1GCFA 3AVEA 4B41A 3QHFH 5E51A 4PAZA 3LD8B 3P0YL 1BX2A 1SEQL 4A7UA 2X6VA 4Y19B 3K72B 4N8VG 1J9TA 4KKQA 4V1DA 3P40A 2B5IC 2NCMA 4YR6B 5EHFA 3RY6A 2A77L 3HAEA 3OLEA 3FT2B 4NQCB 5GGTA 3E8UH 3HTLX 1KDIA 2WNGA 3N91A 4YSPA 1P7QA 3WHE0 3W5MA 3RUGE 3CLFH 5AW6B 3NJHA 4NM4L 4NENA 4V1DD 4AYBA 3MNZB 1J9CT 5FUOH 4QMEA 1LD9B 3HZMA 3PJSA 2KC0A 4H8WC 4PG2A 3MLTB 4OLYH 4ZUWB 4YS4A 4CMHB 1DQKA 4XBEL 1UT2A 3DUUB 1CD9B 4N2HA 3TS8A 4M1CD 3EJJX 4ES8A 1ONQA 1FO0B 1KUMA 2FZ3A 2NY6D 4J27A 3RIAF 3SPHA 3PAYA 1MCRA 4ZZFA 5CD5C 1DQDH 2ICWJ 4WUUE 1MW0A 1L7IH 1NBQA 5ESVA 1U91A 1J8RA 2BY0A 3OKOA 4R97C 2FWLB 2VN4A 3FHAA 3ZPDA 5FYLH 5E4EC 4DN3L 3OHMB 4JO2H 3JZYA 1BFVH 5IG7B 3ZSTA 4UT6L 3TYFA 3Q7JA 4QHLB 2DMHA 5CEXB 3CDCA 3B1UA 1GZHA 3VXSB 3JTSA 4BUGA 3DJSA 1W2KT 3KYOA 2NX5B 5L2KA 4UZGA 1MHEA 1N5YL 4E9XA 3SYCA 2G30A 2AJVL 2J2ZB 4XCFH 3QZLA 1UCBL 5C8JB 1RUML 4FNUA 3NA4A 1EQWA 5DMYA 3Q1SH 4N22A 1INEH 4U1LA 2R0KH 2AHIA 2PR4L 1RUQH 1BQUA 2CRMA 1IGIL 3FRPB 5L2KD 1RK1B 2ZWKA 1WUNT 3ARZA 2BW5A 4YDIL 4NQEB 5C0EA 4G9DA 1MFUA 4KI5F 3KCWA 2WGXA 5AW4B 1EAJA 2IMMA 1IFGA 3SKNA 2IPKA 3NFPA 1Z7JA 1E4KC 5F1NA 2WXOA 3MTRA 5DRNB 4RMQA 1ASOA 4D9QE 3TCLB 4OFPA 3PNWA 4R4FL 2B14A 3CFDB 3ZL2A 4NOBA 4Z7WB 2VO8A 4QXWA 4F93B 4P5RA 3OL2A 1PIGA 4NWTL 2HKHL 5IQ7L 1HL8A 1SYSA 4JPWL 1GGRA 4IBWA 3CIQA 2D9QB 4EUPG 3BFOA 1NFAA 1U8NB 2C3HA 4FQ1L 1SXAA 1VCBC 1TTAA 1YEFH 2V7NB 1OP3H 5EOQL 4XNQB 3CQFA 4UOZA 1IC5L 4XN5A 3IJEB 1AKJA 4X7FC 2VT0A 4N2NA 1GMEA 1QNZH 4JRXE 3THML 4JQIH 5C0AA 4WNSA 4BWUA 1A9BA 2K4WA 4M6ML 3RWJA 5F0JB 1HINL 4P5KB 2DD8L 2ZIDA 3SBRA 2DQGH 3NSCA 2IPUG 2AQ2A 1TTFA 1KJ2L 2B2XL 3OXRB 1AKJD 4KAQH 3P54A 1BW8A 1O2FA 4L1SA 3G3LA 4GW4B 1AHMA 5C0AD 4PJDB 3NTCH 4OCWH 1OPOA 1PZ2A 1JP5A 5DWPA 5E5RB 4WW2B 4DZBB 5I30L 2EYRB 4WNQA 5K9KA 5L9DL 2VDNL 5IJKA 3T6WA 1ZANH 1P2CB 3L3DB 4AQEA 3U30C 3BAEL 4HALA 4Y4HC 2MCMA 2HX9A 3S3JA 1CFNB 4D9RE 5LG6A 1JPEA 1ZY9A 2DB8A 3UZEA 3T4AA 1R17A 3OM3B 1IM9B 3GRWA 1TENA 4QRPB 2IGFL 3HC0B 4PCKA 4KMTL 1CT8A 3QUZC 1JWUA 3OJMB 3WNIA 5AVVB 4G6ML 3OLGA 1IC0A 3UIZA 4GG6A 5IM7B 1QEWB 3L9EA 4Z0XB 3BCDA 4Y4KA 3HLAB 4WEEA 1N12A 2J71A 2CUAA 2ZF9A 4OCYL 1RJYB 1LM8V 1OOAA 5LCVA 3DA0A 3OR6B 2YAQA 3BAJA 5KVDH 2CK2A 1IQWH 3H3PL 5JA9A 3MRMB 1KWKA 3GMNA 1SJHA 2YD4A 3FBKA 1CFTB 2PN5A 4Y4KD 5DS8B 3N40F 3ULUF 4PY7A 3BIBX 3FPYA 4GAFB 5DHVA 2JI2A 4WI9A 1Q38A 1V27A 1A1MB 2XFXA 4MMZB 4IBZA 5D9SA 8FABB 2HKFH 5F97E 3U9UB 2R1XB 1YRKA 3BKCH 3B2XA 4PW4A 2QELA 4F8PA 5ID0B 4ZTOH 5DK0A 3JVFC 1E5UI 3S97C 3QISA 2DZEA 4CILA 2GPZA 3WY4A 4R3SA 5HHMD 4QJ3B 4PRNA 3CSPA 1DFXA 1C5BL 4JO5A 1I9RH 4ZYKA 9CGTA 1J12A 4A6YL 2XKNB 5JIMA 1KLGB 3D08A 1G1KA 2BSDA 4MB3A 4Y1SA 1K6QH 4D0BA 5IVXB 5CBAB 3NAAL 1R75A 2DW5A 2ERJB 3C8HA 1KYUA 4F9PA 4KH2A 5I66B 3QIWC 1FH2A 5HGHA 4GAYB 4YHZL 4GQZA 3MRPB 3US0A 1ZLUH 5DJ2A 3BUTA 1V55B 4OT1L 2OX5A 1QFUH 4IBTA 1HC1A 2JJUA 4PP1C 2X3BA 3LYRA 1I8IA 4ZODA 4Q52A 5GZNA 3MR9A 2MCG1 4JFDA 2R39A 1INDL 4LSVH 2DQIL 1KELL 3HE6A 5AVXB 3TWYA 4JMXA 1M56B 3D3VB 1HILB 4FQXD 4TMPA 5G55A 5C1MB 3BWUF 3M7FB 4HS8L 5K1NA 2VQ1B 4MZRA 3RAJL 3EO0B 1QR1B 3L81A 3IFOA 2ED7A 5DJAA 1BBJB 4JN1H 3CLEL 5GZND 1GIGH 1IAMA 2WQXA 2CCVA 2IDFA 1T2QL 4JFDD 5FHBL 2AV1A 2Z8SA 4BFNA 4JB9H 3MUY1 3GTTA 3NQKA 2L7JA 3Q48A 4HHAB 3ECUA 1WWCA 3MFGB 2YA0A 4AT6B 2DBLL 2VMEA 4FFWC 2YMOA 4L8SA 3ET9F 4N9GA 4LASH 4XC3L 5I1CH 3RWHB 3X13B 1GGTA 4PRAB 1Y07A 4PJ7E 1ZA6B 3O6FD 4WUKH 3WN5A 1BG1A 1UKSA 1G7IA 1NMBL 4G3YL 4EXKA 3T0EA 1ZHLB 2M83A 2WO3B 5I8OL 2R29L 4QY8B 3CFKB 4HKJB 4PBVC 4XB3A 4X4XA 3M8OL 4IGBB 5FCUL 4UTBA 1MXDA 3H53A 4FFYA 1VHPA 3AUVA 2J6WA 1CE1L 3LRMA 1G7PA 1J88A 2YWZA 3EOTH 1DDHB 2P45B 4G80B 4ZDHA 3SDCC 4MHHG 5J11C 4WWKA 3VW3H 4OZFH 4PB0H 3QUYC 4CDHA 5FB8B 2CIKA 4PEEA 4CADB 3PHQB 3T2LA 3BH8A 3UBGA 3GBEA 6PAZA 1DLHA 2QSTA 2ZUUA 3DV4B 4UILH 2EVJA 5F7HA 4FDWA 4YHPA 2IBBA 2LT9A 2ITCB 4G70B 1FH5H 5FKAA 3KJ6L 4GEIA 2I69A 2FSEB 4WWKD 2FO4A 2WTOA 1IGMH 1D6VH 5HYSB 1G1YA 3B8SA 1T5WB 3OF6D 4U4IA 5JW5B 2UVEA 