2HSIA

Crystal structure of putative peptidase m23 from pseudomonas aeruginosa, new york structural genomics consortium
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
257
structure length
227
Chain Sequence
SFIMRLLNKPVPGGVAVVDLGEEGPPPRAFYQGKPVLVVREEGRRWIAVVGIPLSTKPGPQKLEVRAATGNHEERFSVGSKPEDLKRIERELAEQTAAYRRFSPGLPSNLMLDKPVDGPLSSPFPHSGLDFAVPAGTPIKAPAAGKVILIGDYFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIFIGAFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peptidase M23
publication title Crystal Structure of M23 Peptidase from Pseudomonas Aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 58
structure length 227
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18421 Peptidase_M23_N Peptidase family M23 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1590 Mainly Beta Sandwich Immunoglobulin-like Peptidoglycan hydrolase domains 2hsiA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 2hsiA02
3CSQA 3OURB 2B44A 4RNYA 3NYYA 1GGRA 1GLEF 1O2FA 4QP5A 3TUFB 2B13A 4ZYBA 4JBWM 2B0PA 1GPRA 1GLBF 1GLAF 3IT5A 1F3GA 3UZ0B 5KVPA 2GU1A 3SLUA 4BH5A 1AX3A 5B0HA 1F3ZA 1QWYA 1GLCF 4QPBA 2F3GA 2MP0B 4LXCA 4RNZA 2GPRA 2HSIA 3IT7A 1GLDF
chains in the Genus database with same CATH superfamily
2VXSH 1U2YA 2YPLE 3VGGA 3I9AA 3QQ3A 1LEKA 1BZOA 4KMTH 3W39B 1S8DB 3TYFB 3QJFA 1WFOA 4LVOB 3ZE1F 3VFPB 3IMSA 1UT2A 3DMMA 2G3XA 4A68A 4X4XA 5IW3A 1S7XB 2EZ0D 5GQBA 5BS0B 5JW3H 4LCWA 3V5KB 4ZBJA 1YJDH 4PJXE 1CG9A 3D48R 3IJ9A 3D51A 4OZHA 2BP3A 2HYMA 3WMSA 3SQOH 5KBNC 2CHDA 2QSQA 3HBPA 1AC6A 1WUZA 4HPYL 3SE4C 1W15A 4X8XA 3L54A 3FU6A 5C0IB 3L3DA 4Z3JA 5E9DE 4IJ3B 4LPXA 4Y88A 1GGRA 5BOZG 4ZXBC 4HKBA 2A3TA 4OD1H 1ZT4B 3HS0B 3JVGA 1HHHB 2X12A 3HFFA 2GFBA 3ZZLA 4GUQA 4LNRA 2EE3A 3T4AC 1TJIH 1MXDA 2OSXA 4G8AC 4JDTL 5HJBA 3GSNA 3N41B 4MYWB 5SV3A 4AYBA 1OAKH 3NA4A 2NQCA 4BCYA 2FWLB 