2HSIA

Crystal structure of putative peptidase m23 from pseudomonas aeruginosa, new york structural genomics consortium
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
257
structure length
227
Chain Sequence
SFIMRLLNKPVPGGVAVVDLGEEGPPPRAFYQGKPVLVVREEGRRWIAVVGIPLSTKPGPQKLEVRAATGNHEERFSVGSKPEDLKRIERELAEQTAAYRRFSPGLPSNLMLDKPVDGPLSSPFPHSGLDFAVPAGTPIKAPAAGKVILIGDYFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIFIGAFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of M23 Peptidase from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
molecule keywords Putative peptidase M23
total genus 58
structure length 227
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18421 Peptidase_M23_N Peptidase family M23 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1590 Mainly Beta Sandwich Immunoglobulin-like Peptidoglycan hydrolase domains 2hsiA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 2hsiA02
2GPRA 4QPBA 1GPRA 2GU1A 3IT7A 4RNYA 5B0HA 2B44A 2B13A 3TUFB 3IT5A 2F3GA 3UZ0B 1GLAF 4BH5A 1QWYA 3OURB 4ZYBA 3SLUA 4JBWM 3CSQA 4LXCA 1AX3A 4RNZA 4QP5A 1GLEF 3NYYA 1GLBF 1F3ZA 2HSIA 1O2FA 2B0PA 1GLDF 1F3GA 1GLCF 2MP0B 1GGRA 5KVPA
chains in the Genus database with same CATH superfamily
3LEVH 1XB6A 4I3GA 4JFFA 3H9SA 5DMJB 2DQCL 3C8KB 2P80A 2CLVA 2XQYA 4RRPG 1HXYB 1ZLVK 1JHTA 3V4PH 4PG9B 4D7BA 3BP6A 4L29A 4UT6L 5DUML 1KGJA 2A38A 2BOLA 4IEFA 4KI5D 1T1YA 3P77B 4CU6A 2D0FA 3BP7A 5I1EL 2OMVA 1CXFA 1NBVH 2OLDA 1NUFA 2XNAA 5GHWH 5FYKL 3UPCA 3K1DA 4WUUA 1DQTA 4I85A 4N4YB 5E94A 1MCDA 4BZ1A 4F37F 1NC4A 1CGYA 2WJ7A 1BFOB 2FT8A 3E6HB 4OZFH 5C08D 5E8DL 1N8ZA 1TQCB 4JFED 3CDZA 4X6DA 2ZSWB 3ARFD 2HJKA 3IFLH 1B0RA 3BPOB 3UL4A 3IXAB 2F53B 1S7TA 5FXCH 2X38A 2I26N 3P9MA 3WLWC 4C58B 1CLOL 1SLVA 1NIEA 1QSFB 4P46D 1FYTA 3FF7A 3GZKA 5L2KA 3GRGA 1R6VA 2HRPL 2ZXBA 1WZ1L 1SYSA 2Q7NA 3MUGA 4XE0A 3SO3B 1CUOA 2ERJC 4KK8D 1O9VA 2JJSA 3F12A 4AG4H 3PP3H 2QLYA 4MA1C 2EDWA 3KWUA 2HVKA 3IPEA 4XVTH 1QFWH 2XN1A 5EZOH 1M2VB 3UTSE 2ZD0A 2J43A 1JZ6A 5AOMA 3CFKA 2IQAB 2FIKA 2NZ9C 3SKUD 3FN0H 3CN3A 4S1RH 4YDIL 5CCGE 4L4JA 2WXHA 4J3XA 4DF9A 1BBDL 1WAAE 4M6NH 5F9WB 1WZAA 8CGTA 1IGYB 3IT5A 4DUVA 1C12B 2K0RA 3SE6A 3ZW3A 5C9KA 5D7JB 4FQIH 2VDLH 4ODVL 3LB6C 4QNPE 3B9AA 4JKPH 2NX5D 2YAHA 2VH5H 3CJJA 3KPRE 5DEZA 5AVWB 2OR9L 2IFFL 2LU7A 1CXEA 1P7QD 3TJPA 3SDCA 2PPCA 2J6EH 3RB5A 1D5BA 4G6AC 1RP8A 5BRZA 1G9HA 4PV9A 2B4CH 3GK8H 3ZE1B 1N5YL 3H4FA 5IJKA 3IU3B 2JELL 3QO1A 1HFUA 4PG2A 5TFSL 2ILLA 1O5PA 2XIDA 5I18L 2YXWA 3DTDA 4HCRH 5T5FH 4GW1B 3L9RB 2DTMH 4GSRA 1A9EB 1WA2X 1XF4A 3QR2A 4U6HA 3UAFA 5KW9L 1ITCA 4L5FL 3KDMB 2V9RA 4Z9KB 4UZSA 2KDYA 3TYFA 1IKFH 3RVVD 1YJDH 4JR9L 4XP6L 5E08L 2ORBL 4I3RH 3TIEA 1HINL 1ZHNB 4Y19A 3QEUB 3CHXA 3EOBB 1R3JA 3KS0H 3VW3L 3L1FA 1YNTA 2YPVA 4FX5A 3BHBA 4X5XB 4X9HA 5LDUA 4MJ6A 2J88L 2SEBA 1QR4A 2X0VA 4RX4D 1S7VB 3UBXB 2NNRA 2ZX7A 3W2DH 4M7LL 3NBNA 4NQEA 4M8VA 5JQIB 3WDIA 1FC2D 5T3ZD 4MJ6B 1S9YA 5BUGA 1KV3A 3CLFL 1KEGH 4WFEE 3CFDB 1AXTH 1E6JL 4HAKA 3MNZA 4YZFF 5C0AE 1YEIL 5T1LA 4YE4L 5KVFH 1B6DA 1SM3L 4UNIA 5IP4A 1NSNL 2XFGB 2AHIA 2YZ1A 4PMFA 3K2UH 1QSVA 2GFBA 2JB6B 3O2DH 3ML9A 2P49B 5B3JF 4Y16A 1L6PA 2IAND 2I60L 4N86A 4R83A 5ILTH 1OK8A 1YMMD 1EQWA 1K3ZA 4OJFH 1IGTA 2NNAB 5CU5A 4PRPA 1E9QB 3IJHB 2CQVA 4NXKA 1T2QH 5AW8B 4N2EA 4NKOB 2QADB 2NDGA 4URTB 5CGYD 5LQBL 2DLGA 1CLZH 3WKQA 5IQMA 4ZQKB 1F58L 3H9YA 1NTDA 4LSTH 4LLAA 3BEWA 1ZA3A 3GMNA 3Q01A 4MYWB 5D7JC 4MCMA 2F53A 3ZT7A 4XMUA 3LN4B 3BKYL 5GRJH 2I27N 4X6CB 3NRPA 4N2MA 1RI8A 1BVNT 2Q86B 3GMLA 1L9MA 1VADA 1QOKA 2QELA 3EFDL 1W8EA 3ZRSA 2W07A 1ZS8B 4Q4EA 3P73A 3VGAC 1LL1A 1CBVL 1JPTH 4QR7A 3UTSB 3X12B 4LAQH 4ZSOA 3MRLA 4HZLB 4PV9B 2MQCA 2WAHA 2XTJC 5E1AB 5DRZB 4LLWB 5GSRB 5I1AB 5I1CH 1N7ML 2AXWA 1JAEA 5E99H 3M1BA 2CJ3A 4ZMTA 4NQDB 4U1GB 4ZFOA 3OLGA 3KEHA 4K71B 1T7XA 3KDPB 2QHRH 3Q2LA 4PJHA 1QRNE 1CC3A 3ULVD 3LRMA 1IKNA 5FPIA 4KDVA 4EQ2A 4NNYA 3GB7A 4LCWB 2H0JA 3LPGA 1U91A 3BAXA 5A3IC 4R4BB 5LNGA 3X1GA 4G3YH 2AV1B 4PRDB 1SXCA 4PR5B 1NAMA 3AU1A 3APCA 3MX0A 1KZYA 2XXFA 1UWFA 1ZHBA 2VLJE 3DX1A 3E0GA 2OP4H 2VLKA 1RK7A 3JUYA 1WFIA 4BSVB 2BNRB 1NCBH 2DLHA 3ZKMC 1OGAA 4XMVA 2ZWZA 3VD4A 1A64A 5DVOA 1IM9D 2A77H 1ODAA 4Y1AD 5EU3A 3O6KL 1FJ1A 3TYFB 5I1LA 3HE6B 2JJSC 4QYOB 4RAVB 5G4OA 5IBTH 4RDQF 4L9DA 1VHPA 3CGTA 3DLQR 4RGOL 3IAPA 3NUKA 3HIZA 1NAKH 1RK0A 1C8PA 1JBJA 2DDQH 4JFYA 4KJWC 3NCYP 3H9SB 3O9WD 4FQLH 2MNWA 4BSJA 1RZFL 3B3IA 4X98B 4PRNA 4L05A 2IANE 5JMRA 5CJ8A 1U8NA 1NEZB 4G6KH 3QQ4B 3LS5H 2BNQE 4JW3A 4XC3H 2RGSA 1KPRB 1GKOA 2H3NA 1I7TA 4BSWA 2N4IA 4KROB 1S5HA 3PNWB 4B97A 3QDJA 4XPGH 1E4XL 4ESKA 5EZPA 5DEFA 3ULUH 3HNTL 3KS0J 4XHJD 1A2YB 4PJFE 4E42A 1RJLA 3MRBA 1AD9A 3G6JB 1P84K 1ADQA 1TVHA 4QDGA 4NZJA 2F7OA 4A2DA 3P2TA 5I1JL 3ASWA 4M7JL 4TNGA 3P3TA 1TTCA 1ZV2A 3FTXA 2WNXA 2E56A 3ARFC 5D7JA 4A2HA 5CFHA 1LM8V 4M1CC 3KMDA 3GMQA 2FJUB 4K4KA 5BRZD 4E0RB 1DVFD 3TVMA 1TZIB 1UACH 3P4LA 5D70H 3W81A 4XPFL 4M7LH 4ZFFA 4AIOA 4KITB 2QKIB 1WZLA 2YPVL 4HFUH 3AG4B 1KBPA 2O1AA 3GDCA 3PGCA 2E74C 2VMDA 3GHBH 3RWHA 6PAZA 4HHGA 3LZOA 1AR1C 1UM4H 2QLVB 1AGCA 5E9AA 5AYTA 1PJ9A 