4ICWA 4N2IA 1MKFA 1NSNL 1CTNA 3NJXA 3N0AA 1WEJL 3WTUA 4ABQA 3P73B 4O2EA 2W9EH 4AVJA 5T1DH 3GMRB 4EO5A 4KXZI 4YO0A 1HQ4A 3CN2A 1IGTB 3KPTA 4LVHC 4OM0L 3SEPA 1ND0A 2G0KA 1CFQA 3DDFA 1M71B 4G6AC 2B16A 4KX8A 3F5WB 4KVNL 4PS8A 2F58L 4KKLD 5LQBH 4K94L 5DYFA 2AABL 4CRPA 3HUJF 4X6BA 4EI5B 3NMEA 4P48A 4OBSA 4FQ2H 4XN4A 3MREB 4L0PB 2D73A 4GY4A 5F1SA 4MA7L 4APQB 2AMUA 3Q8AA 2BDNH 2UY7B 4NC1E 3TIEA 3UTSD 3VFSB 4BCYA 2P44B 4HZAA 4KI5D 4P46D 3MGOA 5KJRL 5GS0H 5LXVA 2XJKA 3F7YA 4U1KB 3D33A 5HGBB 5EDSA 1KTLB 2FYYB 4RFNC 1A7QH 5KSAA 5DD1H 4TLTA 2H1PL 1DLFH 2EDNA 4QRRA 1AMXA 3DBXB 5GPRA 5C0CE 3GI8L 3VD1A 4J12A 2WXFA 2HLEB 4MBRA 4RMRA 5F7AA 1R5VB 4JNXA 3V5DA 5EIVA 2UWEE 1XSJA 4GAJH 5JOPD 4OF5A 4YDJA 2EJ1A 4QHUA 2WQSA 2AITA 3P9WB 5E8DL 2E46A 5KSAD 1TTRA 1Q1JH 3BH9B 1RZKH 2H6PB 1XD1A 1HE8A 2ESVA 4OZHA 2FB4H 2BP3A 1QNIA 1WCBB 3EDDA 3CMOH 1BJ8A 3QQ3B 4AEHL 4N6QA 3K2IA 5DHDA 2F9BT 4H20L 1P6AB 3QUMB 4XPHH 4FMFA 2L3BA 3IJYA 1SBBA 3N50A 4ADIA 4N8VA 4MA8H 4OGYL 7CGTA 3C5ZB 2FD6L 5BMFH 5DEGB 2ESVD 4NKMA 4FCHA 4M93B 4HK0B 2EUWA 5D70L 4HWEL 5HP5A 1K5NA 5K9JH 1J1XL 1JUFB 3AADB 3AXLB 4RSVA 3ECQA 3LN4A 1O6SB 1IJ9A 2E76C 2FJFB 1NINA 1PTZA 1Z9MA 5INCA 5GSRA 2CSPA 1X4YA 5IB3B 4FTVB 5FGBC 3VRJA 1IT9H 5JW3L 3P0YH 4R0LB 2MHAB 4Z7UB 4J39A 3PPSA 2OMXA 3GSQA 1VIWA 1QBBA 2LU3A 1VSCA 5I8EA 5DVKA 2V5YA 1MF2L 2H2PD 4KKPA 4QHMB 1M05B 5KS9F 3QR0A 9PCYA 5JPNC 1ASPA 1KC5L 3IEAA 2EAEA 2NOYA 2WVVA 1R0AL 5EZOL 5BZXA 2VQ4A 4PD4K 3TH4T 1NA8A 2HP4A 5HHOE 4OD1H 1PF3A 1QFWI 4NYLA 4XBEH 3GSNB 3NCEB 1D5BB 2EC8A 3M1CA 3QIBC 3ATBA 2VXTH 4N0FB 1GYUA 1WZMA 4KUCF 4MAYC 4NC2B 5TDOB 1U8LB 2CM5A 1ACYL 2EO7A 2OQJA 2Z8VC 1U2CA 4DN3H 2R83A 5B3JE 4BE5A 5KAQF 3M46A 2EVIA 4WHYG 2FX7L 3M45A 1KBBA 4BH8B 2I26N 4UT6H 3GJEA 2O5XL 3A47A 1R3JA 4WI8A 3FQYA 1JZEA 1TEYA 2DQJL 1G5AA 2VZ1A 4XB7A 4IOFD 2G2RB 4OFIA 2ZXGA 1ZGLA 5E23A 4XE5B 5HDOA 4HOWA 5JPMC 1OM3L 1N5YH 2DYRB 4L4VA 2NDFA 4PLKD 5I26A 2AJVH 4HLEA 4ORGB 1UCBH 3C5JB 1RUMH 1U21A 4Z7QF 2K6WA 1J0HA 2A9NL 2WIIA 4ODUA 5DRXB 3TEYA 1N8ZA 5FK9B 1UWGL 1LE9B 2PR4H 1CR9L 3HE7A 3ISWA 1OP3K 2PYEA 4JHZA 1IGIH 2W0KA 2WN2A 3MRCA 3T6XA 5LNGA 2CLZA 4HIPA 4YDIH 1X4XA 3AGWA 3MVSA 3F7LA 1TITA 4ZUVB 1XGQB 1WUZA 2C3GA 1I8UA 4ZTPL 4BGDA 5HPMA 2QBWA 1C8QA 1S7SA 2VLJB 5E1AA 3SKOB 5C0RL 2YXVA 3V9CA 2BH0A 1KN2L 3CSGA 1YUKB 1ZHKB 3ILQC 3TNMB 5DURD 4MRCA 3BGFC 3ZHDA 1RSFA 3RDTB 1C08B 4N2DA 3CFEB 3ASWA 2WTRB 2COVD 4R4FH 1BZ7A 5E7BA 1ZS8A 4K71C 5TE7L 4LXCA 3ERXA 3DV6B 4XZ4A 3L3OA 4NWTH 4G8GA 4ZQKA 2HKHH 3P4MB 5IQ7H 4JPWH 3LKPB 4MA1B 4IRJA 4M4PA 1E4WL 1QA9A 3SDAB 5K5YA 2RMNA 3CVHL 1HH6A 2UUDH 4FQ1H 2AI0H 2P8MA 1BQKA 3WIFB 5EOQH 4F3FB 1IC5H 1TT6A 2X12A 4G8GD 3U7WL 4AZUA 1QI3A 1MUJA 1CJYA 5KVPA 2ZX5A 2OXHB 3MV7E 3THMH 2WQRA 1KIUB 1GMIA 2GTWB 3TJEH 3AY2A 4M6MH 3FAWA 4PJBE 4QXTA 5F9DC 2EUVA 1HINH 4R7DB 2DD8H 1NFIA 2B2XH 1KJ2H 3HHSB 4MZIA 4FZEL 2CPUA 5CGYD 3WEAA 4APXA 3FQTA 5D5MB 1TZHA 3L9YA 5ESAA 5KYUA 3LEVL 1QSEB 1AGDA 5FYKD 4E0RA 1R3LB 2ZD0A 2VDKB 5I30H 4U0RB 3PDOA 1U6AL 4CNIA 5J6HB 1NGYA 5L9DH 2VDNH 3CHQA 2FBOJ 1ZVYA 1C5DA 3OAWA 4AQ1A 1NFDA 1X5IA 1NEZB 5L4JA 2V0AA 4A7GA 2R59A 3MRFB 5E4AA 4XI5C 2HMID 3B3IB 4JM2F 4YUEH 4RMVA 4KMTH 4J23A 1MCHA 2Q2LA 4YHIB 5HDQL 2XXGA 4S2SB 4G6MH 5MEPA 1L5GB 1COBA 3NIGE 3IU3B 3STLA 3C60C 3HJ0A 3MOAL 5GGRB 1D2OA 1FGNL 5DD0L 2OSXA 4DP4X 5EOCJ 4HPYL 2HPTA 3W9EB 3LPOA 1QRNE 1NIDA 4ZS6D 5DHXB 4OCYH 4AMKL 5AYUL 4AW4A 5T3ZL 2J8OA 4KJYB 5KANG 1BXVA 5JIKA 1DDTA 2YRPA 3CC5A 3H3PH 3DMMC 1RZGB 1U3ZA 3HUJA 4KRMB 4YLQT 5IMOA 5EU6E 2LV4A 3TBCA 4HIJA 1ZRUA 4HIXL 4Y88A 5EV7A 4Q9QL 4X0NA 1HHJA 3BP5B 4L5FL 1PFOA 1JZ6A 2ARWA 4XNMA 5HHVH 3JT2A 5D2LB 4J3WA 4HG4K 2VR6A 4U1GC 3D51A 3DHMA 4PP2B 4R26L 1RZ7L 4FG0A 4B60A 1Q8MA 5JOFA 1I75A 3BQUC 1DE4A 4H5SA 4Z18A 1C5BH 3AY4C 4C8XA 4A6YH 4BKTC 4JRFA 1XMWA 1IFHL 4PJ8B 1Z9SB 4I0KA 3MJ9A 4NJAL 3CFBA 1DJHA 1PIFA 1AIZA 1DVFA 4DEPB 2YMXL 5L88L 1IKFL 3QA3B 3S36H 1D6EB 4DPCX 3NEOA 3HG1D 3WFCL 5KANI 3NAAH 2P9RA 