3VXNB 2EH7L 1OAJA 1RZJC 3HZKA 3KXFE 3EH1A 4CBZA 4CW1B 3OQRA 3AGVA 1MJ8L 1OARL 4J28A 5DYOA 4AVIA 2R4RL 1BD2E 1MFDH 4H0GA 1XAUA 3OB8A 2J1YA 3QHFH 1KLFA 1MLCB 4NZTL 2RR3A 1E9OB 1EEQA 1U58B 4LVNC 5DT1L 3WHE1 3AG3B 3KHOA 2NY1C 2P5PA 2G2NA 4GRWF 2E7CA 3AWGA 4EI6B 4ZS7L 3WGVB 4ZI8A 4PVBA 3F7YB 3IPBA 3NJLA 5A43C 3HNTH 4N2MA 3VW3L 3MLVL 3NPSC 5CF3A 1J5CA 5AZEL 3ARFA 2XPGA 4LSPH 2FNWA 2QKIC 3NOIA 3EBGA 2HRPL 4N25A 4OI9A 1D9KA 1QAWA 1P7QD 3HHRB 3BPCB 2ZG2A 3DXAA 4PLJD 4F1ZA 2D3LA 5EU7C 1YEKH 1PBYA 1H8SA 3WKPA 3BSGA 1VENA 1N64H 4UTAH 3CCHB 3MC0A 3TZVC 4AENB 1BF8A 2UX6A 4ZQTA 4IDJL 4XTRC 3BRGC 4FTVB 5K93A 2GABA 5HGDB 1FFOB 1S9KC 5GGRB 3JV0A 3FCUB 2C3VA 3S6CA 3VGAB 2A6JB 3B9VA 2V5TA 3S88L 3MQIA 2CLVB 1ZHLB 4UWQB 2QFPA 2E86A 3D18A 4G1EA 4TL5A 1ZSDA 4AV5A 2B59B 3G3LA 5ISZA 1KOAA 2BFVH 3IDMA 1EZUA 1COBA 4J3TA 1AI1L 1CR9H 1TJGH 2W07B 2ZD0A 3K8LA 2EDEA 3MR9A 4MJIE 2V5SA 1MUJB 2R29A 4OF3A 4UM9A 1BFTA 2WYIA 1IBYA 3LMJH 1P7KB 4YQXH 1D7FA 1FPTH 3ES6A 4FNRA 3PHQB 4OU3A 3D85B 4AYEC 3TF7C 4YFDB 1KJ2B 1N70A 4HBQA 1U8NA 4XO4A 4X0NA 1MN4A 1K4CA 2AQTA 4X50A 1Q72L 5HVHB 2LR4A 3F5WB 3JWOC 4FABH 2EH8L 1QNIA 4DN4H 5BMFH 5D8JH 1KG0B 2FO4B 3HPJA 1OF2B 5GJTH 2Z31B 5JHDD 5J3HC 3WAKA 3FRPB 3MRCA 4WWKA 5CJ5A 4WU5B 2TSAA 3I50L 3CHRA 1Z32X 3FKUS 4KXBA 3TBSA 4X5WB 4ILDA 3ARED 3IKCB 5AFAA 1WBXB 5F88A 3N9GL 1KGJA 2F1AA 3MV7A 2J6EL 3W11D 1JZJA 2EXWD 2F53E 3WHXB 5J12B 4MA8L 3RIFK 5C0EB 5DMJB 1T0MB 4OJDH 2ADIB 1AIZA 1TCRA 3OQ3B 4JM4L 1E0OB 2AK4A 1Q1JH 3ARUA 4H40A 1FWXA 1SJMA 4UQ3A 1UJ3B 4JRWA 2BSED 1L0QA 1GMEA 2EP6A 1U8MA 4HUUB 1GVIA 1MG3C 2VQ1B 4X8JA 2VSMB 3VA2C 3NSFA 2W9DL 4WO4A 1BDYA 4CVXB 2JKIS 4UCFA 5HGHB 1OTTD 4BE6A 4I3RL 5EIQA 4QRPA 3THML 1KPRA 5AUMB 4F33B 4UIKL 5DJ6A 2OMYA 3TBCA 3U36A 3X1NA 4IBWA 3H1ZA 1RLBA 2C9PA 4HLZH 4W9LC 3BEVA 3Q0HA 5GHWH 2HPTA 5K1NA 6TAAA 3UJTL 2C1PB 3MOQA 5DDHA 5F0MB 3I74A 1BVKB 3CHQA 