2CBOA 1CDBA 1NDGB 1G6RL 3EO0A 5L2KB 3HS0C 4M7KL 2VDMB 1PD1A 1A25A 5I23A 2YC1B 4HS8L 5DD1H 5L6YH 1BBJA 1F4WH 1D7FA 2P8LA 2WIIB 2Y7MA 2XTJE 4WI2A 3E8VA 4XAKD 3P30L 5JA8B 3FQNA 1KFGA 3NZHH 4G2AA 3P0YH 5IW6A 2X88A 4PG9A 4KXAA 3PP4H 4ES8A 3C60B 4KH9A 4Q52A 2EEBA 1XTLA 5E9DB 3MRCB 5CSZA 2L04A 3SE9H 3QYNA 5HYFA 4JMXA 2X4QA 3QO0A 3T5WA 1DTUA 3DIFA 1QLFB 4GG6A 3HG2A 4AYDC 1W9XA 2WVTA 4UNUA 1DE4B 4G72B 2J6EA 3VWJC 5HDQH 4Q74A 1ZS2A 4LKXA 2QT6A 4F7PB 5JOPE 3NA9H 4FULA 2P5EE 4LOFA 4CGTA 4Z7WE 5TH2A 3VJ6B 4HJGA 4QRTA 5D93B 1KIUA 1SYVA 3O8XB 2G75A 4Y88A 4J8RB 4Q6IA 4F2MA 3CV5A 4YHLH 1WSST 5DHYB 2HPTA 4NZTL 1R3IL 1T7ZA 2EDFA 3I3EA 5C0FA 4O02H 1BCIA 2Y5TB 2XSKA 4JHZA 4CA4A 3CZNA 3X11A 4LLMA 3GSWB 3NAAH 1A1NA 3UJIH 5MHSE 4J1UB 4Z95L 1NFIB 1Z6JT 3RWDA 4G83A 3VTAA 3RY4A 1DQLL 4LSQH 1AJ7L 3CSFA 3HUJE 3D0LB 2QMJA 1DQLH 2PO6B 1MF2H 1QABA 2N01B 4IOSA 4HF5L 4Z95H 4ZFZA 3SYOA 4P59L 3KGUA 2R9HC 3QPKA 4HJEA 1TZ8A 4PBVC 1YPZA 2I9LA 2UX6A 2FK9A 5ACLA 1WFUA 1P9MA 4Y2NA 2FO4B 5EU5A 4HUMB 3RWGA 4I3SL 1DEEA 5AALA 3VI3E 4TQ8A 1H3PL 3TS8A 1U9KA 2GTZA 1MFBH 4HGKC 5HYJB 3LRHA 3QS3A 4IMKC 1OAKH 4OLWH 1QUNB 1XGTA 5D71L 2YN3A 1FL3A 1G7PA 3WGUB 4YSOA 3SOBL 5E8OB 2BSEA 4IBQA 4F7EA 1I1AC 3U1PA 3AREC 1NH6A 2Z7ZA 1WAAF 5FF6A 5I1GL 4DPAX 4JO1L 3PWLA 2IH1B 3TT3H 2D7NA 3WFDL 2ZX9A 3ZKXC 4AYEC 1A6WL 1H6TA 3ESOA 4B9KC 3WIHA 5H2BB 2DQCH 3GRWA 2Q3AA 4GKSA 4TNVF 2BIQA 2VXSL 3EJUA 1KIQB 2VDNH 3UAJD 2R2EA 1TTGA 1AO7D 5JXED 4UTCA 3WMQA 2R0KH 2QV4A 1QSFE 4FCAA 4J3OC 4CJ0A 1D5RA 2VTFA 3QE5A 4J4PC 2X6BA 1EMTL 5EB9A 4Z5RA 1AYRA 2C9VA 1RURH 5K9JL 4L3CB 1AGCB 3RY6C 5LVEA 4A7UA 2O5YH 1TVDA 2UZPA 3JSSA 5I6OA 4RISL 4LIQH 4EDXA 3CNKA 1CFQB 4ZFFB 1CIUA 2NY3B 2Q7YB 4N8VG 3BKMH 4JFHE 5F1SA 4XO8A 4DTGL 3U0PB 4LLYB 5IMOA 4KK5C 2ZUSA 3SQOH 5FLVA 1XTMA 4GY4A 3B56A 1P5UC 3UG5A 4XMWA 3LRSA 4LU5L 3LKSA 5ADPH 4IBUA 1ETJA 2EZ0D 3ILPA 4KVCL 4CVXA 5E9DE 3C09B 2VDQB 4AWJC 2BH0A 1JHLH 2F15A 2I85A 3HC4H 3P0VL 3KLQA 3QQXA 5CCKL 4KJQD 1U8MA 1A5FH 1E5AA 3VH8B 1AHWA 1XAUA 4Y5XC 4NQXA 4PV8B 2K6YA 2Q76A 4KRNA 2ZSVA 1ORQA 2IV9A 4KJPC 4PJHB 4JPWH 2J5LC 3CUPB 2OCCB 1ML0A 1S7XA 1SDDA 2VM3A 2B5IC 3CLWA 4IJ3C 4LLUB 1S5IL 4RNRA 1FLTX 1GGCL 1TJHH 1E8WA 4KBPA 4WNQA 2BP5M 1AGFB 2NW3B 5FWQA 2ZXQA 5I82A 5HDQL 5IMLB 5DEFB 3U2SB 3BQUD 4AVIA 1KTCA 3J27A 5E2TH 4YH6A 3E8UH 3K5SA 2OZ4L 5FK9A 4KFZC 4WV1B 5EU4A 1JV2A 5KVDH 2EDXA 1M7IA 2ADFH 2A73B 3ZXAC 5C0EB 2ZAIA 2CIIA 4GKLA 4X80H 5AENA 4R2GD 2DLIA 4JBSA 1FBIH 2Z31C 3RIFF 2O61B 5CMAB 2BVPB 3QWRD 2CPUA 3PE9A 2YD2A 2WOYA 1XB8A 1SJHB 2DMBA 3GMNB 2CAKA 4LVEA 2A6KB 4KK8C 1BPLB 3TZVC 1PG7W 1MI5D 1XR9B 2BNRA 4Z3IA 4CKVX 1URZA 1DLFH 25C8L 3ABZA 3MBED 1OP5K 5J6HA 1AQHA 3G5YB 1IC4H 3VXNA 5GGVH 2HTKC 3PHSA 5F97E 3B8SA 3SGDH 3JTBA 2F58H 5GRUH 4F9PA 4R4BA 1OANA 2B8OT 2WKLA 4DUWA 1EHLL 3GMQB 4JVWA 1AP2B 3BVVA 4WDIA 4JDTH 4ZMQA 4F2ME 4FMKA 1R3HA 5DMYA 4FFTA 1QFWM 4YHKH 3MRFB 2WIMA 4DVRL 3C6SA 3BWAA 2R2HA 1IGFL 4NCDA 5ALCH 3TWYA 4CDGC 1A4BA 4WU5A 1LO0H 4K3EL 1A6PA 1MZZA 5D2LE 4YVUA 4PY8J 4IMKA 2YOAA 5KSVA 5KN5B 5TF1H 4PRNB 1JP5A 1KF9B 2XA3A 4WIQA 3OMZA 3QEUA 4AC4A 1TSRA 3SGJA 1C1EH 4R7XA 4G7YH 5IB4A 4LCCB 3SE3A 3IMRA 1R5VB 2DQHH 3L6FA 3NIFB 3OB0K 1OGSA 2YAMA 3EO1A 4L18A 1OP4A 3RZCD 4M61A 5FUZH 4NM4L 1FN4A 1TUPA 4HMEA 2JCCB 3GBDA 3TBVB 4PJ8A 1XXDC 4DH2A 1MEXH 4OD3H 1UZ8B 2PCFB 1RZJH 3VMOA 5JQHC 2HFTA 5AW3B 3ULAB 3BZ5A 1SVCP 4I48B 2RALA 4NKQB 5GRJL 3OKMA 5HHQB 5I0WA 3CZFA 2H0EA 2IBZX 3EYSH 2ALWA 3WV0A 2BINA 1G9MH 3ZYZA 3LN4A 3EOTH 3LKNB 5GS1A 3ARQA 1M7XA 2AQTA 5K1JA 3B2MA 5IFAL 3RVUD 2BNUB 4UYPA 1RMFL 2BWDA 5HGAA 1FFQA 2H6UA 1P0SE 5E8EA 5AOZA 1Z9LA 3US1A 1A6AB 5I17A 3WE6B 4HS6A 1V3KA 2R2BB 3QQ9C 1ED3B 1TXKA 1MRFL 1UKQA 3TOPA 1M71B 1G4MA 5TDPB 4NQCE 1GZHC 1MFAH 4I1RA 5FV2A 5C09A 3V8OA 2XWZA 3VGHA 4JM2A 2B1HH 3ZUNC 4G8GA 5DGQA 2GSIA 1LMIA 3HFML 4BZ1L 1J8KA 5B8CA 4S1SL 3NPZB 1D5ZB 1EBAA 2OMBA 3N43B 4UMSA 4LO9A 4YQXL 3CBKB 5DZ9A 4GQPH 4FQCL 5GIRA 1CDHA 2AZUA 2O30A 5EV7A 2QV2A 1P69B 3WHE0 1BHGA 1OSEA 4JB9L 3MO1B 3RIFK 4DEUA 3P3SA 2X4TB 4YFLI 4WUKH 4PB0L 2VAAA 1F86A 2J88H 3AREA 1P6AB 3FU0A 3UP6A 2M1KA 3BQUB 1F6AB 4ENED 3EJJX 2WOBA 4JM2B 3TCXA 5J1TC 5HVHC 5I1AA 2R9HD 1WA1X 3J2PA 1U2YA 1VEMA 4AEIH 5K9QI 4YVNA 3WY2A 4M3HA 3IETB 3EYQD 4YHYC 2DWDB 5G55A 4O2CB 3RAJL 1BFTA 2R4RL 3IT7A 2D31A 4QXGH 3V7AE 1G6VK 3H9ZA 1MCKA 5I73C 4F27A 2NTFB 2OZNA 3CVIL 4K9EC 3NABL 4F7MB 3O9WB 1JGVH 2DOCA 1XH3B 2IIJA 2QEJA 2VSCA 3D9AL 5EIQA 3QRGL 4JDVB 1F45A 1FGVH 4KK9C 4E9QA 2X6MA 1NBCA 5BV7L 2C9UA 2JB6A 1Y6KR 4JY6B 1MVUB 1PZBA 4PREA 4KNQA 5F8QC 1QQDB 4V2BA 1Q9WB 2V2XB 4X0KA 2HMID 1FZMA 4KKCD 2NNAA 3JXAA 4FQ2L 5CZVL 5DMKB 5EWIL 1Q9OB 4K73A 2WZ5A 3U4BH 4RMBA 4JPKH 2YD6A 5JZ7D 4KV5E 3HRZA 3PL6D 2MOGA 1M42A 1Q1PA 2HFEA 4X8GA 3V7MA 1BMWA 4DN4H 1MNNA 1N6QL 4DT2A 2J57A 5KBMA 3LPWA 1JZJA 1AG6A 3VD9A 4LDCA 3PHOA 3EH4B 2YSSB 3SD5A 4PY7B 4X7TA 4HDIB 4M4RA 5IV2B 1K4DB 4PTTA 5LO7A 1MHEA 43C9B 2DS4A 3O3DB 1ETA1 4JHVA 2GJPA 3DV6B 3GKZA 4GG6F 5JIKA 3VD7A 3BYTA 3QUKB 1A65A 4JQVC 3WY4A 1F8TL 3R1GL 2C3HA 3WBDA 4CSTA 5F7EH 4NFDA 4H5SB 3HB3B 2FQGA 3QZMA 5F0PB 3SYQA 2EVJA 3WIFA 2B9BA 3QQDA 4X4YA 