2XTJB 5D1QD 2E0PA 5K93A 1UA3A 3PP3K 2OXGA 4MMXC 3E1ZA 4YHZH 2FHCA 1BAFL 3RX7A 1BA9A 1XR8A 3R7QA 2HFEA 5J7CC 2ICEC 2BERA 2XT1B 5EN2B 1DVFD 1AD9A 4N8PA 4KTEL 4OT1H 4ODSL 3MCG1 4L8CA 2UZPA 1J0ZA 4X0KB 1E8WA 2HFGL 3GSWB 2P5WD 4MQTB 4ODVL 3SPVB 1INDH 2DQIH 1KELH 3PGFL 4O4YL 4V11A 5DZ9A 4GUOA 2DI7A 1SQMA 3BHBB 3GT6A 1T22B 2FO8A 3JYBA 4P23A 5B4MD 4KVPA 3RAJH 2A0LD 2K7QA 3R06A 4ZMVA 3CLEH 2GJ6E 1IBGH 5D2NE 3H0TB 2GQHA 1T2QH 4RFOL 4ACPA 3D34A 3LIZA 4KWUA 2K70A 4WEBH 3F7QA 3L1FA 3RUGB 4ZO9A 3I85A 2IAMA 4P23D 4UQ3B 4ZW6A 1KIQA 2J21A 2YFNA 1IU1A 3DOSB 4LL1A 4XC3H 4GRWF 2J8UF 4PS3A 1OWWA 2FJGA 2WWKT 3QARA 2BOCB 4WJG3 3TJHC 4G3YH 1NMBH 3L4TA 5EIIB 2DV6A 4QKXB 4OU3A 2R2EA 4H8WL 1XSKA 2IAMD 2DYPA 3I2CL 4X6CE 5I8OH 2CBQA 5AKRA 2AJYL 2R29H 2W8CA 3OR7B 1HSAA 5FM8A 3M8OH 3V8CA 5FCUH 3KGRA 1C12B 1RK7A 1HOCA 4F7TB 4RRPM 2WXJA 4DPRA 3ATFA 2X9XA 3HNVL 3RY4A 3FO2B 2DYPD 3K8LA 2F8IA 4Q6IB 3HHMA 3K71A 4MDJB 2HRLA 4JL1A 4R4BB 2Y4SA 1VKXA 3LKRA 5E1IA 1JPTL 3FTXA 2C7UB 5D6DA 3KJ6H 2CO4A 4LHUB 4NSKB 4UF7C 3E6FB 2HKAA 4KUCD 2V2XB 3MTXA 2DIEA 4EIGB 4LMQI 2D0GA 1NC4A 5KYWA 2HT4C 4M3KB 5F3BB 2AW2A 4PRHE 1FL3B 1NSNH 2XWXA 4GKSA 4G7RB 1FGVL 1G7HA 1P9MC 1WEJH 3WN6A 1FIGL 3P69A 3PY9A 4NN6B 1BOGA 3V6ZA 3IVKB 3JBG7 1H3TA 5I1LA 1YEDB 3S4SG 2BSTB 1ANUA 2VGLM 5IF0B 3UYPB 1AMYA 1NC4D 3T4YB 2NYYC 1HIML 3O41B 2HVJA 2PWHA 5F89A 3BN9C 3LVTA 4K94H 4HSQA 1M42A 2AABH 2NDGA 2PCYA 4N25A 4U1NA 3W0WA 5ACZB 1NDGB 2A6KB 1FJ1A 1T7ZA 2BY1A 4CC4A 2CLRB 4G6JH 4UT7L 5AVWB 5BOZG 4MA7H 3GSRA 2Z35A 4PRDA 2XBZA 3QUXC 3UPCA 3HVDA 4B9PA 2WYTA 2O61A 2J1WA 2Z6FA 4POYA 5KJRH 3PWUB 1KULA 1S2EA 4YWGH 3F85A 4BKSC 1WT5A 4X5WA 4A7SA 3COOA 2PNDA 1N0LB 3LMJL 2VISA 2O5ZL 2CM6A 4HIEB 4JRXB 4EE2A 4F7MA 2H1PH 4KKCC 3PGDA 4HMEA 3RTQB 3HG0A 2E75C 4RH4A 2BVOB 3GI8H 2R7EA 4FHBD 4JFQB 4U0QB 5AL8A 3FUDA 3Q5YA 3S34H 5IOKA 5BQ7A 1G9NH 5GGQH 4V1DE 2WZPA 3RL1B 4MDIB 3NCJL 2BRQA 1ZTXE 5E8DH 1JD9A 3GBML 5E1QA 1MFDL 2ZOOA 2V9RA 5IEKB 4PREB 5JQIB 1EFXA 2CE6A 2FK9A 2WSPA 4AEHH 2H3NB 4YX2L 1HQRB 4H20H 1JFHA 1HZHL 1HNGA 2VDPL 3GMLA 4P2RB 1RJLA 2KQNA 5CEZL 2HFFB 4XCCL 4ZFQA 4BA0A 2FD6H 3UTTA 2Q8AL 2CHNA 4EXPX 5LN8A 2W60B 4U3SA 1SF5A 3REWB 4HWEH 1IZKA 2A6JB 1EFXD 1J1XH 1E43A 4HJIA 3FUKA 3B2VL 4N8CL 2LU4A 4NZJA 5T5NG 3JZ7A 1ITBB 4G7VL 4DQOL 3LNGA 4H2AA 2DWEB 1KPUB 3MFFB 3RGVC 2CHDA 3UTTD 4Y4FA 3AT9A 4X50A 1DBKL 3UADA 1KT2A 3V4VA 2XX1A 3ARGA 4H8PA 1LK3L 4Q9BA 2NY2C 2A4EA 5C9JB 1GYWA 3DYMA 3VFGH 4QTHB 1MF2H 5I6PA 5L2KE 2DM7A 3I6KA 2VCOA 1B4RA 1NCOA 3Q8CA 3HR5A 3IFPB 4JM2D 1KC5H 1XEUA 4Y4FD 1S7RA 2CGZA 3LDBC 1P4UA 4JG0L 3T0AA 5EZOH 5EBWB 4GBXA 5EWIH 2IG2H 1R0AH 3SJVB 3WENA 3BP7B 3DYOA 5AALA 1BZ8A 1F41A 4LEBA 1RZ8A 2B15A 3OJ2C 1PKQA 2X87A 3EDJA 3AMKA 1TFPA 1TQUA 2CCWA 4KJQD 5D4IA 2BZDA 1A64A 4JFPA 1WBXA 4GBXD 4NUPA 4NT6A 1ACYH 1R1CA 5PAZA 1BIIA 1V7NL 4BUHA 5CS7A 2K45A 4UQAA 3IJ8A 1KIPB 3E0GA 2FX7H 1INQB 2O5XH 4OV5B 1NDMA 3NZHL 4HX1B 1JBJA 5KG9B 5FC9A 2IFGA 5D7JB 2DQJH 5DA4A 3NRFA 5KVGL 1NBYB 2CKBL 1EUTA 4GT0A 4Z76A 1FNHA 1M7IB 4DKFL 1QBLH 2YD2A 4XXCA 3WCYA 1E9PB 2A9NH 4M03A 4HUXB 1UWGH 1G6VK 2UUDK 2VJ0A 4RGOH 4B9CA 2PXYA 2WZ0A 4ZPTB 1CR9H 1SNRA 1SVZA 2QT6A 3KBHE 4YFLI 3FU8A 3K6OA 5L4MA 4G8IB 4U6XA 5KOMC 4Y8DC 3L3KB 5JHLL 3GSOB 5C0AE 4ZTPH 4FLOA 1OAKL 1BSIA 2HZHA 4KQ3L 1ZV2A 4CW1B 5C0RH 4AM0Q 1XZ0B 1KN2H 2PXYD 3T6VA 2W95A 2ZTBA 4WDIA 2WXMA 3IXTB 3HC3L 1TLMA 3FB6A 5EZIL 5L8LB 2PW2A 5GRXG 4WHTA 5IOPA 1A02N 5EULV 4YC2C 2OSLA 4MX7B 2VXUL 2X4SA 2GU1A 2YD0A 4XVJL 1USQA 4XRCA 5HPOA 2V8LA 4PJ7B 2FLMA 1UD5A 4WGVB 1E4WH 2C4FU 5MENA 4OVVA 2VIRA 3CVHH 3CFUA 1T21A 1SEBB 4OGAD 3S6CA 3GUTB 3HJEA 5EPMA 2RHEA 4AYFB 5LGJA 4HH9B 1GZPB 2JLPA 2KPWA 4GMTL 4TTGA 3U7WH 2JKXA 1NM4A 2P8PA 4DUVA 3ECBB 2D7PA 1LO3L 5MEND 4GG6E 1BFTA 2GTQA 1OE1A 3RURA 4Y16B 1HTYA 3ZE1F 2R69L 3TVMA 4FZEH 1NKRA 4GOSA 5GGRY 1WCQA 2DLIA 5EOCL 2BPBA 1WZLA 3LEVH 2WQUA 3A5VA 4HXBL 2B1AH 2A6IB 2VDRB 4NQDA 5CZXC 2BFGA 4NO0B 1ZLDA 2WWNA 2ZNXA 3S35L 2AXGA 3HMXL 