5K9KA 5AKTA 5C2BL 4NO0B 2WXMA 5A6MA 4OQTH 2JIXB 3FTVA 5CP7B 5KUMA 5HGBB 1IC1A 1I1AB 3TF4A 2J8UB 3EGXB 4H7VA 3KBEA 5KANG 4Z5RB 3MACH 3LD8C 1NDTA 1F4AA 3TWCH 5D2NE 2JJWA 5KBLA 2G0LA 4CILA 5GRWA 3QDMB 4MD0B 3C87A 3EJTA 3TOPA 3OVUB 4FQ2H 3S4SA 3TA3B 3A6BH 4HD9A 3RWHA 3VJ6B 4HOZA 3NEXA 1QTSA 5A2BA 3RA7H 5TE4L 5HDBF 3BFOA 5DJ8A 1H3XA 2QADC 1CFQB 2JFCA 3B2UC 3IN2A 5T3XE 3S34L 4AC4A 4DEUA 1PZUB 4L9LB 3DHPA 4BQ9A 4OGXH 3KM1A 3IJYB 5AZUA 4X6DB 4NIYE 1CDCA 3IFOB 4OF8A 4QHUB 3CN1A 3UTZA 5BS0D 3WO4B 3TCTA 4YSEA 1J8HA 1RZQA 1TFHA 1W72H 2WKLA 2FX7L 4X4YA 4F9PC 4PJ8B 5AVVB 3BD5A 1KTLA 2FT8A 3NA9H 2VDPL 2IADB 3DK0A 2VLJE 5I8EB 3N0AA 2OTUA 5I73C 2BH0A 3KLAB 1ZJAA 1E4XL 1DVFA 1GSKA 5HPMB 1CL7H 5LGKA 3O6KL 2X4RB 1Q90A 3EJZC 4KJYB 1KEGL 2Z7YA 4DZBA 4UT7H 2ODIA 3GI9L 3MOAH 3O6FB 5F9OL 1GHFL 2UXGA 1QPPA 3ZKMD 5KJRH 3DX0A 3DVFA 3TWYA 4PJBF 4A38A 4M6ML 4PV9B 4JO4H 4A6YH 1O6TA 5D96B 4AL8C 2H3XC 1DSFH 2WLIA 3DX4A 4EQ3A 2JJSC 4YPGA 1F13A 1AE6L 1BIIB 3K6SB 1ZGLA 3MUUA 1L5GA 1T2XA 3B8SA 1U8KB 3G6DL 1RUPL 1IT9H 3HPLB 3SGDI 4FADA 3GMOB 1MRFL 4JZNB 1FRGL 5F7DB 3SE3C 4P9ML 1KB5L 1GYUA 4PSRA 4F7MA 1EAPA 4JFFB 4XAWL 1INEH 5JZ7D 1QFWM 3CVIL 4HS6B 5FYKU 1BZQK 5IQ9A 5K39B 5K59F 5BO1H 1UWGL 3LKPA 2VMEA 5DMYA 5B22A 5CEZD 3CLFL 3GM0A 3D1MC 1NAKL 2ZAHA 2FJSA 1FZKB 1WFNA 1BOGA 3Q9QA 4XO5A 2XICA 4DKDC 3ULSB 4FHBD 4FNLL 1BVNT 1QNZL 4IGBC 4ZXBD 3EO0A 3LEVL 1ETB1 4JFOB 2P80D 3F7RA 5CMAB 1A7OL 2V5MA 4QHLB 3LX9A 2ZXCA 4NCC2 4GUCA 2AJYL 3SQBB 1A1OA 1B3JA 2SODB 1YYCA 1GR7A 3UL4A 5DFVC 2PCPB 4XBMA 4Q7DA 3HUJF 3CSGA 1FV1A 4RCAA 2QQNL 5JLZA 2HFGL 4WFEE 4TLUA 1BAFH 4IW4C 1RK0B 5IKCA 1WK0A 2CPUA 3T2OA 2B1HL 1JTTA 4EPSA 4JFPA 1SVZA 3DX7B 4HLZG 4OGYL 4PLKD 4XP5H 4XVSH 3GT6A 4C83B 5I6LA 5L8KB 2GSGA 2KDYA 1PZ3A 4DUWA 1U8IA 2DM7A 2YO3A 5HYSG 4PRNA 5IR1A 3GHPA 5E99H 4OLZL 5AVTB 5I1KL 4R84A 5FCSH 4KK8C 5PCYA 2EDHA 1FG2B 5BRZD 1N68A 