3SCMA 4P2RB 2O5ZL 3QPQC 1SBSL 1OGAE 2QPSA 5CJQL 5INCA 4GAJL 3T2LA 3UBXG 3B9DA 2WZPD 2XX1A 3KYNA 3NJLA 5EZJB 3L4WA 4UB0L 3MR9A 4OW6A 2WNKA 4EI5A 2XTSA 3QIBB 4PPTA 4BHUI 3EGXA 4LOVA 3AGVA 4JVUA 3TA3B 1CQYA 3X1BA 3GEWB 5EF0A 1FSKB 1HEJC 5AVXB 4JFOA 4E36A 1G0YR 1D5BB 1VZHA 2E27H 3GI8L 4CBPA 4Z7OB 2P5WE 2DQGL 3HZMA 2MMXA 1R5VA 3FL7A 3L6FB 4YHNA 1WBYB 4WCYH 2QQLL 5FA3B 2WVVA 4KMQA 1DBAH 2P5EB 4HOMA 1OE1A 3WEXA 4I0PD 4CVZA 4PN6A 4F8LA 3AMKA 1CLYH 1ULVA 2IDSA 3MI6A 5DTFB 3HTLX 5DJ6A 3CMGA 3W39B 3BSZH 3NTCH 4HK0A 3GK8L 3NK4A 3NA9L 5HGDB 4DEPB 3RRQA 3TNNB 1FQ9C 3T4YB 4PJGE 2CLVB 3HG1E 2K7QA 4FXLA 3RP1A 1WC7B 3LMJL 5I74C 3ZZSA 2AEPH 5AZUA 3WO4B 1X7QA 3QDGB 4OF5A 1C16A 2EC9T 2X4TA 4OIIL 3WNOA 1WFJA 2Q87A 2ZONA 4LPVA 1FGVL 2BNQD 3LXCA 3RQ3A 3PP3K 3WEXB 2NNXA 5LGJA 4PG2C 2XPYA 4A63A 5DQ9A 1OCOB 2KZBA 4UOJA 4YL4A 3TH4T 3FKUS 3WS6C 1Z9OA 2IQAA 4NUPA 4UCFA 5IUSA 2ZJSH 2EDNA 1VFOA 3CUPA 3NIDF 1E5YA 2JVUA 1J87A 4YO0A 5BS0E 4AL8C 5CKGA 5IOPA 2BIPA 2OL3L 3B6SA 3Q2CA 3X3GH 1I8MA 4Y9FA 4YGVA 1FHNA 2XWCA 2YQGA 3VH8A 3BWUF 1JGUL 1ESOA 1FYTB 4Y1AE 3DUSB 3TESA 4BUQA 3BLBA 1DBJH 1PIFA 2KLTA 3ULVH 3AS2A 3CVHA 4WK4B 3RY6A 1KYOJ 2X1PA 1F97A 1X6LA 4JREB 4GOSA 5T3XD 3MOBL 3HAEB 4H20H 1RJYB 4PRAA 4BA0A 4X4ME 3WD5H 2EILB 3AG1B 4X6FA 5CEYB 1U42A 3W5NA 4FHJA 4PV1C 3L7FA 2YGPA 5GGQL 1OZTG 4X6CE 3BLKA 1QD0A 3WN5B 2ODHA 2PETA 2A1WH 1MHHA 4M1DH 2RH0A 2DQUH 4YZWA 5SV4A 1I7UB 5H37H 4Z7QE 3BXNB 4WTWA 4QXUH 1NIFA 3RVUC 2AVFA 4Y4HB 4NKDA 1X5XA 1EEZA 2NY3D 2CH8A 4Q14A 1IJNA 5DMKA 4I13B 4DP1X 5EEUA 3V2AR 1AR2A 3BMVA 5FKPB 4H8QA 4O02B 4BKTC 3SYPA 3VI4B 3APNA 3NJHA 1JGEB 3DOIA 3VXSB 1F00I 2ITCA 4Z76B 4TUOB 2J8UE 2FGZA 2X10A 1BJ1H 4BFNA 4P2OB 2PPAA 3GS7A 4P2RE 4X83A 1GVIA 1PG7L 3G08B 3HUJA 4HWUA 5CAYB 3LOWA 4CU8A 5GJSL 4ZXBD 1MEXL 4HKJA 1R3HB 4OD3L 5IUCA 5CIPA 1PDKB 2FJGB 3L3JB 1R34A 3V0WL 1KENL 1JPFB 3A6BH 3ZE2F 1OSYA 4NC1C 4YBLC 1AQMA 2HVBA 2PUQT 3KH3A 4TSAH 3A5VA 2LLNA 3GJEA 1VLXA 3Q7JA 2YBRB 5F0MB 4N28A 1TMCB 4F7TB 3CSYA 4MRCA 3DECA 2VZVA 1L3WA 1LWHA 3N42F 5E2VL 2WVSA 4FQHB 3WL9B 1DJGA 4GIOA 3D3VA 1R0AL 4HJTA 2X4SA 5I6PA 3PL6C 2HRLA 5D7IF 2HFFA 1Q72L 2BNRE 3HZ3A 4S1QH 3OPZL 4OBRA 3TF7C 2NY5C 3BE1L 3Q2WA 1O6TA 3RVWD 5F7KC 2X4RA 4P5RA 1ZLWK 3ZJAA 2HMIC 1PG7X 3SKOA 4I9XA 5DO2C 4WUUE 4OGQC 4HC1A 2X41A 4BEIA 2X3CA 4GS7C 5AVYB 3LNIA 5IT2L 4H8VA 2X4OB 1DBKL 4KAQH 1KB5A 3QDGE 4UOW0 4A2GA 4AEFA 3T0DA 2HT3C 1AFVL 1GAFL 2GIYA 3HS0B 1A0QH 4X5RA 4WKZA 3BVNB 1UUNA 2BOBA 2OMYA 1BQSA 3HCVB 4R96A 5DWUH 5AYQA 5B1AB 1P7KA 1SXAA 2EECA 2NSMA 1KY6A 3PGDB 4P04A 3TZVD 2H1XA 1NFAA 4MMZC 5EO0B 4ZW3A 4WKZB 3SY0B 4A7TA 2BNQB 1NCWH 1NGWA 2E9JA 1WFNA 3C60A 4JCMA 1DLFL 25C8H 2WY3B 4F33A 3L3HB 5HPOA 4C8XA 5FECB 1S7SA 3BUBA 2X4OA 3EDEA 2VJ0A 3A6CL 3Q1EA 4QO1B 1XF5A 3K8MA 1Q94B 3B7TA 1MAJA 4MDIB 2XG5A 2PWFA 2AXFA 3ALPA 2ICEB 2A0LC 4OD1H 4QRRE 2OW6A 1H3GA 3HR6A 3DURA 1XBDA 4M93C 4LP8A 2VLLB 3EFDH 3K2MC 3T3MF 4BH8A 1J05B 3D09A 3DVIA 5DK3A 1BM3H 1R19A 2WBKA 3LXAA 4F58H 3B34A 1ZLUH 3I3BA 5CJ5A 3FU6A 5TDOB 2H32A 3MLUH 5A40E 3TWCL 1BJMA 3O4LD 4P2OC 4DVBA 3MRHA 2YXMA 4PFEA 1QHOA 1KJ2H 3HRPA 1H0DA 5IEHB 1PDKA 5FYJD 3DTXB 2CKNA 4CMMB 3MV7D 4XCFH 4R7LA 1YN7B 2XBZA 5J0BA 2AJUH 3TH2T 4JFEE 1RZKL 3AAZB 4ZFGL 5BO1L 1S7QA 2VLKD 4ZOEA 1YEIH 5BZDB 4OFYA 1QO3A 1ZT4A 1AP2A 1VESA 3S2AA 3SPVA 1ZA6B 1IIKA 3DIVA 4GG8A 5AG9A 1IEBB 4QHMA 2WINA 3W57A 4JFZL 4NDMA 1NL0L 1TVHB 3LIZL 1YECL 5GRYA 1I82A 1KWKA 3ZDZB 3O3EB 1TZHB 3NCXA 4PP1C 5CEZL 2IALB 3TH3T 5FW7A 3CFEA 4K3DL 5BNXD 5KUMA 1TO4A 2O6PA 1USQA 5CUSH 5AB9A 2XHNA 4NUGL 4Y5VC 1OARH 3L9EA 1FORH 4ZTOH 3DNKA 4OM0H 4POUB 4Y16C 1WV7T 1ECZA 4KFMA 5JR1H 4P23A 5DJXB 5I6XC 4C56E 2FO1A 1FL6B 2NSQA 4IBYA 5F6HI 1GHFL 3WJMB 4CADB 1DANT 2P4AB 1G1KA 4JRWA 4UV4H 1CURA 2DWSA 3AQYA 3L3HA 3M7FB 4N0UA 1J0YA 4XMZA 4U1IA 5B21A 4D9QD 1EWHA 5AZEH 2JKRM 3TVMB 3JWOH 5CN1A 3V4LA 1MVFA 2FUTA 2CO6B 2VDKH 2UYLA 4FF9A 2B4CC 3PDDA 1FVDA 3PWVA 3WUZA 2HRGA 1FP5A 1MCFA 3GSWA 4E9WA 1JPSH 1MW0A 4PR5A 1ZLSH 1OPGH 3HS0A 2IH8A 4HUNB 1T0OA 1XCTB 2H4EA 2PW1A 3DOSA 3DJSA 5HPMA 2XJKA 1BG1A 3MBEC 2HRHA 4TLSA 3H3KA 4NUQA 3QFGA 3GZPA 4FQIL 4H44C 4TTDD 1Q9OA 5D6CA 5LGYA 1A47A 2J1ZA 4QLRA 4DUXA 4OUOA 2C9XA 2WLNA 1KT2A 5KS9F 4MX7B 4ZYKA 1LQBC 2OMUB 4LKXB 4XWGH 2X40A 1Z2KA 4Z3HA 5JORA 2IPTL 1RUAH 3DTXA 2A74C 1LYQA 2WO2B 2G0KA 2W38A 4AQ1C 4GG6E 4Z3TA 5HSFA 1PJWA 1DSFL 2NQ3A 4LOUD 2HLFC 4MS8C 3JWNH 3CBRA 3CC5B 5FM5M 2P9RA 1YNLL 2VDNB 1A4JB 1OALA 4H0IA 5ELIA 4E68A 3LQZA 4FG0A 1C9SA 4EOWL 5HBBA 1DBJL 4MZ3A 2DWTA 3QUXC 1G84A 3HNVL 3RNQA 1DDTA 1F3GA 1JGLH 1TG8A 1PLBA 3IETA 4E9VA 3T08A 5D1XA 4IBSA 5B7FA 3GSNA 2CKBH 5F3HA 1U3HB 3TUFB 3PPSA 2QGCA 4EI5B 5DRXB 3DX7B 3VWJD 5BRQA 4OM1L 1S9VA 1NGXB 4QOKD 4N5ED 4QHUB 1Q94A 4HJ0D 1UYWL 4KHXL 2ZJSL 3N42B 3SBWC 5JHDA 5H2BA 5DJ0A 1X5KA 2IOOA 1A1MB 4TQPA 5EBLB 4GUPA 6FABL 2IAMD 3D12B 4FLOA 1IVTA 1NLBH 1PAMA 1RU9H 3QA3A 2JK5A 1UEYA 3BT2L 4QTIH 4NRXB 5J3HC 4OI7A 4M7LT 3SJVA 3LMJH 2G4EA 4QRUB 3IJHA 1T80A 1W0VB 4UINH 4UV4L 1MLBB 4JJHA 2YIHA 5KSUA 3UEQA 3VSUA 1J5OH 3D39E 3KYAA 2H0FA 1D5IH 3T2OA 1NMBL 3JTSB 2P8PB 1GC1C 1JUFA 3VRIA 4UQIM 1TMQA 1QSEB 3V6OE 