3TVMD 4HVBA 3A23A 5JUEH 1U0QA 3FUHA 3RIFK 4K7FB 2C4XA 4PV8A 2VN6A 4F7CB 2FVNA 5KTEL 2A6DB 2KI6A 1WIUA 1KYOJ 2OCJA 3TX4A 3UG4A 4NQDD 2VUYA 4PJ5E 1JZGA 5HDQH 2OMVA 4ZD3L 3IN0A 1KEGL 4LGSB 2MCPL 1CGSH 4P2OB 3MOAH 5IFHL 4BSWA 2WVTA 1FGNH 4YFLF 5DD0H 1XCQB 1JN6A 2ATKA 4HPYH 1P7BA 3K0YA 3VJ6B 5DZLA 2Y6SD 3CN0A 1A4AA 4AMKH 1O7SA 3TFKD 3R7RA 5JHDA 4GW5A 4M6AA 5JA8B 1S9KC 5T3ZH 1T20A 3DTUB 3GK8L 4Y5VC 4ZTEA 3WIAA 3PFUA 1ACZA 3B9DA 5LBSA 2FT6A 1SN2A 5DRZB 3T0XA 5MEQB 2NY1B 4BK4A 4NAJA 4MASA 4Y5YA 4UQIM 2ZOLB 1PW3A 4ETQA 3T1FB 2EVFA 4JFDE 2P5EA 4L5FH 1CE6B 5IB5A 1UUNA 5HVHB 1MQ8A 2DQDL 4OTXL 3W1ZA 4XNDA 1U95A 5GJTL 4R26H 4Q8BA 1RZ7H 1EDYA 1EVTC 1OD7A 2NY3D 2UWEB 3HG3A 3SOTA 4WTWA 1AOZA 5EC1B 3EFFB 1IFHH 4K5NA 1PD0A 2P5ED 1A7PL 4NJAH 3SE3C 3UAEA 1U8OB 1AGCA 4M3JA 4X6DA 3CNKA 4F1SA 4BYHA 2YMXH 5L88H 1IKFH 3HW7A 4X7TA 4PVBA 5E6YA 5L4FA 12E8H 2UV3A 1UQSA 2VSDA 2Y23A 3NSXA 2VDMB 3OJDA 4FI7A 5SWQA 2N59A 5KEZA 3IDJB 4UDTB 3CHSA 3LCYA 3CFIC 1J9RA 4P2QA 3VMNA 4OV6F 3AQZA 4RNRB 4TRPL 2EH8L 4ODSH 3G04A 4BH7A 2AKRB 2BXYA 3T0EE 1NPUA 2ZXBA 3DURB 2BHFA 2HFGH 2NNAB 4L37B 3V55A 4ODVH 2NQDA 3OAYK 5HVFB 3BZFA 4FQPA 5IEHB 3PGFH 4O4YH 5J6GB 4BZ2L 4IKNA 4N2MA 4TUJA 4P2QD 4PGJA 5JHBA 3RGHA 4AKQA 1RCYA 5D7LA 1B2WL 4H8UA 2LFGA 3X11A 2HFTA 2F53A 3FSVA 3LKSA 3JTTB 3KVDD 5T5FA 2JIXA 3DVGB 2IDCA 4NZUL 3BSGA 1AQHA 4Q9RL 5LJYH 4M00A 1OHQA 1TQTA 4YEEA 2JXMB 1U92B 5D7LD 1FVDB 4TSBL 5GJSH 5I1DB 3EYVB 3BVVA 2F53D 2Q6WB 5HHOB 5CJBA 3OB0H 2P7TB 2JIXD 1R24B 3V5KA 4JFTA 4L8DA 4ZX3A 2C26A 1CYGA 4WCYH 3I2CH 3L5WB 4PGBA 1E3XA 2AJYH 2JNZA 3EO1A 3MRBB 4LLVB 3BX7C 4N0UA 4DAGL 4N2EA 2WMPB 1EO8L 2HA1A 2WB7A 3CZGA 3HNVH 3UDWC 3IAGC 3UP1A 3SGDH 2ZPKH 5DJ6B 5HTSA 3V9FA 1B4LA 4LCCB 1H3PL 3VFWB 1U36A 5ERWA 3MCLL 4YSQA 4ELKA 4NO2A 2X38A 3I02B 3EH1A 1AGFA 4K55A 3L7FA 3VGDA 3WTWA 1BMZA 1T89A 1JPTH 2X2HA 4JUTA 4YDKL 3X1FA 3G5XB 3S4SA 3VMOA 1HYSC 4LSPL 4Y2DB 5JLZB 4GRLC 3C9NB 3N42B 1CDCA 3NJJA 4R2GB 4WAFA 1A6TA 3UTZA 4L3EA 5C08B 5JOPE 4XN1A 4BCXA 2QLYA 5D1XA 2HB0A 1M2OA 1FGVH 4GI6A 2JKTM 1FIGH 3D0VA 3K4AA 4QRRE 2D2OA 3MCYA 4B6ZA 1TMQA 3II1A 1KPVB 4RMUA 3MYJB 5T1MB 5AFAA 4BFGA 3HHRB 2WXHA 2NW2A 1HIMH 5D1XD 4JO8A 1EZUA 3QJUB 2Z8RA 3EBIA 1E2WA 3KGSA 1KTDA 3NK3A 4OZHE 3RVVD 4PJ6A 3GXPA 4GSXA 5IROC 2ZONA 3BGMA 3FCTA 4XH2B 1DUZA 2XYBA 4RLDA 1E2ZA 1Q9LB 4YDVB 4LVEA 5EF1A 1TEGA 4AMXA 3HN3A 2F6AA 4AYGA 4M1DH 3MLYL 1JK8B 1UZ6E 3FF7A 3LQAC 4L1LA 5F0MB 4HS6B 4AZ8A 2Y2TA 2V37A 4HU2A 2B4CC 1SOKA 2XPGB 3LMJH 1PX4A 1VFOA 2O5ZH 3P3SA 3CD4A 1PQZB 5HBBA 1UB6A 3BGAA 4PJBB 4PLJD 3CFMA 1MLBB 1IV8A 1XH0A 4HZLB 3N6YA 1TVBA 2VZUA 2FEDD 4YHOL 1XZWA 2YUZA 1QTPA 1VACA 3MRRA 3L4ZA 3EOBB 1YEJL 3FBQA 4LBEB 4YE4L 1YYML 3WKNA 1R46A 3NCJH 5CD3B 3MGTB 3TA4D 3GBMH 2YD7A 4EDXB 1MFDH 4WV1A 2B59B 5ECJE 3DHUA 4PS4L 4EI6B 1ZDSA 3ARSA 2QPSA 2XVLA 1S7XA 3WUZA 1YPZA 4I7ZC 2JTYA 3ZDYB 1S8DB 2P24B 3ZKXC 3WEMA 4YX2H 4OIAA 5D71H 4EVNB 2IF7A 1HZHH 2VDPH 4JPSA 3P9MB 3BEWB 1LMIA 4XCCH 2Q8AH 2AZAA 3WLBA 3ULVE 4J6IA 4ELDA 2XI9A 5DVPA 3SZ6A 2VM4A 4N68A 3GSVA 5IW3A 2VMJA 3PDDA 1MJJB 4N8CH 3MLWL 3NIGB 2VLRA 4G7VH 2NNCA 1U8IB 3ULUC 5T3XD 2CDEA 4LOUD 1DBKH 4OZ4B 2FT7A 3V0VA 3KLKA 4RAHA 1WPCA 3MX0A 1VADB 2QADB 1WQVT 3VXTA 4HV8B 3F84A 2VLRD 4H88H 4GMSH 1U8KA 2FJHB 1FFPA 3NEEA 4L4VE 1ORQB 1DANU 5EU6B 1KG0B 3VXUA 3MXWL 4N6RA 4JG0H 2YGOA 4MD5B 1SJEA 4OGQC 5CJOL 3DKHA 3U48A 3DO4A 1VLXA 2J1KA 1KTRL 2FO1A 1I7ZB 2FWUA 2PYEE 1VPOL 4TXVB 2GAZA 4B5EA 4PI0A 3QNFA 5IBUB 5DJCB 2Q8BL 1B88A 4XVTL 1WC7A 1DCLA 2PW1A 3MPCA 1SM3L 2FATL 1YMHA 3VXUD 2EH7L 1RHFA 1G4MA 1UWEL 1V7NH 1DBBL 3TZVC 3ISYA 3WKPA 2BNRA 1TYJA 4FA7B 5C0JB 3GQFA 5DD6A 4RIRA 3V52L 3NZHH 4WJ5B 3BP6A 1M6UA 2CCLA 3DUSB 3UAJA 1GPRA 1CDYA 3L3IB 5IHBA 5FYLD 1OD9A 4ZXBA 1GOHA 5KVGH 2ZUYA 1MCFA 4G8GE 1EBAA 2AQRA 4ZRGA 5F3HB 4U1SA 4DKFH 1SHWA 3SDXA 3MJWA 5CSZA 2BNRD 2X4UA 5AB9A 5J06A 3PCYA 2Y24A 1UM4L 2D0HA 4IKJA 5LAPA 1E9QA 1S9XB 3TEUA 3UAJD 4YFEA 3EGDB 5HJGA 3DX9B 1OCOB 5DA0B 1F1DA 