1BFOA 4GQQA 1PX4A 3FT9A 4LLAA 3D85D 4GNKB 4APQD 4KI5E 3K4ZA 3D0VB 4KOBA 3PHOB 4MJJA 5D72H 3UYPB 3LXUX 3FUHA 1WA0X 2W92A 3M46A 3QG6B 4M56A 4DO6A 3U4BL 2P47B 3L7FA 3MRKB 5CLYA 4Q6KA 1BWMA 2NW3B 2XWBA 2WZPD 3ETBF 4H88L 2OMVA 1ZEAL 4R5TA 2BX5A 3HCVA 5KBPA 3NZHL 3AREA 5CHNA 5FF6B 1E5BA 4OQ1A 5J8OA 4NEHB 1U9KA 1F6AA 1TZHA 3HAEB 5FO2A 3UZQA 1USQA 3RKDD 3W9DA 2R2BA 1U8PB 1JSYA 2OMUA 3BVNA 4H25B 4NOBA 1SMAA 3LRSA 1QBLH 4AWJC 2WXPA 1XVSA 4ZMXA 1HXYB 5TD4A 5LAXA 1ZHBA 2D0HA 2OZ4H 3CLEL 1NIEA 1RUML 4HD5A 1BCIA 2ZWNA 4ZW6A 2P52A 1G0XA 5FYLE 3S2AA 1CE6A 3PWLB 4G6FB 3ROLB 3S37L 1QZ1A 1IAII 1R47A 1J1OL 2FHCA 2EO1A 4QRFA 4IYKA 2R1YB 1MCCA 2K6YA 2Y6TE 4B9GA 5SX5H 3FZUD 4PJHF 4N8VA 4XP9L 5DMIH 2BNRD 3DKHA 5IEKA 1PDKB 2MNJB 2WYZA 1E9PB 4NPYA 4JQVC 3EYQD 1MREH 1ORQB 4P46C 2ITDB 2BOLA 1KBBA 1CGWA 3ZTCC 1AZVA 3U48A 4NXKA 2I5YH 4NO0D 3EFDL 2Q20A 3BVXA 3F7LA 4LFHG 5FCUL 3VSUA 5KSUB 4FFZA 4QRRB 2CBMA 4PRAB 5SV4A 4GMSL 1NMBL 1YEDB 3R0NA 4JM2F 4K7PX 5B1JA 5D70L 4LLUB 4PRHB 4PBVC 1HZKA 5GSRA 2EEBA 1C5CH 4GBXC 1B2YA 4DPBX 2ZKHH 2N4IA 2KHAA 2Q8AL 2JH2A 2EDQA 4KH9A 4OSUH 3ULUD 4IKLA 1XEUA 2L7EA 3GSVB 2IGFH 5ACMA 3MXWL 3M6DA 1S8DA 4RMQA 3SKOB 3TYFA 4IQHA 2Y2TA 1VAHA 5FKPB 3VFPA 4DK3A 3FONB 3AC0A 3DSFL 2IGTA 1YN6B 4FULA 5BS0A 1JRHL 4JLRB 5KWYC 5FYJH 4TVPH 2GSIB 3O2WL 4FI7A 5I1GH 1I1FA 4PJ8D 1SJHB 5B39A 3ULVL 4JCWA 2Z92B 2HT3D 3HJEA 1ZS8B 3WENA 3K2MC 2X6CA 5L4FA 2AGJH 3EDKA 4K7FB 5C0IA 5F7NC 4NUJB 2W88A 2YN3A 1ZT4A 3GLDA 3HS0A 1HHHA 1SNRA 4MCZB 5T5FA 4G2AA 2E9WA 1U8QA 1YEEL 4EDWH 5D9SB 4PJFB 2X4SA 1XXDC 1X7SA 5GZND 3VXNA 3VDBA 5KAQG 2EE9A 4TQEL 4OV6F 4BFGA 4CW1A 1B4RA 4RFNC 5ALCH 4WTZA 4M7JH 3VFTB 2ENQA 3QUKB 4DJMA 4AVJA 4LHJB 3NQKA 2WXKA 4LASL 4BM7A 1OGAD 1MLCA 1E9OA 1U58A 2ZXWB 5EU4B 3U9PL 2OI9B 1QSEE 3BVWA 3L1OH 4PS4L 3SBRA 3MROB 3S5LG 5EEUA 2ZX6A 3QZWG 3AS1A 1YO4A 3RJOA 2YPLB 4EI6A 1GW0A 1RP9A 2VW7A 