3ALWA 3HRZB 4M7KH 5C2BH 4EZLA 2J8HA 4YHZL 2GAZB 3WFBL 2W92A 5FB8A 4Y89A 3VX0A 2O6CA 1QLRA 3WGVB 4Z6AT 2VLRB 1IMHC 3PQYE 3HNSL 4KRMB 5DC2A 1NZRA 2BWQA 3N0AA 1OAXL 3FSVA 3QDJB 5HHOE 3SN6N 4Z7OE 4ZFQA 2XN9B 3D51A 3TL5A 4QGYA 2ZICA 5KG9A 3BVDB 2BSED 2FECL 3D25A 3I9PA 1R75A 4XOAA 3PHQB 3OAZK 2ATKB 2X2HA 1ZWIB 4NUGH 2F3GA 3MXVL 2AGJH 5EZIL 4X6CA 5F7DB 4FQXB 4LSUL 3H0TA 2C1OB 2VN6A 2ZCZA 4M7JH 4MB5A 5IB4B 3L3JA 2GI0A 3H9HA 3TBSA 1VJSA 4OLXH 4LL4A 4DGVH 3BDBA 2DV6A 1N9PA 4HMDA 3NIGF 4LARH 3IXTA 3OJDA 4KQ4L 5DURD 5KAQF 2CLZB 2GEQA 3V0EA 3WKNA 1MY5A 1ZWIA 2QSVA 2P47B 4G71B 3GLAA 5GGTH 2EE6A 1IJ9A 5CXPA 3KBFA 3EKCA 2XVGA 3LH9A 2C4FU 4XMLL 7PAZA 1CFTA 3FPXA 3ZSTA 3ZDXF 2V6HA 3MO1A 1MFCH 4Q2ZB 3O11B 5J1AA 5ACZA 3AY2A 1RUKL 1G43A 4FFVD 4ACTA 3FMGH 3V0GA 5CJOL 3HG0A 3TBWA 2BSDA 4PRIB 4LSVL 5FO7B 3VFUB 2QFPA 1GPRA 2XV2A 2VWEC 3QS2A 2EC8A 1D2PA 2W88A 4TQHA 3OAUL 4RDQG 3S3BB 3S5LB 5A16A 3DSFH 3K74B 1V05A 5DQDL 3P3UA 4XCNA 4CC4A 1T83C 4HH9A 3M8OL 1ILUA 3TZVA 1JSYA 5JUEL 2MFNA 2NQCA 4U1MB 3RGVD 2NXYD 1RUQL 3BPNB 2YD7A 3T09A 3SZ6A 5DFVD 4OD1L 2Z7UA 4RBPH 5EOCH 1JF1A 3ARGD 2AI0L 1DVXA 5DHDA 1QI3A 2OTWA 1CGSH 1NM9A 5DO8A 3IAQA 3RILA 4S0HA 3DPBA 3EZJB 1NGXA 3U4EB 1WVZA 5IJBC 4PJDE 4K3JH 5T33L 2ISDA 2FX8H 3TBYB 2BS8A 1E8XA 5G4MA 5HI3D 2FTAA 4YDNA 1QW9A 3IU3A 2ZCKL 3KL3A 2FO8A 4OGXL 3QHFH 2BJMH 3MRIB 4E9XA 4OCWL 3VG9B 4YDVB 1DVFB 1UFGA 3FYEB 3ZHFA 1FG2B 1G1YA 4WFED 2DY2A 1YEDB 2CHDA 5ITBL 1F3DH 1K3IA 2V7HA 4PGCB 1A6UH 2VJ8A 2CR3A 4QNPF 2YUXA 4L4VA 2X44D 1X5JA 1LEGA 4WTXA 4LNVA 1WICA 1FCGA 4YX2H 4M1GH 2FGWL 1N10A 1T5XB 3FCTB 2I69A 3JV6B 4L4VB 5H35A 4BSWB 1OIOA 2CA4A 3QH3B 1G7IA 4FA8A 2GFBB 3CVHL 1F1AA 4NKIH 5CU9A 1OCZB 4PCTA 3CFJB 4LAQL 4F20A 4PBXA 4HALA 4NZ8A 1BZ9A 1OXYA 5D6CB 1KYFA 4KTYA 4X7SL 1I9IL 4EJ1C 3FH7A 3ATBA 5DRNA 3VXME 1OAQL 4ALAC 4FXKA 3HZMB 3U46B 1LXMA 1PD0A 4Z3GA 4E2OA 5BXFA 1QKZH 4HIQA 4S0SD 1XGZA 1YYLL 5I0ZA 2FWOB 1M6OB 4NGHH 4QTFA 1A7NL 1OAQH 1I8KA 5K9OA 3DMMD 4EN2A 3TA4D 1WWWX 4MDJB 4NO3B 4UQEA 4ZUWA 5BW7C 4PS8A 3HZYA 3MYJB 2BP0A 3IRPX 3QEGL 2ZOUA 4L8DB 2G3ZA 1MRCH 1ICTA 3DHUA 1J1XL 4J4PA 4M6OH 5F93C 2VAAB 4Z1PA 1T1XB 2NNCA 4MJ2A 2WKOF 1FA4A 1ZTMA 3ARUA 3NCJL 1L6ZA 4L8SB 4XMPH 1WITA 5D1XC 1HDMA 1E42A 4GKSB 5EUOE 3N1PC 4JJ5B 5H8DA 4G82A 2H41A 3CVBA 2JF1A 4KKAC 4GAGH 1L7TL 2LE9A 1VFBA 4QXUL 5I8KL 4NNYB 3TO4D 1DO6A 1IM3D 1J86A 2EYSB 4RLDA 2BSCA 4FEMA 4G5AA 3MSPA 5I17B 1U6AH 2AAVA 1PZSA 3O6FB 5LCVA 4ILDA 4YMPA 1J1PL 4J3TA 4N6RA 2YRZA 2B0SH 4C54A 2ZCKH 5C0DB 5CBAA 2XG4B 4HFWB 4TULH 1HINH 2AK4E 3V5HA 4NI6A 3Q6GL 2NUTB 4KKPA 3UG3A 1EO7A 2AEIT 2DQJL 3KM1A 3EXLA 4AVHA 1B4TA 3O45A 3ZRCC 1M7DA 4MRBA 4P0DA 4YDJB 1OAZL 5E6SB 3UJTL 3LIUA 2AJZA 3DROB 2P44B 4BFRA 1H8NA 3F6JA 2VISA 3DA0A 3ERXA 5JXEA 1J48A 3G6DH 1G94A 2CO7B 2BO0A 2UV3A 4CILA 1KFAH 1A1NB 2OMWB 3FOLB 3QZWG 4DOHB 5I2IA 5DI8B 1I1AB 1T0NB 2EH7L 5TGBA 4TNFA 3OWEA 4LSVH 5C3LD 4LAJH 2PCYA 3QR1A 3FMGL 4RGNB 5H37G 1TENA 3SD2A 3VACA 2IMNA 1PZ5B 3MJ9A 3BLPX 2D4DA 3EYVB 1CLYL 5D7EA 1U58A 2GHWB 3DX4A 4GRLA 1W72L 2AQRA 3QZBA 4QUOA 4ZO9A 2AVGA 2CM6A 2VLRA 2DQGH 4IHOB 5F1OB 1EZVX 1W15A 2R69H 3TV8A 3IM1A 2NDFA 3CLEL 4JKWA 3G6JE 3RPBA 2ARJB 1JL8A 5C1MB 1OSZA 1E28A 2P8PA 2Y22A 3BKCH 5B0HA 4QF1A 2A4EA 1CTNA 1QI5A 1WHPA 4KXDA 3PWNB 3CHOA 1MCIA 3TYGL 1ZRUA 1TEFA 1XGQB 1GLAF 4JFFE 5JHDB 2DH3A 1JV5A 2DM2A 3RI5F 2I9TB 2BVQA 3L4TA 2R29A 3H9HB 3WELA 1P5UB 4TQEL 5HP5A 1HJCA 4XRCB 2FR4A 1I8IB 5MENE 5IQ9B 2XQYK 4GNKB 3DX8B 3DV4A 1JZFA 4HJIA 5HJDA 3NG5A 3GHEL 1TQTA 2A6JA 4F5CA 5GGUA 1UA3A 3D33A 4U6XB 2O5ZH 2X5PA 3CDFA 4BIKA 1OAXH 4G7RB 1HQRB 2R69L 5DJAB 5ENWA 3DHJA 3GKWH 1F0LA 5GHWL 1P4LB 3EOAA 3Q13A 2LTQC 2WXQA 4GKNA 3KGSA 3H0TB 1N19A 3KJ4B 4OF3A 4UIKH 3BZEA 4NM8H 2WC7A 2VXQL 4GYBA 3VWKA 2EDYA 5HJBA 4PI2A 1MHCA 4HIJA 2ZOLA 3LIZA 4MTMA 4X9GA 1SXBA 4MJ4A 1S7RB 3DUHA 1FVCB 2YEQA 4C57C 2FT6A 2B2XL 2R0KL 4OFQA 1GJWA 2XZAL 4LHUA 5IEKA 3QNYB 3X14B 3T1FA 2OXHB 3QZPA 5ESAA 1IM9B 4P4KA 1BZ7B 4FZ8L 4H88L 3QUZC 3QK0A 4M43L 3RU8H 2FBJL 2HWZL 4Z0BH 2Z8VC 4MA3A 1AHWB 1SY6A 1TYEB 5MEOA 4JFEA 3PY9A 5ERWB 5C0NC 3L3IB 5JXAL 4ODSH 3EF4A 4BK5C 1NDTA 2W0KA 2Z4QB 3KWVA 2N3JA 4TNEA 2C7UB 2E7MA 1A66A 3EGDA 3T0AA 4CVXB 1ZSHA 4HXAH 5B8CC 2BRRH 5D7HA 2NNFA 3WIAA 1YC8A 1JF5A 5L8LB 4W9HC 1CFNB 4PWFA 2BP8A 5CNHA 3CSPA 5HDOA 2UWEB 4YFDB 1R3LB 4X5WB 1AZCA 5BMFH 4N9OB 3HOGA 2WD0A 3DJZA 2MPAL 3A4AA 4MQTB 4XPAH 5HJ3B 4PRHA 3NSCA 3LSOB 1R9FA 5I8KH 2X3AA 3WTUA 2FD6L 1CFSA 4K23L 4J2XA 5EU3B 2E5EA 1TEGA 3SPJA 2ADYA 3QIWA 3MV7E 5G5DB 1H3TA 3U9UA 4OZHA 4AJ0A 1XIWD 5SV3A 3D4YA 4KHTL 4GEJA 1IC0A 5T1DH 4ENEC 3HC2A 1NCCH 4UOW1 3F5WB 3JUZA 3LTVA 4IK7A 1WDAA 3ETBF 4UT9H 4XNXH 4Z0XA 3SE8L 1JRHL 1UM6H 4JY5H 4ZMPA 5T5NG 3L95A 4FQCH 2VR9A 4MVBD 4HWNA 1HI6B 3T2NH 4TVPD 3C5ZA 4BZ1H 3GB7B 2IALA 1MFAL 5KZCB 4JKKA 1QO3B 2R69A 3OHXC 4H8WL 4F7CA 4YBQC 4IRZH 2XZQL 4EXKA 4KROC 4QHMB 3IJEB 1Y6NR 2IQ9H 3SGDI 1BQRA 3QCVH 1NGPL 4K5LA 4ZFOB 3WCYA 4D9LL 3QQ9D 3FO1B 5L4JA 5AZEL 3NA4A 1RZ8A 4Y4FB 4JZJB 1LO2L 3WNMA 3BIAX 3HE7A 1N2RB 1ZD6A 3D85D 1V10A 1LE9A 2WB7A 1XXFC 3QORA 5L0QB 4LPXA 2OTUB 2OXGA 4KDWA 5D2LF 3SKOB 2EDMA 4JQXC 5EC2A 