4ZFOB 2JQAA 5LUMA 1AGEB 2ID5A 4K7PX 4AV0A 2ITFA 2ROYA 3GFUA 3D2UA 5DO2C 3KPLA 1B4JL 1KBKA 4LPTA 5JHAA 1PS3A 1OAKH 4JFYA 5FYKE 4PGEB 4KQ3H 5TDNA 4QOKA 4NPYA 1NUGA 2D7TH 3JV4A 2NW3A 4D0CB 3PUUA 5AVZB 2JKJA 1K2DA 4N20A 5D2NB 3P4OA 4P4KA 3HC3H 5EZIH 2IWEA 5F7MC 5B1JC 4NI3A 3M86A 3D05A 2ZICA 3D2UD 3QDGB 4XP4H 2CJUH 5D7SL 2FIKA 3VXNB 4AIXA 2E7MA 2WZAA 2VXUH 3NSJA 1T66C 3KPPB 3ESOA 4XVJH 4U1MB 3CHXA 2C1PA 4BFEA 3STZB 4PJFF 1TZIA 2F5BL 3OKLA 4P4KD 1T1ZB 1NFDE 2PTTB 3O3UN 3SQRA 4CU8A 5C71A 3PAVA 2ZX8A 4G1EA 1UGKA 1C16A 4F37F 2MSPA 3L3HA 3DUHA 3TO4C 4GMTH 2BIQA 4W6YB 2CHZA 4JQIA 2NSMA 4L1BA 1N6QL 3WL9A 3D2TA 3GJFH 3BD3A 2JCWA 4GXVL 2WD0A 3QSKB 4D0DB 2EDXA 5ENWA 1FL6B 1LO3H 1UYWH 2GI0A 1J0IA 3RU8L 3GSUB 5JDSA 2X4QA 4BGLA 4XZUB 3WTYA 2WZ6A 4F7KA 2R69H 4HUWB 5HVWA 4HT1L 5ESQB 4MAZA 3SCMA 3CQPA 1QWUA 1SY6L 4GRMB 4PB9L 5DWUH 1JNLL 3HG4A 3UTQB 3FQRB 4MNHA 4JFFD 2X6AA 2DM3A 3FULA 1BG9A 3ALWA 4HXBH 1JWSB 5GS1B 1FL5B 3B7TA 4O51B 3S35H 2YKLL 4F15B 3HMXH 3U6RA 1HHIA 2FX8L 1EAQA 3SCMD 1IEBA 2X7LB 2MKLC 3QPXL 1MFBL 1RKRA 4F7EA 5FWRA 2E9BA 1BJMA 4DP6X 2YD9A 3HS8A 2GK0B 1D7FA 1F6LL 4RGNE 1TJXA 5C0BB 1F45A 5ICXA 4ZD3H 3ZE2E 1KEGH 4IQHA 2MCPH 3IJ9A 5I1JH 2CH8A 2LE9A 5IFHH 5C7ZA 4GAGL 3EADA 3NBNA 1WVZA 3AAZA 1QPXA 2QQNL 5E94A 3LRGA 5E8EB 1RY7B 3QJXA 1NUFA 4QWWD 4EF3A 3NN8A 3GK8H 2L7QA 2ZX7A 2XIDA 1FFQA 1W6LA 3PGCA 2UZYA 3TOPA 4FA6A 1S5IL 4M6NL 2R56L 3VCLB 2UXTA 3NABL 3EDEA 1EFQA 1Q94A 5IK3A 1QOKA 4C4BA 3HZKB 3O4OC 3WO4C 4N0CD 1MHPL 1QSZA 4K9EL 43C9B 3CVDA 3TA3C 2DQDH 2DEYX 4KVCH 2Y69B 3ARFA 4OTXH 4U7KA 1BX2B 4EQ3A 5GJTH 3A6OA 3MXVL 4TS6A 3T5WA 4V1DB 2O5NA 1ORSA 2YGPA 4HCIA 2OCFD 1TO5A 1AZNA 1KN4L 2BVYA 3HAEB 5D7IF 2HH0L 1XXDC 2LU5A 5E9AA 4U6HA 4M5YH 1A7PH 1OCWH 1UURA 3BCFA 5J1AA 4NHCH 2WBXA 1FQ9C 2NY6B 5I6NA 1JZJA 1FLRL 4EDWL 4JHAL 4NENB 3OKYA 4CGTA 3T0VA 1MAJA 3HBGA 5J13C 2J6EL 2Z92A 3S3DB 4LSQL 3HZMB 3PJSB 2N56A 5AKVA 3RJOA 2GCYA 4YDMA 4DOHE 1YVLA 3BKYL 3U4BL 3OB0K 2EXSA 2RD0A 2ZYIA 4ZUTA 2AMGA 2EH8H 2FZ3B 2EP6A 2Y1ZA 1AZRA 3HPJA 3PXLA 2EYTA 1XF5A 3EUDA 4KDTA 4JREB 1MJ7L 4ZZKA 5ESVB 1U91B 3EYQC 4UAOB 1L0YA 3AUWB 3AABA 3OKOB 3BYYA 1N19A 4KDVA 1QBMH 1WIPA 3TYFB 1B2WH 4FNPA 3VA2C 2OV0A 3ETBF 3GIVB 3QRGL 4FFZA 3KPSE 3UAAA 1U3HC 4OCLC 4Q9RH 4NZUH 4XOCA 4Y8AA 1A5FL 3VFNA 2F7OA 3KYOB 1Y0LA 5HI4D 5L2KB 1MHEB 4CSTA 1MCBA 5BS0A 1E8XA 1YO4A 3L54A 2FQGA 4GO9A 1RLBA 3MLPA 3A21A 4TSBH 5CP3A 4MD0A 5BV7B 2ZJSL 4JJ5A 4U1LB 3ARED 3NCCB 4N26A 2GITA 2CHWA 2BS9A 5CJXC 3MRQB 4I1NB 4ZQTA 2VAJA 5C0EB 5KBLA 4G9DB 1HH9A 2A74A 2XTSA 3LB6D 4TUOA 3ZW3A 1I82A 2Q7NA 5AZEL 4DAGH 3SKNB 5K59F 5E4IA 2IPKB 5DGQA 3TEWA 4X9BA 3C2SA 5F1NB 1EO8H 4H0IA 3W0WE 3PNWB 1H3PH 4XBGA 1YC7A 5HDBE 1Q9WA 3MCLH 2X05A 1TJMA 4D7PA 4TTDC 3APNA 5FUZL 4NKIL 1SYSB 4K4KA 4YDKH 3WOVA 4HFWA 3L4VA 2NY4C 5FECB 3N41B 3BLKA 2APVA 4KRPD 2JELL 2FEJA 4AVIA 5CHNA 3Q8BA 3U1PA 1AHWC 2QMKA 1ZLSL 1AKJB 4QUOA 5GRVL 3WNNA 2ZYSA 2C9VA 3VFRB 2OMUA 3JT0A 3NJNA 3EIFA 5C0AB 4GKNA 3HN5A 3RWJB 3F8UB 4P57A 4R7XA 5GRWA 5CLTA 3SKMA 3VG0L 1UZ8A 4OQ1A 5BOPA 3SKJH 3F6IA 3DWTA 4M7KL 5ES4B 1OF0A 1Y18A 5CJQL 3DIDA 4FXGC 3NYKA 3UC2A 4WRLA 1I1AD 3V0FA 1OQXA 3IAPA 4LCWA 3ZO0A 1WGVA 2Z31C 4WNQB 2VXQA 3HFML 3F01A 5A3IC 4AQEB 2ICES 4NNPL 3QJHA 5H37H 5DO8A 2B1HL 1NEUA 1D7CA 3MLYH 3P3YA 5J89A 3G5VA 1CD1A 1WHPA 2XNAA 3NJIA 3T4AB 3UTTE 4B5ZA 2JKWA 1KV3A 2X0WA 2NY1C 5J5EA 4HUCA 3LZRA 2DIJA 1YC8A 4LCWD 3VWJC 5IIEA 1RJZA 2EKJA 1CT8B 2HVKA 2GUOA 1JWUB 3NJGA 1N26A 3AG4B 4XN2A 5D96B 1OSPH 4GG6B 1E5AA 3SODB 4Q9QH 4YHOH 1ITCA 3PL6D 4Y4KB 1M2VA 4S1QH 3VRIA 3VQLA 1YEJH 4YE4H 4ELMF 1YYMH 1F8TL 3KEHA 5DJ0A 2KH2B 4HC1A 4PS4H 3EJZC 3KYAA 3LQMA 5E8NA 1HS6A 1IIIA 1SJHB 3GMNB 3BQVA 1FUNA 4BWTA 2CU9A 1B0IA 5ALCL 5J56B 4XNZB 4YDLB 2A7BA 5I5JA 5DHVB 5HHMB 1D9KD 2XFXB 2XHNA 4L4TA 1U58A 3N43B 4X8CA 3L13A 4M4RA 1PKQE 5EEXA 3EDKA 3DX3A 2X41A 3GRBA 1CGTA 4HIHA 4LVOB 1J87A 5DK0B 5DXWA 3TEXA 1JWMA 5TQ2L 4PRNB 3MLWH 2EXYC 4L4TD 4W68A 4ZYKB 3RX5A 3B37A 