2IDTA 3NCXA 1CLCA 2YPVH 3FU5A 4AKOA 4NZ8A 5E1HB 2VXVH 3GSNL 3R1GL 4OF7A 3QJUB 3BPCA 1XT5A 3WKMH 1S2EA 2L04A 1BXXA 3ZKSD 3DHMA 1OM3H 2B3IA 4PJXB 2DQIH 2Z6FA 4GP8B 3VU1A 2P80A 2ZUQC 1BZDA 3U7WH 1JPST 3CCHA 4AENA 1DEDA 5I5JA 2WAQA 4NNYB 4FTVA 2MCAA 1X6LA 1PYWB 1GW6A 1MHPH 4RETB 1Q0XL 4PJGE 4MQSB 5E9DB 5GGRA 2EVGA 2MQGA 2A6JA 4RGOH 1D5XB 2ZOOA 3OKEB 1FVEB 2CLVA 1ZHLA 3F04A 4JFSA 2JQZA 1WEJH 2CU9A 5I1CH 3K6FA 3KPMB 2B59A 1ZRUA 4HJ0D 5E2TL 5DQDH 1LP9F 2W07A 2QSVA 1MUJA 1E6JL 3KXFB 4NNPH 3FOMB 4XT1C 4HSCX 4MB3A 3PHQA 1BD2B 4J3OH 3D85A 3WBDA 4HUKB 4YO0B 4R97B 4APQA 1KJ2A 4QTIL 3KLLA 2R56H 3V0WH 4KO6A 4Z0XA 1CFBA 3F5WA 3RE0A 2WZPA 2AZAA 1NIAA 1KG0A 3FDWA 1OF2A 2Z31A 2G3NA 4UU9B 2F2HA 2FAUA 3FRPA 3RLSA 2J73A 2AXGB 2E4FA 2Q3XA 4WU5A 5A2IH 4AXWB 2ODHA 2VB5A 5E8DL 4QXUL 2YLKA 4JO1H 4X5WA 3RYMA 2R29L 3IKCA 4YDKL 5DFVD 1AR1C 1VRSA 1WBXA 4Q89A 5C0GB 1GCFA 1J5IA 2ZX5A 4Z3GA 3R7RA 5JIQA 5KVFE 3C5SB 4IU3B 4K9JA 4HC1A 5C0EA 1T0MA 5HJDA 1OP3K 1XF5B 2ADIA 5I17B 4L5FL 1YEIH 1X5MA 4UBDC 4BSWA 4GOSA 4KPHL 5LJYH 1F58L 2LHAA 4S2SB 3DYOA 1UJ3A 4Y2DC 2UZPA 5KG9B 3NCFB 1A7PL 4Y4KB 1CGSL 2CHZA 4FG2A 4K2UL 5BV7H 3UPRB 2QSCH 3PP4H 3K4AA 4HUUA 3B7TA 2VQ1A 2YEZB 5AEAA 4KXZI 2Y07L 3D3VD 3CK0L 5IIEA 3P3RA 4G6AC 3RHWF 3UP6A 4CVXA 5I8OH 5HGHA 5CLZA 2C34A 4F33A 5AUMA 3V6ZA 1P53A 4MJIB 2NZ9D 1CGTA 3MLYH 5INCB 3WY2A 4JHVA 1VZGA 4FNPA 2FVNA 2BY0A 2ZUVA 4PJEB 3CFBB 4PG9B 2C1PA 2XN9D 1QWUA 1BVKA 2JK5B 4NO0A 3DIDA 2R0ZH 5CP7A 1NQBA 5HGBA 1I75A 3LY6A 1XR8B 2J8UA 3EGXA 4DPRA 5F7WC 3JT0A 2CJSA 4Z5RA 3O4LE 3NQIA 2F08A 4QRRD 3BI9X 1ZVHA 2HTKC 2BWDA 5JYLA 4PRHD 2QV2A 1F0LA 1W8OA 4W9KC 4YXLL 3WGUB 2ICEB 3QDMA 5CLTA 1TSHA 2BHFA 2BVTA 3TA3A 3VJ6A 1NCCL 1A7NL 1L7IH 3V8OA 3OG4B 3TEXA 1CXIA 4MS6A 5DHXB 8PAZA 4A04A 1NFDE 1X4YA 4FKKA 1CFQA 4GAFB 1ZVNA 2F53B 3MCLH 1WAAE 2W65B 1N6QL 3KAAA 2H7WA 4GY4A 3CFIC 4XPHL 1MFEL 5K1VA 2FR4B 