2E8ZA 1WC7A 1D7CA 1WAEA 3IU4H 5F7UA 4BGLA 3ARPA 4XVJH 3VO0A 3HHRB 4Y4KC 2HFFB 3KPOB 4G9FD 4X7SH 1KPRA 4HPYL 2W1NA 3UDWC 3VWJA 3CFBB 4PLJD 1XF1A 3MRGB 3HI6H 4P06A 3UTQB 2J55A 3U30C 2AZAA 5C0IA 2JWYA 4G42A 4M5ZH 1TCRA 2WKGA 3KL0A 3IVKA 5GGVY 3BT0A 2CIKB 1NLDL 4XBEL 2QKIC 5FFLA 1UM4L 4NOBA 3TIDA 3BEWB 4D94A 4MCYA 1E2WA 4ONFH 3IE9A 4AE0A 2G75B 3VI3B 5IB1A 3CFEB 1AKJB 1E9QA 3PAZA 4QYOA 3FSZA 4XXCA 1IC5H 2WLIA 2R83A 2CUIA 1JK9A 1HOCB 2D9QB 2F5BL 2Y7QA 1LD9A 1CICB 4N0FA 3WKPA 4OJAA 5TPWH 1YEGL 2KC0A 4TM9A 1G0DA 2FWSA 3UP1A 1BD2B 3K71B 4PGDA 2LLGA 3RGVB 4DVRH 2MNJB 4HBQA 4YEEA 4MA7H 1WGOA 1U8JA 1E8YA 4GMTL 1MCEA 5I8OL 3C60C 2WMPB 3GFUA 3M8OH 3UTZA 4HUVA 1QTSA 2A6IA 2F19L 2R27A 1RL1A 1GOGA 4GRLB 3CAFA 3ULUL 2W0PA 3LQAH 3BCDA 5A43C 3HJ0A 2XWXA 4R0LA 4AOFA 2HJFB 4PJAF 1MLCA 2BOBB 3Q5YA 5LXGL 1IC4L 1T5WA 2KMWA 4ZW8A 3K7UA 1I1AA 1T0NA 3SDAB 1GS8A 1MFNA 2VN4A 1T7WA 1U58B 2VDRB 2NXYB 4Y9BA 3WDJA 4PP2B 4FN0A 4YK4B 1ZT7B 1GYCA 5GZOA 5E1AA 3DVNB 4FXTA 2NRDA 1QLEB 1MJUL 3GGWB 5BVPL 2WXJA 1SEQL 1CYWA 2VQ1B 3HI5H 1MVUA 4PREB 4E0RA 2Z93A 4P2QE 1GYUA 4R2GC 2CXGA 5D7LE 2LABA 2BDNH 2F8VA 4WGKA 5F71A 1BECA 2DLEA 4U1KA 1F1DA 2LGNA 3UYRL 3FTYA 4DGVL 1A8ZA 1PKQB 5IBLD 5EC1B 3ZE1F 3EBIA 2RHEA 2CO7A 4EN3C 5SWZB 4F9LC 2VZOA 4N2FA 2PCPA 3ZLQC 2YD3A 1BM7A 1GGCH 2AJZB 3DROA 3F7PC 5INDA 3EBAA 4BRVA 4K55A 1V3LA 3H55A 2L7EA 1L9NA 2IMMA 3EFOB 4HV8A 1HYRC 3MXVH 3MGTA 4GXUN 5DYFA 4FXGA 2EO1A 1I53A 2YPLD 1NEZG 2XIBA 2NCMA 3P4MA 4P2OA 4TUKH 3DJRA 3DX9B 2DI7A 1X5AA 3EADA 3N3EA 1XR8B 5IQ9A 2BSRB 4NO2B 3VWKD 3FJTA 2BNQA 5D2LB 4KO5A 2FDBP 5B38G 3IJ9A 2PTUA 4O02A 4IKKA 1IAII 3WNNA 3MA7B 1G6RA 4Y9CA 1DLHB 1IE4A 4PJEF 3UZEC 4MZIA 5F9AC 3ARXA 1SN0A 5EO9B 1TZOA 4YDZA 1WIPA 1EEZB 3W56A 1U3HD 1ZVNA 4OGAD 4ZMXA 2Z64C 5CEYA 4WSJA 3GJFB 2YHGA 1ID2A 1L3NA 2XXGA 5A6LA 4OU3A 4K7PL 2LHAA 4BRJA 1HL5A 5DK0A 1HXKA 1VKXB 2FZ3B 2OCJA 2PTTB 1MFMA 3BESR 3IU4L 2ARJA 2FQFA 2FX7H 3R8QA 3IN2A 5C0BE 3F7LA 4XTRD 4LGSB 2P8LB 4PJ5A 5FGCE 2K9UA 3A6BL 2DIAA 2DQTH 4OIAA 4PB9L 3FU8A 2YK1L 4GW4A 5D5MF 4H13C 4AJVA 3CDZB 4X6DB 4XXCC 1LQSR 3FO2A 1KIPB 5BPPA 2ITFA 3VA2C 1CIDA 2IQ9L 3KPRB 4QXTB 3U7YH 3R0NA 4FTVE 4U1SA 1YA5A 5E94B 5CN3A 4HCIA 1UHVA 3MCG1 3CFTA 1H6UA 3RWHB 4XP4H 4Y1TA 3WAKA 3WFZA 1QSFD 5DFAA 3UZ0B 1YEWA 1AZZC 1V3MA 2ZE0A 4GEIA 2J71A 4LEXL 5DJ2B 3V7AG 2AABH 3NZ8A 4YUEH 4AKPA 1OAKL 2AJYH 5T8IA 2Q6WA 2NXYC 1HJBC 2PYEE 2CKBL 3QUXA 4HOZA 2CKBB 1EFXB 2ZG1A 5T3ZH 5J56B 2I60H 5B39G 5ILTL 3WI9A 1D7BA 4I3SH 4DEWA 1AHKA 3LHPL 4N2CA 4TYUA 4FJ6A 2BFVL 1FNFA 4B6ZA 5B39A 2OSYA 5I6MA 3QCUH 4BFGA 1KGUA 4XXDA 4KX8A 5D71H 4BQBA 5JW4N 4LIQE 1AXTL 3D18B 3H3PL 3L81A 1YEJH 1CI5A 5BOJA 3I75B 3VGBA 4MBOA 3UYOD 2J8UF 4EN3B 2QHLA 5FR3A 4R26L 2NT0A 2F7PA 2WTPA 4BFBD 1M1XA 3AQXA 3IPFA 3T4YA 3MLYL 4Z7NF 1UXSB 3W82A 5IROD 4GPVA 3CCHB 4HULB 2FHFA 4HPOL 4X8JA 4R26H 2B59B 2NW2B 3F05A 5B39B 1BGXH 4WWID 1HH6B 1XIWC 2FD6H 3CFUA 2WXKA 4ZAKD 1KCSL 1OP5H 4DP5X 5GRWA 2BPBA 2NTFA 1JI2A 4PJCE 4EUPH 2YXVA 1KXQE 3ALXA 5KJ7E 1PZ2A 4YGVB 4DP0X 5JXAH 5BUAA 4F9PC 1QSFA 1RH8A 2HKAA 1MI5E 4C4UA 5IOPB 2NY7L 3GRWH 4JGNA 2D8KA 1QATA 3S35X 4HCRL 3IDXL 1HH6A 4AQAA 1CDGA 3NP4A 3FQWB 3BVXA 1VA9A 2E6PA 3TZVB 1CJYA 3OVUB 3QR0A 3EUDA 3GMPB 3MLWL 4B7LA 2IDFA 4L1SA 3RFZA 1DVQA 1XCXA 5T1MA 3EO9L 3CFDA 1BZ9B 4IRSD 4K7FA 4KRPB 2R23B 2WSDA 1F6LL 1E67A 3QJRB 3M6DA 4HIIA 1FORL 2WQRA 4EXPX 3NJGA 1G7IB 3BDYH 4FXKB 3S3JA 1CF8H 4G5ZL 1FO0A 1RZIB 5EPMA 3FRPA 4HJ1A 5EO9A 3VFNB 4HOWA 3ULUE 3HMXH 3IJ7A 5AUMA 2OAAA 1UT9A 2DD8L 2KI6A 1EUUA 2KBGA 4L1TA 3N40P 1S7WB 5FOBA 2CKBA 2VRKA 1HEHC 5HHPB 5FDWB 2JKWA 3SBQA 5HYQA 1BQLH 3IJYA 3QDAA 5GRVK 1XGPB 1ONQA 2I07A 3OZLA 2YN5A 2MOQA 4FZEL 4JRYA 2R8SH 2J1WA 3L9RA 1HILB 4GP8B 3FQYA 4FTVB 5ANME 3BEVB 4KKLC 3AM8A 4DZBA 4UM9A 1ZHKA 1SBBA 2QBWA 3BD3A 1J8SA 3ZE2E 5GZNC 1A3ZA 3UMNA 3UH8A 4LVNB 1N59A 4IKIA 4U1NB 5DD5L 5F8RC 5LAXA 4NN6C 3B7RL 3V6ZA 2KHAA 5FYJL 4WI3A 2DW5A 3A3YB 2J8UA 2ZKYA 5SWSA 5I15L 2PW2A 5EEVA 4KGLA 4TQIA 4Q56A 2W81C 4U3HA 3GBML 3MFFA 1MLCB 1TTFA 1KCUL 3EHBD 3V4VA 1JPEA 3CXDH 3D05A 4NUMA 3V9FA 1DR9A 4LVOC 4JQIL 5BVPH 1KXVC 2A6IB 3CFKB 2EXTA 3G7TA 1UZ6E 4GAAA 4M4PA 3RYMA 1Y18B 4X42A 5IF0B 3MGOA 4V1DA 4BE5A 4X7CC 1KGIA 1EIBA 1WBXA 5ABAA 5IQOA 3C5SA 1AG0A 1AGBB 5SX4H 4MD4B 5EN3A 3VFOB 4FXGC 3VX1A 2EXYC 3HZKA 4PGDB 5C7XH 2OSWA 5LXGH 2NPLX 4ISVB 2BIMA 5JQ6L 4F37K 5EDSA 2CDEA 4WQOA 1IAIL 5JIMA 1AQ8A 1KXHA 3FO9A 4UTBA 1QHPA 3BIBX 1PKQA 1WQVT 1S8DB 1WZKA 2CA3A 1NEPA 3KW7A 5D7IB 5E24E 5MERA 1WGVA 3O6KH 1ZHNA 3IDUA 4CSZA 1Y1DA 2UXGA 4I48A 4JY6A 2A77L 3OKOB 3MXWL 3ECVA 2OM5A 3HE6D 2Y07H 2DM4A 3VG0H 4ZFOL 3MCLL 5IIEA 2WBWB 2JJWA 1NCBL 3GSNB 1J1PH 3MRKA 3DRTA 3ORJA 4XI5C 1XF4B 4U6HB 3KL5A 4NAQA 3WEBA 2WQUA 4NHCH 1TJGL 2EAEA 3ZY7A 3OAYK 4B9GA 1AFVH 1GAFH 3KPMB 1TTUA 4NQCD 4U1LB 4PJEA 5KVEL 2VCOA 4N20A 2CGRH 5KVGE 2X4UB 3HUJF 5IB2B 1UCTA 5F7DA 4IBTA 1AS7A 4U31A 1TETL 3U2SA 3ZHNA 5KN5A 1MJJA 1Q9KB 1ZK9A 4EZKA 4F8TA 3GSRB 3PWPB 1TKWA 4MNGA 3EHBB 2CJTA 3CZSA 3C9NB 5FYKE 2EINB 3L1EA 4OQ1A 4PJIF 5F6IB 1Q9LA 2R39A 4YDKH 4WGWB 1F56A 1HKLH 3QIBD 3ARTA 3S48A 4A7SA 4XCEA 3MOAH 5KSAB 2E4TA 