1T4KA 2ZG2A 2C1OA 4NLAA 2AVFA 2OAAA 2Z1PA 1W0WA 1LJMA 1NCCL 4D0BB 1AC0A 1PGRB 1X5AA 4ZO7A 5A2JH 2DOCA 2B13A 5HGHB 3QYCA 1YEEL 3IMRA 4CGUB 1DJZA 3OZ9L 4FQXB 1FNFA 3MXWH 2XWRA 5A2CA 3BAWA 1KY6A 5DMIL 2IAAC 2XQBL 1MY5A 5CJOH 3FHQA 1I8IB 2HXAA 3FT2A 3HVNA 4NQCA 1S4IA 1VPOH 4HLZG 3MJ8A 2OMBA 4W9HC 4JFDB 4AUJA 1OKEA 4YAQA 3IETA 5J0BA 3DVIA 3KPQA 1GL4B 1SM3H 2FATH 3C6LC 1JV2A 4IYKA 4R90L 4KK5C 4R7LA 2EH7H 1IMHC 3UYOD 1FO0H 1XCXA 1ZPLA 1M57B 5DC4B 3G6AA 3IFOB 1DBBH 3MLTA 5DJAB 4ZUWA 2EDEA 3CFCL 3O6FB 3ARTA 3V52H 4DFIA 3ZDZF 1CLYH 2QQLL 1T83C 1HWGB 3ZHLA 2FJSA 1WH0A 2CALA 2ICWI 4IOIA 4L8SB 1Y1DA 4N9GB 5D7IA 1I1FA 5IB2A 4LPWA 1BPVA 2LAAA 2M8XA 1CQKA 2Q7YA 4A38A 3HNTL 3ETTA 2X1OA 4UIKL 3WN5B 1X5GA 1UJ3C 1UM4H 1G7IB 1HDMA 1M9SA 5MENE 5DLLA 3VB9A 4GIPD 4LOEA 2XA8L 3OPZL 1XQ4A 4LDCA 1MIML 4M7JL 1U3NA 4U7MA 2D7NA 4MWFA 5F93C 4KO9A 4P2AA 4X4XB 1E42A 2WUCL 2NX5A 2ZUQB 3KJ4B 3RVTD 4LRIC 3VE0A 1B4JH 2MQGA 1AYRA 2J2ZA 3F7KA 4N85A 1MDTA 2MQCA 1G7PB 2XQ0A 2WBKA 1AZVA 4UBDD 5F7NC 2ADIA 3KGUA 4ZDHB 2OLDA 4WWKB 2ISDA 2R9HC 2I9LA 1U3YA 2BX5A 1CZ8L 2CIKB 3CK0L 4O58L 4G1MA 3BH8B 1DLHB 3CZKA 4AIEA 3ZHFA 1QPPA 3TESA 4YHPB 3C75A 2DF3A 1U8CA 5D7SH 5C92A 1OP9A 2HT3C 3KPMA 5FKAB 3QQ9C 1OZTG 3PWNA 1SLUA 4YBQD 1XFPA 2JJSA 4NGHL 4NQDE 3FCBA 4L1DA 2FO4B 4M7LT 4KDWA 1G9ML 2F5BH 2E47A 1KXQA 3JWNG 3QDHA 2GSMB 4DKDC 4JUSA 4P04A 4PJAA 3CFDA 3UYRL 3A0OA 4O2EB 4Z7WA 4HSAC 1FSKB 1N6QH 4YO0B 1LO4H 4Y5XC 1HQ4B 3FH8A 2PP7A 2YGNA 3VXRA 1ND0B 2E7BA 4GXVH 1DVXA 1BQLL 5MI0B 3HRZC 4HDIA 3RU8H 1ROCA 1BDYA 1YMMA 4P46B 4X6BB 2G5BB 2H9GA 4K8RC 4HUVA 1XB8A 4GB9A 4C57C 3CCHA 4HT1H 3IJEA 1SY6H 2MIZA 5JHDE 3VH8G 4PB9H 1JNLH 1QQDA 1FRGL 2IV9A 2CHXA 4PWEA 5J3HC 5CKAA 5DEFA 1UM5L 3E6HA 5HI3D 5CP7A 1AQMA 1U41A 3LN5A 2WBJC 3TIEB 4A39A 2H41A 5AAPA 4P5KA 5C7XL 1YMMD 2YKLH 3MGOB 4WFED 4K73A 3F7YB 4KJPD 2FX8H 2BSCA 4JHWL 2OI9B 4IRZL 4NS0A 3EJUA 5KSAB 4GW4A 3QPXH 1MFBH 4OVUA 5KUMA 4QRBA 4TVUA 2P5EE 1J9QA 1U8HA 1YN7A 1BV8A 4ODTL 1CBVL 4U49A 5E1HB 1RVFL 2EYRA 4J3OG 2XX0A 4UIMA 1F5WA 1EK3A 2QGCA 3L3DA 5TE6L 1JVLA 2EDRA 4QHUB 4YDJB 2LR4A 4AVHA 1AHKA 4Q6YA 5GZOD 2OMWB 4GAGH 4XNUH 4IHBA 4WI3A 2QQNH 3O0LA 2ESVB 4OZHB 4X6DE 3WTSA 2HTLD 2NZ9D 2AJXL 1ZPUA 3VM5A 1NGXA 2CJSA 2HRGA 3RJDA 3WLWC 2DQEL 4A2EA 4WFFD 4IIQC 3IJYB 2VERA 3JTBA 1S5IH 2H0FA 4PWJA 2JJTA 4P2QE 2G0LA 3HLAA 4M6NH 1EHNA 2R56H 5FGCB 4NKMB 1AQ8A 1URIA 1NH6A 3UOAB 3PAUA 1N9PA 1K5NB 1VENA 1WWAX 1OGSA 3LQAL 5GXBB 3LN4B 3WDIA 5C0FA 4K9EH 1DQML 1VEOA 5GSRB 4FXKC 4KK8D 3EJSA 1H9DA 3VRJB 3PHAA 3ABMB 4FQCL 5DS8A 5AOZA 5BO1L 1OLLA 4NRXA 5D7LE 2OMXB 3GSQB 2F53E 3RQ3A 5DVOA 2HH0H 5I8EB 4DUWA 2DKSA 5ID0A 2IEPA 4BFBD 4LESA 1FLRH 4EDWH 3B34A 4JHAH 3DROA 5SX4H 4I0PD 2WVVB 1NC2A 4FOMA 3SB3A 1GW6A 4LSQH 2LQRA 4AJYV 3BKYH 1QEXA 4UV7L 2ZYHA 4NYLB 3QFGA 2AS5M 3KWTA 3CFTA 5AWNL 1SXNA 1KGUA 1I9EA 2F74A 5D1ZI 3D18B 1TZAA 3UAFA 3AT0A 5GS2H 1MJ7H 2Y0SA 1MI5A 3PWJA 4HD9A 1BVNT 3U7YL 1QSFA 1WISA 2D0FA 3GHBL 4YSRA 4CN4A 2WQVA 4GSDL 1CK0L 4W9CC 4UTAL 3MRPA 5I8KL 4QO1A 2OMYA 2QPEB 2XZQL 5IVOA 4QJ5B 3GJEB 1R3JB 3QRGH 1I3GL 4PG9A 3NT0A 4FFVC 3ULUL 1FVEA 1MI5D 3T6ZA 4FZ8L 1A5FH 4N2BA 1QSFD 4ZAKC 1ZGLB 3ELQA 4PU2A 4L4VB 2JVUA 2WNXA 2WIIB 3JV0A 4HEMA 1N8ZB 4MNQA 1QR1A 2ZJSH 1OCZB 1BHGA 2AF2A 5DURB 1KOAA 4L3EE 3ARDD 3MRCB 5D1XE 3VNZA 2CLZB 3KPOA 2E9GA 1S46A 4J8RA 4Z7OE 5A2FA 2QKIB 3PDGA 2ENSA 5KVFL 4X4ZA 1KB5L 2FJUB 1S7SB 2R0WL 5DVNA 5AZEH 3WIHL 1X7SA 2CQVA 4MNQD 4QHNA 4I0CC 5D72L 4WKZA 3RVWD 4BXSV 1RZJC 4QDGA 5AW5B 4JDVA 3CFJA 1K72A 5GRYA 3S8WA 3FSOA 4EIUA 4L3CA 1BZ7B 1N68A 3Q6FA 2A99A 3ULAB 4HW6A 4HKJA 1E7UA 1JTTA 3DGCR 3II3A 3L3OB 3MV9D 1IVTA 4G8GB 4JFXA 4WEUD 4ZQKB 5F7LB 4EMZA 2KQMA 5FUZH 4NKIH 1N70A 3IU4H 4IRJB 2K78A 3RKDC 1QA9B 3VI3A 4J4PD 1DVUA 1HH6B 1UENA 2EE2A 2KZWA 4NZ8A 1LNUA 2P8MB 1IARB 4X7DC 2JELH 1CMOA 1QFHA 2QVIA 4CADA 2BXZA 1PFCA 3GNMH 3B43A 4OLZL 2X89D 1MUJB 1NAKL 1WBYA 1KZQA 2E6PA 5A1AA 1OGAA 4GSRA 1S7QA 4QXTB 3BPOC 3VSQA 2VWEE 