3CQQA 3IJYA 2KS0A 4TQHA 2CDEA 2EIKB 4X6DA 3SKJH 3ZQ9A 2H2PC 3IFOA 4DIXA 3CBRA 4EIZC 4XP6H 4WI8A 4MQTB 1ODAA 4JG0H 5I6MA 1KYUA 2H0EA 3ZHNA 1ITBB 4FLSA 4PJ8A 2CHNA 4OBRA 3KPSD 3SDCC 3UTPE 1B2WH 2UXVA 3LZRA 4XC3L 2IADA 2FNBA 3N06B 5I8EA 1ZV2A 3KLAA 4NQQA 3BWUF 3O6LH 3W5NA 2CUAA 1IGJB 1XCXA 2UXTA 4N22A 4DTGH 2D7PA 5HPMA 4MNQE 5LHDA 5DF0A 5AALA 5GZOD 1UM5L 3DROB 2X4RA 3ASOB 3QBTB 1FFNB 3V0IA 3NFNB 1SXSA 1JVLA 1P5UC 5DJ2B 5GZNA 3O9WC 4J3OG 4U1IB 4D2NA 3FN0H 1SM3H 4PV9A 5TGBA 2WYHA 3K6SA 5AD0B 1BIIA 1OGAA 2OBGA 3CSYB 1NANI 3KG5A 4I7ZC 5E4EC 3VVVA 2ZKMX 2IF7A 2DV6A 5KVEE 4IMKA 5D2NB 1LD9B 1U8KA 4QUOA 2A9ML 3HPLA 3EYVB 1JP5A 4M5SA 3GMOA 5HHXH 4D8PB 4JZNA 1BQHG 3B9AA 3IS0X 2EC9U 2FATL 1WZAA 4JFFA 4TLKA 4BK5A 4HS6A 3EAKA 5K39A 2RQEA 1D5RA 4LDLB 3LKRB 7PCYA 2DM2A 1MLBA 5FO9B 3IVKB 5I0VA 1FFPB 1F90L 1FZKA 1UZ8B 1XGTB 3FFDB 2J8HA 5I1HH 1HVXA 3ULSA 3JWDC 1M2OA 5IGXH 1KCVL 4GO8A 3JTTB 4PP2A 2V2TA 5IJKA 1ZLVH 2AEIT 2HJFB 4QHLA 3ZZSA 3IWUA 3VI4F 3P0VL 2VLJB 3SQBA 3UJIL 2BNQD 3I9GL 5HI3C 1RU9H 4PRDB 4OIBA 1ACYL 2ERJB 2WWKO 3QPQC 2AEQL 2F7OA 5E9DD 3VFRB 3H6JA 1DN0B 1D5BB 2FHBA 4XMKH 3SY0B 4R2GC 4HUVB 5AVYB 4GI6A 3E8VA 4GRWH 3RNQB 1RK0A 2WQ8A 4L29B 1E4XI 4FZ8L 4C83A 3BT0A 3DX7A 2R69A 3TBVA 2FWOB 4IRSC 1NGYA 4YSAA 2WCSA 1D5IH 1PL3A 2K1MA 1KJVB 1JS4A 3QSKB 4Z77B 2PLTA 5H8DA 2RB8A 2WQXA 4KVPA 3KXFD 1C9SA 4X9BA 3QJZA 3DC0A 4Q58C 1PZ5B 2AV7A 1FG2A 4P5TB 5FHBL 4FEMA 3F58H 2J72A 5D4QA 3M7OA 4FLHA 3BPLC 4AKPA 3JV6B 1SN0A 2VN5A 4XBPB 1DJWA 3D0VA 5C0BE 3TJEH 3R4DA 2QPEB 3UYPA 1I85C 5E1AB 2B9AA 1I9IH 2X3AA 4ANXA 3DA0A 3QG6A 4M43L 4RA0C 3Q44A 4I9WD 4QD2E 3WXVL 5IHHA 2VR6A 3R0MA 4EIBA 3F6JA 2VC2L 2HN7B 2P4AB 3MRKA 3EJPA 1J9QA 3DUSA 1KGXA 2NW3A 3RVWD 1A0QL 1AY1L 1HCVA 1SN5A 2XWDA 3U0PB 2Y1AA 4WW2F 1ZT7A 2VDNB 3L16A 1HHGB 3QQ9C 1AGEB 3S3CB 3JV4B 3PS6A 3VD9A 3MCYA 5D1XC 3TVMB 3VXUD 5FF6A 2VRAA 1F00I 