1C7SA 2GBUA 4PUBH 2BZDA 4QRSA 1O75A 3QG7L 1JRHI 1OGTB 1DJSA 2NY6D 3QG7H 1F18A 1ITBB 1CXKA 1MRCL 1DJWA 2IADA 4B5ZA 1SXNA 3DUUA 1CLZL 4ZOAA 3S3CB 3T6VA 4JKMA 2ZG2A 1CE1L 4ZUVB 3RZCC 1WBZA 5C0AA 2A6DB 4HEPA 4ORGA 1MCHA 2CJUH 4R0LC 2Z4TA 5FHBH 4QHUA 3N43F 5E1GA 4NM4H 4HKBA 4FQJL 1W72A 3CXFA 1VGKB 5HGAB 4QI3A 2IAMB 1BFVH 3DMMC 1ZHLA 2CNZA 4JEGB 1BX2A 3PWUA 3CZLA 3ZK0A 5ID0A 5LGKA 1LEKA 1G87A 5GGQH 4DCQB 1IAKB 1S3KH 1UD5A 2Y36H 1IGCL 2EEFA 4M61B 3VA6A 1HN1A 2LU5A 4L3CA 2FATL 3ZO9A 2JKIS 3ZE0E 4U4IA 5C0IB 3UTQA 4OJFL 4W4OA 3QISA 4BINA 1Y1UA 2RIKA 1IEHA 1WE5A 2VABA 1QNZL 2V7NA 3C12A 4Y0GA 3QRFM 3NFNA 1TOXA 3F65A 5J6GB 1XSKA 4MJID 1MW2A 4GSDL 2FL5B 3V0DA 3RTQA 2C3WA 1DJHA 2DJSA 2QVKA 2WXGA 1XH1A 2OMUA 2WHVA 4LRNH 5AWNH 4HKZB 4UILL 1N70A 3TJHD 4CU7A 2YO3A 2VXUL 2IPUG 5GGSY 4O9HL 5CN2A 4MXWL 4YE0A 3QAZC 1IKFL 3LEXB 4DQOH 2EVHA 1RERA 3T65B 4PJGF 1CDJA 5AW4B 5I1DB 2BJML 1HCFX 4IIQB 3V5DA 1Q38A 5J3HD 1KGWA 3E9TA 5CJXA 3FAWA 4PJEE 3NMEA 4JFVA 4K3JL 5T33H 2R0LH 4DP4X 3MBWB 1FNSL 3LV3B 4HWBH 2ICWB 4IJ3B 5F7YC 3VXRD 4OVVA 2B08A 3VMNA 4OJEH 5B4MD 2HYMA 2HKFL 3DK2A 3RA7L 1PBYA 4WW2A 5H4YA 1WZMA 4QRBA 1J05A 3SKNA 1U8LB 2PO6A 3ABLB 4JN2A 5C0BA 4W9KC 3DURB 1MUJB 3RU8L 3NOIA 3AG3B 5GS0C 1SJHA 4Y8DC 5I0XA 5CLXA 3L3DB 1LO5A 4ZS6C 3T3PF 4WSKA 4BKLB 1RHFA 1P53A 1KGCE 3W9DB 3B8YA 4K9JA 4PD4K 1I7ZA 4BHUA 1LEIB 4ZK8A 2AKRA 4P3CH 4CC4C 3APDA 4WCYL 4DKFL 1AQDB 1LNUB 35C8L 2BP8B 2IXQA 1YPZF 2AXFB 2N7AA 2NZIA 3EJYD 5GZND 4KJPD 2XQBH 4PS4L 4DESA 1WYJA 2V2WB 2Y25A 3IFNL 4OFIA 4IW4C 2E59A 3JT2A 5I1LB 1JK8B 4XMLH 5BRPA 3ABGA 4J3SA 4W6XB 5C0GA 5T1LD 5EBWA 4FKKA 3GD1C 5DUPH 1YNTF 1E3FA 1THCA 3CE1A 4MMZA 4LLQA 5GGTL 4LSUH 3MJ7A 1TQWA 3CC1A 1OTSD 1KIRA 4ZTEA 3QORB 1XGQA 3QI9B 2VLJD 1OK0A 2NY1C 4P5MA 5JIPA 3C09C 5I24A 3M88A 3F7YA 4JO4L 1GCFA 1E28B 3ULUD 4MB1A 5F3BA 2HVJB 2YD1A 1NIAA 2R8SL 4P5SA 5HXMA 5JIDA 5DUBB 4ANVA 1DQJA 2ETWA 1ZV5A 4HIJB 3VUAA 1AI1L 4NZDA 1J5IA 1KYAA 3OKKA 4LCIH 4E41D 3QG6B 5J13B 2H2PD 5E8DH 3KPSB 3NFPA 4JFFD 1QASA 5I2IB 1BSIA 1OTTC 1LK3L 2A9AA 1KYUA 3REVB 3VFTA 2FJGA 4XC1L 4N8VB 3UYPB 3LKSB 4Q6IC 3NT0A 3PGCB 4TL4A 2Y7LA 4A6YA 3WKYA 1J5OL 4JFWA 1F11A 4ODHH 4OLVL 4RQQA 2WLMA 5AAWC 4DN4L 3ZGIA 3PYCA 4CN4A 1KSRA 2OZ4A 2M83A 5JOEA 5MP6L 3MVSA 3WXWL 2RB8A 3TC9A 3L4UA 3S88L 4KI5C 1NPNA 4QHLA 1E6OH 4HAFA 3RX8A 1IGMH 2MOVA 3ZX1A 5CHNB 2OYMA 4AYGA 2X70A 3GBNH 4QTHB 5J4MA 3IGLA 3NSFA 3ZDYB 1RHHA 4O51A 3C08H 4ODTL 5HYJD 3WFCH 2FWUA 4ZDHB 3PWUB 4NN5C 4NRZB 5K33A 1QI4A 1R33A 2R1YA 3VCLA 2OL3A 5DHYA 4ISVA 3W9EA 1JHKL 4S2SB 5D1QD 4M8UA 4IRJD 2EKJA 1JDCA 2O6DA 3G6DL 4PGEB 4WO4B 5J9PB 1TITA 4KKNA 2JKSA 1I1FB 4KXCA 2PXYA 3BH8A 4TSBL 1A7OH 2XG4A 4HFWA 1G0XA 1DQML 1K8IB 1YLBB 2VOTA 4DQOL 1FCCA 1NBZB 1MCQA 4KKQA 2OK0L 4JN1H 4XNQA 3QXAA 1JTTA 2PXYB 2GYSA 1HDMB 3IDNA 4TULL 1KCSH 3UACA 1MG2C 3P40A 3H2QA 4UI2A 2D7MA 2AMGA 4B27A 5I71C 2X1XR 4ZODA 1BF5A 1QRNA 4WFHD 4HPOH 3E2HB 3UJIL 5FAAA 3GI9L 1H3VA 3HAEA 3HFMH 1IBGH 2BFVH 3M1OA 3AACA 3ARBD 1BWMA 2BW5A 4MNGE 1A6ZB 4AE1A 4XMKH 2IFGA 5CEZD 2CDFB 1HNFA 1R3IH 4LK4A 2K4WA 4DIXA 3ULVC 3HC3L 4CSPA 3P0GB 2ZOLB 2V3DA 4J27A 4EBQH 5D7SL 1XZWA 3EG9A 4ZFZB 5F88B 5FYLE 3T6XA 1UD4A 3EYUH 3V52L 1G9ML 4ZPTA 4GBXC 3W0WB 5CFAA 3UMTA 4PJIE 4NOFA 2XKNA 3FRUB 5EU6A 5BQ7A 3BMWA 2IGTA 5ISZD 3MRKB 3NFPB 3OC5A 3D07A 1BAGA 1JZ7A 3JWOL 4GW1A 4MAYA 4XTRC 1CZ8H 4TV3A 3PF2A 4NWTL 2YAOA 3G6JF 3UGEA 5C08B 1P5UA 1G7QB 4LB8A 1UWGL 4M8QB 4XP4L 1OB1A 1MWAH 3ISRA 5IWLA 4ZJ9A 1XZ0A 1KG0B 2VIRB 5DC4B 2WN2A 3TJHC 2DWYA 1MCNA 1DFXA 4LVHB 1DZBA 2CO3A 5EPMB 1DBBH 4PJDA 1HKLL 1KLUA 4X8XA 4RDBA 4R3SB 5E6UB 4A68A 2ESVB 1DVFA 4HUWB 3TVMD 4F3FA 4Z7WF 3VFOA 1ZANL 3CDYA 2Z34A 2VR6A 3TBCA 3NFNB 3QIWC 4G7YL 1AS8A 1RLBA 3GMPA 4IOIA 1CFSB 1NCIA 4X7EC 4DP7X 3GZQA 1U8NB 1VAHA 3TCTA 4NBXB 4KC3B 1BZQK 1TTRA 2IDTA 1IAKA 2VR8A 2KQMA 2ZUQC 3TA3A 4ZMNA 1U8KB 3MV8E 1TJGH 2EYRA 3PPEA 3V5KA 1ZEAH 2UY6B 3UZVB 1Z32X 4NCC1 1UH4A 5KVGH 2ZWNA 3X13B 4GB9A 2VC2L 4YC2C 5AOLA 1FGNH 1S7TB 4C55A 3KZ8A 3GLDA 1I1YB 1NCDL 2C7UA 5DD6B 2D7TL 1UKSA 4OD2B 4R4FH 3VI4E 3E6HA 1MQKL 1W91A 4B3EA 1HHJB 3UIZA 1X9UA 4WJ5A 4WWKB 2I5YH 4OZIE 1RPUA 4YHPA 2AXJA 2CBQA 1X7QB 1LK2B 3IB4A 2VDML 2OXHA 3NIDB 3QZWB 4QPBA 2XWBB 3C9NA 4B60A 5EORL 4NFCA 3BP6B 3CPUA 3MBEB 4L1DA 4L29B 5ICXB 2V3EA 4DEPC 3P2DA 1PQZA 3LKOA 5IHUL 4HWEL 5E2WH 3ATDA 1QHQA 3TWCH 5F0JB 4RFEB 5DJ8A 2CG9X 1TJHL 1QPPA 3AABA 3B9VA 3FTSA 2HAZA 1YYMH 1O6SA 2O6EA 3TBTB 3X3FH 2YARA 2GJ6A 2R1XA 3PCYA 4YHOL 3ML8A 2Z8SA 4MA7L 3D2UD 4Y5YA 4GQRA 3LS4L 3VB9A 2QR0B 1TSHA 2LR4A 4AJWA 1F3JA 3DI2B 4R97B 3HAEH 2PNDA 3AT9A 4LSSL 3REWA 3IJSB 5D1QC 1IAOA 2VRAA 3B9KB 4XN7A 1U8OA 3ZQWA 2KPNA 4RAVA 2P45B 4H8PA 3BPLB 3IMSA 4I77L 1GJUA 2A9NL 5HHVL 3QARA 5EOTA 5AW5B 1CD9B 4J28A 2E46A 1KN4L 2Q3XA 4KQ3L 1EA9C 1QBLL 1Y6MR 1FFTB 3LZFH 3BRGC 3FTZA 4ICWA 3IS0X 3QNFA 4PRHE 5DJYA 3T2PA 1IGTB 5HY9B 4DQAA 4XT1C 1KPUB 4F1SA 4PRIE 5TQ0L 1E3ZA 4DTGH 3UAJC 3EFFA 1HTYA 2AQ2A 4ZO8A 5BRZE 5HDBB 2D03L 5IK3B 1IC7H 1WH0A 2EDDA 2YRBA 5I8EB 1PZ5A 1JPTL 1FZOB 3FUMA 3VXTB 4GJTB 1IZKA 3MRJB 3FK3A 4FYQA 3CZFB 4NJ9L 5IY5B 1DUYA 3MGTB 1K9TA 3H3BC 1XMEB 3QW9A 