3E3QE 2G3NA 1WAAA 3V6BR 1NFIB 3VG0H 4F27A 3VGAC 1WZ1L 1HZLA 3WE6A 3RWFB 4PRIA 4APXB 2ETWA 3GKWL 4M7KH 1TZHB 1X3DA 3RB5A 4LPCA 2EIBA 1YEGL 1AGDB 1A3LL 1F2XK 2ZWNA 3FFCE 1OGAD 5J9PA 5G5DB 3V4LA 2EXWC 5BPPA 3NK4A 1HCVA 4BQ6A 3AS3A 1YPZE 4CNIB 1IGTA 3AS1A 3SGDI 1I9IL 1C5DB 3HFMH 4AQ1B 5ICYA 5IWLC 1NFDB 4NNPH 2FAUA 4PRID 2B1HH 2EEXA 3MBEC 1OE2A 1OO2A 3OB8A 4HJ0C 4EI5A 5T3XE 3B9AA 3UCRA 4AENA 1XDTT 2L8AA 4PN6A 1M1SA 1IZJA 3KYNA 4P0DA 5IQ9A 5B39G 5MEPB 4MCNA 4JVWA 3STLB 2C9XA 3T2PA 1ZWIA 4JHUA 5TK2A 3IWVA 1S9WA 3QI9A 3BVDB 4PH8A 4Y1AD 1HNYA 1Y6MR 4EI0A 1NJ9A 1QMUA 1A66A 1VRSA 2H2SD 3X14A 4M1CC 3IRCA 5E03A 3CC5B 3HUJB 3QI9D 5IMOB 5ALCH 4JJOA 3VXUE 4HIJB 2YAEA 2A83A 3JVGA 2CGRL 3QPQD 1J5OL 3NZ8A 2QQQA 3LS4L 4LQ1A 5B8CC 1KSRA 1ZK9A 3L16A 4EN3A 2W65A 1HNFA 3VWKA 2A2QT 3GIZL 2YSTA 2PP9A 4PJCF 2NY0C 4XNMB 2Z8WC 4NZFA 4JREC 5TQ2H 5D1QB 5AW3B 4RGNB 3SE8L 3QUMA 1DE4B 2ICWA 4H5SB 3ZE2B 4KMLB 4M9PA 3R4RA 1CI5A 4M8QA 2NXYD 1IGFL 3EHBC 2BNRE 2AQTA 2G9HA 3VWKD 4CJ0A 4EN3D 3CFBB 4WI0B 1DVFB 2GJJA 1URZA 1NCCH 4J3SA 4XMLL 4FNTA 4P5SA 4HWNA 1RPUA 5IB3A 2OXGB 2P5WB 5FA3A 4FTVA 5H35A 2W1NA 1YEEH 1XR8B 1O7DC 1MCSA 3SDXE 2HFEB 4IKLA 4YHKL 4ZBJA 4MVBD 2DH2A 1LVEA 4O2FA 1AD9B 4L8CB 5EC2A 5DMIH 1YNTF 3ZY7A 4TQHA 4Z23A 1RLWA 2YO3A 4IK6A 2WM0A 3U4KA 2WOBA 2EKSA 4RISL 1O9ZA 2PWGA 3BZDA 3FB5A 4L8BA 4R90H 3GLDA 4FS0A 1MXGA 3GSNH 3KHQA 2C9UA 4P23B 2BP8A 4QOKE 4DP9X 4P8QA 3R06B 3P77B 4M62L 4UOQA 1KXHA 5DK2A 1IAIM 4NERA 5T1LA 5JZ7D 1D5BA 1L3NA 4BZ1A 2QQLH 1J05A 1YY9C 1KY7A 3QDMA 4C58B 5ECGA 5CCJA 2ZWSA 2IAMB 2YEQA 3DBSA 4AEIL 3FO9A 1KIQB 3U36A 3N1GC 2NSXA 1G7LB 2OA9A 5F0LB 4DOHB 2FJGB 2YPLA 4W9JC 2K9UA 3TBWB 3HNTH 4UIKH 1GGBH 4XOBA 5LG1A 5T1LD 5F1IA 4BH5A 3B9KD 3EJQA 1J8HA 5C0DA 32C2A 1AI1L 4XMZA 3QDMD 2R2EB 1X5MA 5EUKA 2XA8H 3OPZH 1DO6A 2DYPB 1XR9A 4M7JH 5DFVD 1OXYA 3KLDA 1WA1X 4A2FA 4NN7C 4RETB 3P3RA 1JCKA 2DPKA 4WO4C 2ADFL 4G8EA 2YPLD 2WANA 2NXZD 5DS2A 5F9WB 1YECL 3UL4A 1J8HD 2VW4A 5DRXA 1H15A 4S1DD 5FK9A 3K4ZA 4MJ2A 5TH2B 1LE9A 4Q4EA 3CK0H 2GSIA 4O58H 3K71B 1YZZA 2H32A 2WXNA 3OHXC 1ZDQA 4IDJL 3APDA 1VFBB 4E42A 1GLAF 4XAWH 2N4IA 1WA2X 3EBAA 1VKXB 3LKRB 1FZOB 3ZDWA 1XGQA 1L9QA 4HCRL 1X44A 1I8LA 2VLJA 1ZAGA 4NGHH 3SKOA 1JHLL 4X2UA 1WRFA 4A2DA 3QS2A 4KMQA 5KYWB 1NC4B 1G9MH 1JMXA 1XBDA 3UEZA 4DJMA 3RDTA 2D2CC 3CFEA 5CSGA 4Z7QB 3UZEC 2WTRA 4GKSB 3T4AC 2IPTL 1G7HB 3UYRH 3V6ZB 1BOGB 2SODB 3VH8A 3B2UD 4KX9A 3DV6A 5I1LB 4POZD 1CO1A 5IJVA 2EDMA 4TSAL 1GJWA 5D96C 1WFJA 1JZ7A 1S6NA 1BQLH 4QCIA 3SDAA 4HWBA 1T03L 5C09A 2RH0A 3IS1X 3L95A 2I7OA 3IDUA 1ZVSA 1EH9A 3KEDA 5G4NA 5AG9A 3TH3T 1S78C 4LL9A 3GSRB 2AVGA 1FRGH 1X5XA 4PRDB 3DX1A 1XF3A 1KIUA 1I9JL 5C09D 1EZSA 4XNZC 1I85C 3K81A 4LDEB 4ONHB 1I7TA 4JHWH 4X5WB 4LBAA 5G4MA 2VDRL 2DJ4A 3EAKA 5IHLB 2Z0UA 3WI9A 1XO8A 2VISB 4IU3A 3U2SA 3QNXB 3RWEA 4F7MB 1PZCA 1N6UA 3PGDB 4J3OD 1Q0YL 4ODTH 4X8GA 1NGZA 1CBVH 1RVFH 2R7EB 4OCNC 3B5HA 5F7YC 5DI8A 5BQ7B 5TE6H 3O6LL 2JMRA 3VD3A 4Z3HA 1NWPA 3FKUS 2X40A 3WJJC 1F97A 5SX5H 3PV6B 3QR1A 2XSKA 4DHLA 1GR7A 4B50A 1EFXB 2AJXH 5TTRA 4QHKI 1JD7A 1PNDA 4UZSA 2DQEH 3WNJA 4TN9A 1RHHA 3GMLB 4L2LA 2P5PA 1UH4A 3K7UA 3FB8A 3ORJA 3NGBC 3QEUA 3UTTB 3LZLA 4U3SB 5T3ZD 2WSKA 3AS2A 4GQQA 4JR9L 3DNKA 4QNPF 5D1ZD 4PUBH 5L2JA 1NICA 1W0VA 3DSNB 2WNKA 3NJMA 3HE6C 4W6WB 1ID5I 1AACA 1T7WA 4FQCH 5BO1H 2Q5BA 2OSYA 3JWDH 4Y4FB 3V4VB 1KT2B 4P06A 4OQTL 5HHQA 3JV6A 2QLVB 5I75B 4PSRA 1EMTL 1S9YA 2OYPA 3KBPA 1QFWM 4K5OA 2CBMA 5BNXD 5FFLA 1AS8A 1G6RL 2E8ZA 1TTUA 4J5VA 3I6KB 5BS0E 3HR5B 1SDYA 2ZXDA 4MJ5A 2EIMB 5EBLA 2FUTA 1S7RB 4L8SC 2Z91A 4PJ9A 4GBXB 2YEZA 4UQ9A 1GC1C 4M7ZC 3VTTA 4TVPE 4NO3B 4UV7H 3BLBA 4PJ8A 3V5HB 1RZ8B 2VDML 2IWKA 4KNUA 3PPEA 4HJTA 3T0EC 1KFAL 2APFA 1KGIA 1J9SA 3EJTA 1HXKA 4P59H 4M3HA 4QRQA 3GXNA 4MCZA 3LKNA 4PJ9D 4JFPB 1WBXB 4ZFFA 3KJ4C 4NT6B 2GHZA 3U7YH 3GHBH 4ZFGL 4NQSA 1BIIB 4GSDH 4UTAH 3T08A 2ZSVB 3NIFF 4XODA 5I8KH 2B20A 2X0UA 3QE5A 2JJWA 2OZ4L 2PUQT 2XZQH 4NLHA 2J20A 3H54A 3ZQ9A 