5HBBA 2CCWA 1CZ8L 3HAEA 3LKQB 4UYPA 3RY6C 2BVEA 2Q2EB 1U8PA 1XIWB 3CSBA 3O81A 4H25A 1JE6A 1KJ3L 1TQVA 1Z9SB 4K5OA 4XHJD 4FXGC 2A77H 3GKZA 3V4UL 1HXYA 1PLBA 3F8UB 4LPTA 3OF6D 4JDEB 3IPFA 3V4VH 4DN3L 3BZ4B 1NCGA 2NXYC 4L1TA 1YJDC 4IEFA 5IQ7H 3D33A 3PWLA 2R9HC 3ROLA 3A6OA 3T2NL 5C0CD 4Y4KD 2ZCHL 2GTQA 2IJ0C 2R4SH 4NKQB 2HX9A 4PWHA 1ZAGA 1KV7A 4D9QD 5EU7E 5AW8B 2AJSH 2CRZA 1YEGL 5G4MA 2CUIA 3MLTB 2R1YA 3CHSA 4ODSH 2O5XH 4LVEA 5CD3A 3CFEB 3FQNB 4JQIH 4PP1C 3ZUCA 4NQEE 2JKLA 5DZLA 1PDKA 4HGKC 1RVFL 5BZXA 1E9PA 1JF6A 1ORQA 2ITDA 4LOUD 4YBHA 4YE4L 3NACL 1KGYE 2VZ3A 4OFVA 4PEEA 4XGZB 5AAPA 3RWGB 3QDGE 5TH2B 2ZNXA 4P3DB 3HN8A 3LZFH 4JHWH 3BISA 1N18A 3C08L 5KSUA 4QRRA 4PRAA 2H45A 5EOCL 3MV8E 1RZIA 2YC1B 1YEDA 2G4GA 1N7ML 3R4RA 2FECL 4LLUA 4PRHA 2COQA 4XNAA 5F7KC 4DP5X 5IOKA 4FJ6A 2WWOA 2NY2B 3PUUA 3ZE2F 1JGVL 2IQ9L 2TRYA 1U2HA 2XCMC 3QUXC 5CO1A 2N56A 4QXTB 1EQWA 3IDGB 3GSVA 4A37A 2LLGA 1NMAL 4XVUC 1FL5B 1UD6A 4Y2DD 2DMBA 4JN1H 4P4KB 3CIQA 2NNCA 1AYRA 4IBSA 3V5HA 4MA7H 5FKPA 3VG0H 3FONA 2J5LC 1YN6A 4S0SD 4NN5C 4JLRA 5EIVA 1F1AA 2GSIA 4YNYA 4FFZL 3KPSA 4UI2A 2ZWSA 3VB9A 3IRCA 4F7CB 3LHPL 3LNFA 5FX3A 1RZGB 2EIEA 3ARRA 4PJ9D 4F8NA 1E65A 4AGPA 2Z92A 1ZS8A 2A9BA 2OKMA 4K7FA 4NERA 4CSTA 5JW4R 4AM0B 1SEBB 2LQRA 3FJTA 1E3FA 5GZOA 4NUJA 4JVPA 3WFCL 3QRLA 4NKMB 4EZMA 3DBSA 5JO5A 5LQBH 5CXPA 3LKSB 1EO7A 5DFAA 3VD7A 1G84A 2Y24A 5CIPB 5D9SA 4JFZH 1S7TB 4PJFA 4ALAH 1DBBL 2QMKA 3TYGL 1NGQH 4MDJB 1YVLA 4JUSA 2B4CH 3EZ8A 4JL1A 3CU7A 3N42B 5C71A 3VFTA 2X2HA 3QUKA 1ERNA 4GO9A 3EH2A 5EU5B 3IAGC 5ESAB 2E46A 5HHMD 3Q1SH 4G3YH 4IBTA 1T83C 1O7DC 1W80A 4WK0B 5EDXA 5EU4A 1BP3B 4MZIA 3MROA 4RRPG 2H2PD 4YZFF 2YPLA 1JCKA 1LO4L 1IGML 5JHLH 1NFIB 4ZG1A 3SDAB 1R3LB 3K6NA 5T5FL 1ASOA 4GSRA 5HHPB 4NJ9L 5DTFB 4PS3A 3L95B 2FBOJ 5E4AA 1NGWB 3DWTA 3NIFF 1TJHH 3BZFB 2QJDA 2P28B 3QXTA 1FSKB 4PJXA 3F6IA 4YHNB 1MEXH 2YRLA 