1XF2B 5IB3B 3HPLA 1WIUA 2ZTBA 4ATTA 3CZUB 1TNMA 3KXFB 2BNUA 4Z7NB 1MHPH 1PFCA 3V0HA 1FN4B 4QRRA 1XGRA 5DMIL 3KDMA 2DEYX 4UQAA 2B15A 1UGKA 2PYFA 4N90D 1N8ZB 4PLKD 5EU6E 5CSBA 2WZ6A 4FQPA 1EEUA 3Q5OA 4ZBJA 4G6FB 4AQZA 2QVIA 2YRLA 3WLBA 2PCFA 1G9NL 1UZ8A 2JIXB 2C3GA 3C5XA 3FHEA 3NZ8B 3KYKL 4JCLA 4QHKI 4H8WH 2CRMA 4UT9L 3U0WL 3KPPA 5J57B 1NSNH 4JM4H 4XPBL 2X6AA 1SXSA 2OSLA 3QXDA 5FB8B 4X7FC 2BY1A 2DB8A 3PWJA 5IKCA 4LCCA 1FPTH 2APWA 3DK0A 1BVKA 2FJFB 2OMTA 1BGXL 3BZFB 3ZDWA 3WYRA 3KWTA 4UTAH 3VXUD 1CU4L 5FYLD 3S37L 4YDLB 3ZKQD 2D73A 4LCYB 5BMFL 4NN7B 1Y07A 5TE4L 1HZLA 2CLRA 1FLRL 5AVRB 2CR6A 4MAYB 5LWYH 1OT4A 3BUTA 5GS0D 2E47A 5GGSA 3QI9A 2X6UA 2BSTA 2G3NA 3RFZB 3WE6A 4XOEA 3EDDA 4L8BB 1AKJD 5L88L 2QADD 4FKEA 3HZVB 1YAIA 4FNTA 2WXNA 4WW1B 1CVSC 1NGYB 4QRRD 2JKXA 3VXQA 1I3GH 3CFQA 2A2QT 3PWVB 3PQYD 4LP4A 2XXMB 3HE6C 3AXLB 1PZUB 3HG3A 2A73A 4Z7AA 1NGQH 1XHHA 1NQBA 3GNMH 3JTTA 4PRBA 5EU4B 3SQBB 4AMKH 4LHJB 1TPXC 4FKHA 4P8QA 2K78A 1JNHA 1I7ZB 4XPHH 4HWBA 2ZCHL 3ILQD 3WIHH 1UH2A 5HHME 4KTDL 1NPUA 4QP5A 4PM1A 2D0HA 3PU7A 2RMNA 1NBZA 3IT8D 4ZX5A 1ZE3H 3B83A 1CGXA 3T3PB 1RLWA 4MS6A 1P4IL 1WG3A 2QQLH 4FTVA 2B2XH 2HPOA 2WLLA 5BZZA 4AEEA 2YGVA 3M7OA 4QJ5B 1BAFH 2AJ3B 3I85A 2CWRA 5ISZE 1DVFC 2VDOB 4FQ1H 3SYAA 3QCTL 3IJYB 4HFUL 2C4XA 4GSXA 1TZHA 3DPDA 2QPDB 1P4BH 4XPFH 4UDUB 4ANUA 2VN5A 3BH9A 2OL3B 1OLLA 4XVTL 1XD1A 5DK2A 4YPJA 5IW1B 2CGYA 1HC1A 4LPTA 1HHHA 3KVPA 4OFPA 4QRPD 4UT9A 1RZPA 5KS9E 1SBSH 2RCSL 2E27L 3GMRA 4TNWF 5CJQH 1CFVL 4YHPB 5A7EA 2GHZA 3VXSD 4JFZH 8FABA 4WK2B 1J0IA 2OI9B 4RESB 5D70L 2CSPA 2BP3A 1F8TH 4NRXA 4JDEA 4EUPG 5K9QG 3I2CH 4IRSA 3Q6FB 2FEEL 3DVGA 3ILPB 3AMLA 2W5PA 5DJ0B 2FL5A 1Z3RA 1KPVA 2CO6A 2H26A 3CXHJ 2EYTB 4MJIE 1W72H 1H3UA 5B1JC 3U0PA 4PW4A 4AGOA 4DN3H 2FEJA 4HH9B 1NC4B 1A6VH 2UX7A 2VABB 3QG6A 4JFDD 4N0UB 3F62A 1P1ZA 1WCQA 3L3GA 2J25A 1KELH 2MQGA 3EJSA 2FJSA 2JIXD 1DL7H 3HI5L 3INOA 3PV6B 4PJHF 2FYVA 2WZ0A 3EGSA 4HJUA 2PTTA 1EZLA 2YUWA 3I6LD 4H8HA 4U0QB 5CP3A 3D0VA 4YR6B 3SCMC 2CO1A 3ZYOA 1BEYH 2ICEC 1U3JA 5MI0B 4K5PA 1G7JB 2IAMC 4HETA 3ET9F 2ADJB 4G6KL 1A6TB 4HCRA 1IBBA 4NIYE 4P2QA 5D7LA 4ZUSA 2XG5B 3DRQA 3RGHA 3NCCB 2J2ZA 4JO2H 4KDTC 4D0CA 3S36X 3BZ4B 5IR1B 4KO9A 2Y7OA 1J10A 3PL6A 4HUKB 5FFGA 4LLVB 1NUGA 1A4KB 4ZX4A 3ARFA 3BWSA 3Q3GB 3KYMB 3BC9A 3TNMA 4FQQB 1ID5I 4WI6A 3K2IA 1OL0A 1OPOA 3LQAL 4XCYA 1HX0A 5T5NF 3ZDYF 1YSOA 4UTBL 5IVZB 1QLEH 1A22B 1WD9A 4TOYH 2QQKH 2GC7C 4MHHI 5JIIA 3JVGA 1K8DA 1BZ7A 4EI6A 3Q43A 2HFGL 1H0DB 3LN9A 2C1OA 1ADWA 3LZFL 3UG4A 1MWOA 3GRBA 3QUYB 1QBLH 5HVGB 2DKSA 4V1DE 4RETB 4PB0H 4OT1H 1A9BA 3EYFA 4KKAD 4V33A 3ASOB 3GTTA 4BK4A 4J1UA 2MIZA 2YD8A 1M57B 2CCVA 1B0IA 2BVUA 1EGJH 1T20B 5D72H 1QG3A 3K6SB 2BZCA 5CINL 5EU7C 5HGGS 2LAGB 1TU2A 3IFOA 4U1LA 4UQ2A 4KUCF 5FGBA 1T20A 2MKLC 3DVNA 1UWYA 1IEAA 4J6RL 2F6AA 1SYVB 2ESVD 3HLAA 3O8XA 3LAFA 4G6JH 4EIGB 5D9SB 2CDFA 4JB9H 1OZUA 3DSNB 4H1LB 1TQCC 4NPYB 3RPIA 4EIUA 5IMKB 3MLRH 1AC0A 2N1TE 3NIGE 1EZSA 5ISZB 5D7LD 4N90E 3HHSB 4XXWC 3OKOA 3VU1A 1XB3A 2XV6B 3MUZ1 1HE8A 4ZD3H 1FC1A 4JPVH 1QLFA 4LP5A 4BBWA 2V9TA 3MLVL 3SJVB 1MI5A 2BNRD 1FL5A 5IHLB 1A1OB 3KYOB 2DAVA 4N2OA 5F0LB 3T0EE 3H7BA 3ATEA 4L0PB 1YVLA 5F7BA 3PWLB 4YNYA 3BUDA 4NDMB 1BOGB 4M48H 1KBGL 1WO2A 1YDPB 5EO0A 2J1KA 1LMKA 3QEQA 2WK2A 3QCVL 3MBXH 4OLUH 1ZGLB 3BKYH 5KJRH 1HIMH 1V7NL 4XHJC 4G1MB 3RB7A 4I87A 4GRWE 3ARWA 5IF0A 2JKTM 1DCLA 3A4EA 2JQZA 4IHOA 2IH1A 3TO4A 4AIXA 4PD4J 4NZUL 1RQ5A 1I9IH 3VGFA 1RIUL 1WHOA 5E6RB 5BOZG 3BWUC 2K9FB 3ZTJH 1GGRA 1QEWA 4M7ZB 3O4OC 2ERJB 1SVBA 4QOKA 4XX1E 5E8OA 3Q06A 1AVAA 1A9VA 3KR3H 3QIBC 4OZFB 2JXMA 2X4RB 3W2DL 3DXAA 2GG1A 1WFTA 2V17L 2X2IA 3VXMA 1YYCA 3CSQA 4NQDE 1ZK5A 4JM2F 5DZLA 2H26B 1VPOL 2JH2A 4PJCF 4P3WA 3CQFA 4K23H 3FQXB 4WFHE 2ID5A 3EJCA 3K4ZA 4ANKA 3SKJL 4OV5B 5KVEH 4IU2A 2FX8L 2QQNL 4X6DF 2PO6C 3D50A 4LRIC 4W68A 2XA8H 4FQXC 3D0LA 1F90H 4OKVA 3EH2A 5MHSD 1I3RB 2N0MA 3CX5J 5EULV 1GGTA 3BEVA 3X17A 5KSBB 5CIPB 2LT9A 5D4QA 4OF6A 4A39A 3LZRA 2EXSA 1V5JA 3QPXH 1OWRM 2ICWA 2HFGH 3ARZA 5F7FA 1JNNH 3EAKA 4AITA 2EUWA 1RUQH 3VW3H 1MH5B 3UTTB 5I66A 3L54A 4F5CE 5JUEH 5L2JB 1AZRA 3ISWA 3LD8C 3P4NA 2XVBA 3M17B 1QLEL 3ATAA 5FUCE 4YSPA 5C0DA 4D0DA 3T4AB 1DE4A 4N2IA 1ILSA 5IR1A 3OF6A 2HJFA 3PGDA 2J20A 2XQYG 1FBIL 1VACA 2DYPD 3FT3A 3UTPE 4HWZA 4NO0A 1TLKA 4R90H 2F53D 4TRPH 3O41B 4OLZL 4MD5A 4GUCA 3S96B 3NIFE 5IW6B 3H1ZA 2Y4SA 3P69A 3F5WA 1WWBX 2DWEA 1SHMA 4UZUA 4GP5B 2XZAH 4L8SA 4U6YB 2XTJD 3CH1B 1DJXA 2C26A 4BKLA 2X1OA 1YQVL 4U6VL 3S4SA 3UADA 2IDQA 4PRBB 2HX8A 1J9CT 1AQDA 3S4SG 4IRJB 4P57A 1HK6A 4PRHB 2YAPA 3EBGA 3QDMA 5DHVA 1J8HD 4AV5A 3ZT5A 1OB0A 1WCBA 5I15H 2UVEA 1PU0A 4EI5D 2Q20A 2XZCL 3V0FA 1BX2B 3QUGA 3CDGB 3T3ME 4PJ9A 1A7PH 3S37X 3RFRA 2NX5E 5TGBB 1A7BA 1P6FA 1XSJA 3AXLA 1OWWA 3GT6A 5D1XE 4B41A 3THML 5JHAA 5DJDA 3MV8D 1ND0A 3L1OH 4LU5H 4IMLB 2WP3O 1NCAL 3AAZA 1JXDA 2BIIA 2CO2A 4Y2DC 1RIVH 4YSUA 5EF1A 2WB1A 4HSCX 3QJZA 3G3LA 1O5DT 1F4YL 3C8HA 1DQMH 2RQ8A 2RA1A 3BKCL 4LCYA 3IJ8A 4P9HH 3CMOH 4Y5XA 2VZTA 4KJQC 1LEGB 3FFCD 5IB5A 1LVEA 1RUPL 1BQHG 4I2XA 3WXVH 3WNJA 1FDLH 3O0RL 2VDQH 1ZS8A 2MPVA 3HI1B 4FLHA 4I4WB 