3MN8A 4JCLA 3GMQA 1I3GH 4X0KA 3NSYA 5HYJA 2CR0A 2OJ1A 4FZ8H 5AEAA 2BZCA 4Z76B 3PXHA 1WHOA 2CXGA 1D5ZA 3N55A 4HULB 4JGJA 1Q72H 4XP9L 4ABWA 2PXYB 2ZAGA 1IVLA 5HYJD 1R3IL 3PABB 1MHCA 2YPKA 2ED6A 2I25N 2RR3A 4KKLC 5GRVK 5GIRB 1F56A 3PHOA 4U6XB 4A7VA 3QRFM 1C7SA 1S9VA 3TBYA 4PYGA 4XMWA 1KB5H 1P4LB 4WQOA 1I7RA 1UH3A 5CUSL 4XO9A 1BBDL 1JNHB 2GVYA 4KXDA 2VYRE 2BOCA 2R2HA 4WDIB 5CMAA 5D72H 1PBYA 1KLUA 3FB6B 4HGWA 2PW2B 4FAAB 4WHTB 5IOPB 2OSLB 1UGNA 4M56A 1S5HA 1PG7L 5CD5D 2X4SB 2W9DL 1ETJA 4WO0A 3ZZLA 3EOAA 4XRCB 5FUCE 3T2NH 2AJUL 4LLUA 4NXKA 4A67A 3BSZA 1KBGL 5MENB 3ARVA 2VIRB 1I8KA 1GGUA 1T21B 2Y1AA 3L5XL 4JO4L 3PHSA 3PP4L 5EPMB 2VR4A 2J8UB 3ZIYA 5LGJB 3FTUA 4CKQA 4OLZH 3U1SL 4R4BA 4YHYB 2P8PB 2AAAA 1NAKH 1IGYA 5GS0C 5A2KH 4H25A 5IHWA 5L0QB 4AW7A 1J18A 4TUKL 3DK0A 4B3VA 1OT1A 4P3CH 1X5ZA 5I73C 3O4LA 4XGZA 1JGLL 2WKGA 3D9AL 4X9IA 3TVMB 1VZGA 1CBJA 2OJZH 3GSXA 4OGXL 4U2ZA 3E2HB 5F3BA 3F64A 1E4KA 1L6PA 4G42A 1EPFA 1YAZA 3HIZA 2WOYA 1YUHA 3ROLA 5CF3A 1YEGH 4L9LB 1A3LH 4M8UA 3BKJL 4NQDB 4I4WA 5B39A 2XWTA 3O4LD 2YRBA 1FFTB 1I9IH 3BKMH 3QUHA 3U9PL 5IF0A 2OYMA 4LPUA 2IJ0C 3BPNB 4L4TE 3VA6A 4MMYA 1E8ZA 4IBYA 2XU9A 5ACZA 4G11A 4LKXA 3EG9A 3FUJA 1V7ML 5C6WH 3BVTA 2OMVB 4P9MH 3QFDA 3ZKNC 2GC4C 3L3JA 1GSMA 3Q2WA 4BSWB 3CTTA 2TRHA 4PR5A 2Y72A 2ATKB 1JN6B 2G4GA 1P53A 1TQBC 2DLTA 3PWUA 4FG6C 4WK2B 4BSJA 4RMSA 2A3TA 2WAHA 1F4XL 4GW5B 4ONOA 4DGUA 2B77A 4K8RL 5INDA 2J4WL 3LXBA 3K6FA 4IJ3C 4KQ0A 2P42B 4JFQA 2XN2A 3E9UA 4Y19E 1KJ3L 4CVZA 2F18A 2AV7A 2NY3B 3Q2VA 2CGRH 1J5OH 3QJSB 1ETA1 2EEBA 2FUQA 3JXAA 4MDIA 3LS4H 1BAGA 4Y5YB 4Y4HA 1WO2A 1JOIA 1AIFA 4NQCE 2IBZY 3U6XA 4ETQB 5I8CA 3ULVC 2P5EB 3MODH 5IEKA 2H47C 3N44B 4PREA 5IB5B 4IRSC 3IT8D 1EJOL 4DP1X 1U95B 3WXVL 4YE0A 4WKXA 3SE8H 5CEZD 3QUZA 5GGUA 1MOEA 3FF8A 4Y4HD 2BSSB 5CCKL 1IGFH 2HFFA 2X9ZA 2Y6TE 4I8DA 1PKOA 3KGTA 1PZ3A 1AGCB 3AZUA 4X6DB 2G3MA 3MOBL 1CDIA 4QRTA 4X7TB 3TV3L 2PMZA 4XMLH 3T3PF 7PCYA 2RGSA 3QUZD 4KV5E 4TPRL 5D7IE 3OJDB 1WFOA 4N2KA 1N7ML 3TPKA 5SWQB 5E6IC 1CIUA 1QW8A 1BIHA 5JIIA 1CLZL 1KPUA 2H45A 4P2QB 4BHUI 4JBSA 3SDDC 2OK0H 3WNKA 3RVUC 4BH7B 1DBJL 5CZKA 1FA4A 1DBML 3HE7C 1PZDA 2DI8A 3VXSE 4PBXA 2C3WA 4FA8A 2W80C 4TNFA 2NX5E 3QCUL 3Q8FA 4RISH 3GXFA 1WFUA 2X28A 3D06A 3BVNA 3REVA 3OSKA 4ZX6A 5D7LB 3RWCA 1NAMA 5EBWA 3X11B 2F53B 3SJVA 2NUPA 4H26A 4M62H 2V3DA 1MFAL 2JIXB 2R51A 2X4NA 1YEWA 3GXDA 1YJDC 2BNQA 3QEQA 1ZLVH 2ALWA 1A6VL 2EDBA 2CKBA 2X4TA 1KIRB 2J12B 3EO9H 3APCA 4AEIH 3L4XA 3L3OC 4BFOA 2QPUA 4OFQA 4R5VA 4YZWA 4XTRC 5DHEA 3RIAK 3QIWA 1W8NA 4IRJC 1B0WA 3V5KB 2BNQD 2QTVA 3QEQD 1KXQE 1GSKA 4OH2A 4L8DB 4WU7A 4CL7A 5GRZA 2VQUA 4LHQB 1PJ9A 2WVUA 4HX1A 4PJAE 5IQOA 3LSOA 5KG9A 1LGVA 3BW9A 3M1BB 4GT7A 4PGBB 4Z7WE 3EO1B 4Z7NF 3MRHA 1LL1A 3C8KA 1AAJA 2DI9A 4BXVA 4N0UB 5JHLA 2ADFH 4PCSA 3VXRE 3QIWD 3N0PB 4ZFOL 1YECH 1F3JA 3ESVF 1YMME 4EEEA 3X1BA 4WFEE 8PAZA 5ERWB 2ZOKA 5IUSA 4N3TA 4PP1D 4IDJH 2ZKYA 4ELKB 2Y2YA 5FF6A 4NO2B 3W81A 3L7FB 2DYSB 3JYCA 3FTYA 5BQDA 4HCRH 3MUGA 4KK9C 3S4SB 4G82A 2HMIC 1MCCA 1S7VA 1T1YA 1EGJL 1NBCA 3D6GA 1JHLH 3NFNA 4UAHA 4F2MA 1U4EA 4AQ8C 4PWGA 3SO3C 3IGKA 4UTCA 1A6TB 3UTZB 2WQWA 4L3EB 1HVXA 3TM6A 3V4PL 1HL4A 4F9LA 1ICTA 5D1XB 1IBDA 4B9YA 4Z7OB 1FNAA 2IPTH 4DVRL 1JRHL 4PJDE 3D0VB 3IBEA 1TU2B 3BPLC 3LH9A 4K3GA 4ZS6C 4AM0A 2EIZA 3O8XA 1P6FA 2X3CA 1LE5A 1UEYA 3LZFL 4FFWD 3K6DA 1Q90A 4KXCA 3OLIA 4G5AA 3QH3A 4WY7L 2NW2B 5F44A 1AXSA 2XZZA 2GY7B 5DQDL 1T03H 2R69A 4M61A 2LLGA 4E9SA 1IE5A 1FPTL 3SDCA 2IH8A 5SX5K 1KTDB 5KSBF 1RZJL 1Z5YD 3QUYA 4QKTA 1ADQL 1OAJA 3BGMB 4ODWA 2D3JA 5KUKA 3FCTB 1DUZB 1T04A 2M2DA 1XAKA 1JFQL 3GB7A 3ZDXF 3AXIA 3ZBMA 2HJKB 3FN0L 2UXGA 1PL3A 4WWID 3SDCD 2CDFA 2XWBA 3S36X 2D31B 1KMGA 2F8VA 3QUYD 3UBXG 4AZ8B 5DMJB 4Z77B 2VDRH 5I9QB 2WXRA 1KYDA 4OF0A 2ARJQ 5AW2B 2FGWH 1UB6B 1L9MA 4JPKL 5AB1A 4I18B 5CZVH 1B2YA 2ZE0A 5E00A 5KSVA 2A6IA 4OZGA 5DZPA 4NO0A 4YHLL 4R5XA 2ZKWA 4RGNC 1NIEA 3UMNA 4DH2A 2EE9A 2XRAL 1VACB 2GBVA 1DR9A 3MRRB 3IDMA