3KGRA 4U1NA 3HBQA 4NX0A 3K80A 1SY6H 1MHCB 4KK5D 4JFOB 1CTMA 5J8OA 3MRRB 5F1NA 4QRPA 5KS9A 5HGBB 3OGOE 2CUHA 2Q8AH 3ZMEA 3BAYA 2F68X 2XTJB 3IKCA 5K9JH 4Z7VA 5KBDA 3EOAB 4PJAB 1TZGL 2Q8AL 1ORSA 1ET8A 4FP8H 2W9EH 4JRYB 5FLUA 4D9RE 2IVFC 2EIMB 4IDLA 4P2RA 5AVTB 1AX3A 2F9BT 3BJ91 3ESVF 5HHXL 2CRYA 4H40A 3DUUB 3CH8A 5HHPA 5AZ2L 5AOKA 1TYRA 5FA4B 4BZYA 3SQBA 1MJ8L 4NJ9H 4OFKA 2NY2C 4ZQKA 1L5GB 2WQ8A 4QRSB 2EYTA 1XMWA 4LCIL 5SWQA 1XF2A 4LNRA 2GUYA 4KJYA 4NQCA 5A2AA 3L4CA 3UJTH 2PR4H 3LZLA 2AS5M 15C8H 5DEJA 1YMME 2NYYC 3DX3A 1B3JA 3ZO0A 5ITFA 3L3OA 1ZXQA 2EEAA 1KUMA 3SY6A 4MWFA 3B7UX 4R7NB 1F6AA 1NCAH 1F4AA 2W95A 3U9PL 4D8PB 3JWDC 2NT1A 5CCHE 2W0FB 4LHUD 3L3OB 4CVUA 2B0SL 3MJGX 1FLRH 3BIKA 4JL1A 2K45A 3N04A 1U3ZA 5I1KL 5TE4H 5JPMA 1M3IA 3WTVA 5LG6A 5DHEA 1R3JB 3C75A 1LO3L 4ZX6A 2MKWA 5ERWA 4NUJA 1D5ZA 1X9RA 2A9NH 2D3NA 1ZLWH 1BEXA 4NQDA 2CLRB 1MCOH 1L7TH 3QXDB 5FCSH 5HI4C 2BHYA 2X4PB 3P4MB 1FPTL 4FOMA 1E4WH 3IFNH 5DS2A 1U92A 2JFCA 4U1JB 5JHBA 4HGWA 4K3GA 4KPHH 3RX9A 2WYTA 3LS4H 1JPSL 2OX5A 3Q48A 1G9NH 1H9DA 4BZ2H 2MHAB 4AYID 3AQZA 3K6DA 1CF1A 3NN8A 3R18A 2AJYL 3SDXE 3S5YA 1A9EA 3N6YA 5BZXA 3V4PA 1J8HB 1SN5A 2WXFA 2ZYSA 1MNUL 3GIZH 4IU3B 1TTBA 3FUKA 4LEOA 3T0EC 1JZ3A 2IWGA 4FJYA 2YRPA 1OF0A 2BVYA 1ZTXE 2VDOH 1TQVA 5FUOH 4NKOA 5C9JA 1QRKA 1XL4A 2KZ1B 2VQUA 5CP7A 2FB4H 3LCYA 4UV7H 1F4WL 1C7TA 4Y4HA 1FNSH 1S2EA 4PJBB 5D8JH 2GKIA 4R84A 3DWTA 3KD4A 3ILEA 4BGDA 3QUKA 3CHPA 3L5WB 4L8CA 3FPYA 3P0YL 3TN0A 4PJFF 3WN5A 3OKNB 3F58L 4OFDA 4GKOA 2NR6D 3BPLC 3IDIB 4OIFA 2BFGA 2QL1A 3GHBL 1YECH 4YXHH 2KDGA 2C9AA 3MV9A 4O9HH 3SDXA 4WI4A 2DYRB 3RY5A 1XGYH 1HHKB 5TF1L 5D1XD 2GSIB 2EO7A 1KCVH 2R23A 2F7RA 3EJPA 5C0CE 4XODA 2VC2H 5ICZB 1A6UL 2DTSA 5BS0B 3I74A 3I6SA 4OGAC 1MELA 2DH2A 2LU3A 3LKNA 3MREB 4KUZL 4U0RC 5GS1B 4OZIB 4OQTL 1W0WA 2D3LA 5FS5A 3A23A 4OCWH 3U36A 4ELMF 3DYOA 4UTAA 2BP0B 3BFOA 4L8DA 1XDTT 4UWQB 2GU1A 5A2FA 2IV8A 3GMMB 3L13A 2Z91A 3EJRA 2AQNA 2YMXL 4KROD 4WFGE 1N59B 3KEDA 1XH3A 2FATH 3V0IA 4NP4H 4LPYA 3I6KA 4Q9CA 1Z9MA 4BH7B 5HYQB 1CYXA 2CK0L 3RNQB 2OMNA 5GGVL 3V5KB 5IOKA 3TIDB 4RRPM 1U36A 5AFAA 1N0XH 1UA6L 3NPSB 3OJMB 4PSRA 1U3NA 4D3CL 1J5CA 5A7BA 3IK2A 5HGBA 3LYRA 4I0PB 5FHBL 2VR5A 2CJUL 5JMOC 3IE4A 3UTPD 3MODL 2FB4L 2ZP9A 2WP3T 3O8XC 1JMXA 4TSCH 4WNQB 3E1F1 5C07E 4JDZA 3TNNA 4FNRA 4GBXA 1KEMH 3LRKA 3ZTJG 1AIZA 4G8FA 4FNLH 4IBLT 1GTFA 4JNXA 2ADFL 2BCKA 4O5LL 5DTFA 5FFOA 3SGKA 5GS3A 5D4JA 3WIIL 2ZSVB 2F0CA 4LHQB 4LQFH 1Z3GH 4KZ0A 1RJZA 4WENB 4ADJA 4PCYA 3S98A 3SE3C 4PV8A 1I3RA 1RZFH 3F2LA 4G9DA 4AUJA 3BW9A 4MDRA 5FO8B 4LLUA 3OR6B 2IGFL 3SE4A 3ILQC 5C97A 2GJJA 2WLYA 4AT6B 4AMXA 1T22A 2UXFA 5ITFB 4U1KB 3V52H 3BSGA 1NC2A 3FQXA 3AS0A 4XP5H 1XL6A 3MQIA 2MNUA 3U6RB 1QP1A 2R2BA 3P4OB 4DKEL 4CKQA 1E4WL 4LARL 1HH9A 5EZJA 1U95B 2APSA 2GT9A 4FHKA 1EGJA 1VZIA 3L5JA 4XH2A 5C8JA 5IT2H 4LEBA 2XKNB 5CLYA 2XDHA 4IMLA 2VKWA 3C60D 2OTWB 4XMKL 1PZ3A 4Q9RH 1NMAH 1OTUC 4HJJL 3KPSE 3UBFA 3BISA 4MZ2A 5E00B 3NK3A 5C0EA 2B59A 2NW2A 1EEYA 4B9CA 4LASL 4NWUH 3VDBA 1Z5LB 1KXTB 2NOYA 4KVCH 2L7QA 2P8MB 3F00A 4AH2B 4DGUA 5ADPL 1HXMB 2BVPA 1YHPA 4JG0L 1FAIL 5FCUL 2F54A 4N9GA 4JG9A 3UAJA 2E7BA 2GJ6D 3IDNB 5BZWA 2XACC 3HI1A 4I4WA 15C8L 5D1QA 5TJWK 4OB5L 3ROLB 5JQ6H 2GJZA 1F02I 2AFNA 3FHQA 1CT8A 4UOQA 5C2BL 4PVMA 4BFKA 2FE0A 5J13C 1FNEA 4F9LA 5E99L 1UH3A 1JHKH 2QZQA 2OMVB 4LQFL 1IV8A 2AJXL 3WS6A 4Y5XB 5K9KB 5MENA 3PUCA 1CI3M 3KCPB 1BOGA 1W2KT 7PCYA 2GQHA 1H9VA 4IOFC 2VW4A 3DYPA 3L2MA 2M26A 4PGBA 2V9QA 2VM9A 1FFPA 3C6SB 4H26B 5FHAL 1PYWA 4XBPA 2V8LA 3GSVA 4UIMA 5I6NA 3IRCA 4A7QA 2G2PA 3NACL 3ZYJA 4KVNL 1CDYA 5E8PA 3JQOB 2UZIL 3WJLC 3HHSA 5F44A 5C07A 5AYUL 2Q6WB 4PLKC 2WUBH 1YNKH 5E5RB 2DJUA 5EA0H 1RV6X 3TASA 4MD0B 3TTSA 1WWAX 1G7MA 4QTHA 2CK0H 2BVOA 3ARVA 1PLCA 2DBLL 2YUZA 2JJTA 4P9HC 3FUJA 5AG8A 5CCJA 4NKMA 3UTTE 3VWKB 2CUMA 2ZX6A 2V5YA 2X4NA 3CHQA 2J5LB 5KG9B 3FO2B 5F89A 3K2UL 1EJFA 3KHOA 4XN1A 2EYRB 3MV01 5FYKU 3WNIA 4OV5A 3KPQA 3LDBB 3MLSH 3PWPE 5DR5L 1HESA 2YFNA 1QEXA 1U8QA 2CNYA 5DC0A 3SODB 4A2LA 4F8QA 4Q9QL 4YSQA 2RAMA 3QEQE 1PSKH 3VRLE 4QAWA 4P23B 5DJXA 1EXGA 5IBUG 4I89A 4Q58C 1KMGA 2WN3A 4UU9B 4XPAL 2IPTH 4JX0A 2HTKD 1ZY9A 1DVUA 3L5XH 4PJ8D 4FHBD 2VN3A 1UG9A 5KTEH 2E9WA 2X3BA 3E80A 43CAA 4HEMA 1KJMB 2EXYD 2Y69B 3DARA 1GC1H 1ASOA 3KG5A 4TSBH 5E8EB 2NW3A 3Q2NA 3VFUA 1Z0MA 2EDBA 2JE8A 4L0ZA 1T21B 2LOEA 4Q2ZA 1BJ1J 1O2FA 4ZT1A 1OW0C 1FRGL 3FQNB 4GXUM 2D2OA 1E9OA 4JR9H 1T04B 2QADC 2VXQA 4P5KA 3RGVA 3JV0A 3WFCL 4Z3FA 5I19H 4BYHA 4UM8B 4ZXBB 4CRPA 1GMIA 5C07D 5HVWA 5EN2B 3L48A 1KGCD 4YXKH 4A6YL 5AD0B 3N41F 2P52A 5AVZB 5I18H 4M93B 5DRWA 3BSZL 3IN0A 4NO5A 1EXHA 3R8BB 5DFVC 3EYVA 3TURA 2EIDA 3W9DA 3GWJA 4ZPVA 4QKXB 1QZ1A 4YK4C 3U6XA 4MQSB 1PNCA 2YPKA 3GI8H 4LOUC 5DI8A 4G6AD 2OR9H 2HX9A 2YZ8A 1TZAA 4G8GD 2VXQH 3M07A 2VH5L 3FQTB 4FFYH 4YS4A 4KZCA 1OHZA 2CR0A 3OV6A 1MDAA 4XPTL 1XEDA 4HLZH 3VFMA 4FAAB 3LKQB 2Z65C 4PWHA 1BBDH 1TQUA 4KU1A 3FQRA 5DHMC 4B9ZA 4HT1L 3T77A 1J9RA 4CGUB 1KIRB 1JERA 1VF5C 4FL4B 2OYLA 3TM6A 3GMRB 3S3SA 4BFIA 4UB0H 5FECA 2D7PA 3KLHD 5DK2B 1B0GB 5KBNC 5DR5H 5E8NB 3RJDA 4U1HA 3S34L 5KSUB 4E42B 4UAOC 1IAIM 1UB6A