3FT4B 1G6RB 2K7QA 1HAUA 4KKLC 2EJ1A 4XZUB 3VX0A 2Q7AA 3MMEB 5AB9A 4JFVA 4LBEB 4NNYA 3O9WD 2AV1A 5EUKB 1CTNA 3NTCH 2P43B 1H3PL 1N9PA 5E9DA 2YGOA 3BQUC 1WQVT 1D5XA 4G6KH 4NOFA 3OKEA 1FNFA 1NGPH 1FVEA 5SWSD 3APFA 3KWVA 2Z4QB 2XVLA 4AYMC 5CEZL 3VFMB 2Y6SC 5F0LB 2LFEA 5EO0B 3VQLA 4OZFH 5GGTA 2DQDL 3ALWA 1BZ9A 2XX1A 2DIJA 3KXFA 3FOMA 3T5WA 5FA3B 4IMLA 3CC5B 3X12B 1WITA 5DLML 3VRLF 4E2OA 1BD2A 3G9AB 2GBTA 5HDQH 5D7KE 2CKBL 2XV0A 4YO0A 3SDXF 3VQ2C 5TF1L 4F7PB 1PFCA 4PV1C 1JXKA 2CGRH 2GCYB 1NAMA 2IPTL 4F7EB 3KNBB 3B5TA 1OO2A 1QSEB 5E6RB 4MXVE 3NK4A 2DQJL 4ADIA 1CUOA 3I2CH 4PREB 3VI3E 5E08L 3FTGB 3CXDH 4Y9GA 4YMPA 5DU7A 5EUOF 1NCUA 4NAMA 1C8PA 2BIHA 4FQXC 2AXGA 2X4QA 1HJCA 2NY0B 4AXWA 1TEFA 3KEHA 4UTCA 2WNWA 3VXUA 1LLAA 2EDWA 4Y19E 4QHNB 3VXRD 1P6FA 5C0GA 4AKQA 4JFHD 3TVMD 3BUQA 1I3VA 2XQYG 2XWEA 4FHJA 3C5SA 4IU3A 1XIWD 1N6UA 2CDGB 3BMVA 3QR1A 1KJ2L 3SE6A 4C55A 3OF6A 1JNNH 1XF5A 5I17A 1EPFA 1PLGL 2FWSA 2JKNA 5E03A 3FT1A 3NABL 5J13C 4J39A 3DRQB 4KGJA 4PJGB 3DO4A 4RIRB 5KG9A 4Y4KA 4NZUL 4FFWC 5DD0L 3UPRA 3PNRB 4UZGA 1S7VB 2I25N 3MNMA 1XCQB 2FLMA 2YEZA 4KFZC 4WFED 3N43F 2F7PA 4NP9A 5HYSB 1QASA 3ULVF 3GS7A 3TO4D 2WTRB 3BZ5A 2DJMA 3CDCA 5DJCA 2GVYA 4MJIA 2HVJB 4HCRH 5INCA 2DQEL 4LQFL 2QPUA 2BJML 4U1JA 2FH8A 3U2JA 1MQKL 4PJEA 3CFBA 4PG9A 4HC1L 1MH5B 2VZOA 4FQIH 4NWTL 4CADB 3VTTA 5LDUA 2JK5A 2Y25A 3Q8CA 4MKMA 4KI5D 4R7VA 4Z7NE 2XV6B 4FQHB 4P48A 3ZJAA 5D1XD 1XR8A 2IFFL 1EZLA 4UZSA 1V3LA 2XN0A 1A14L 4Y1AE 5LXGL 4QRAA 2O93L 1F4HA 4AEIH 2CK0H 4OZHF 3UBGA 2WVVB 4KY1H 4K3DH 2ICEA 3MLSL 4AX3A 2NY2D 3VWKD 3RURA 2NXYD 4OM1L 2HLEB 1DBJL 2X4NB 1SFHA 3CZEA 5JPMB 1U91B 1HINH 3S36L 4YDLB 2F53A 1SF3A 3V6FB 4N4YB 1VERA 1QLFA 4KNTA 1M7UA 1T66D 1HT6A 3KWWB 2B15A 1H3UA 4HDIB 3C2SA 1WE5A 3AVEA 4NRZB 3U4KA 1YAIA 4LSRL 4CGTA 3MLRL 2GK0B 2DQHH 2C3XA 3BUPA 3HS8A 3MGTB 5AVRB 5LB1A 5DQ9B 9CGTA 5BVJB 3EJQA 3IJ7A 3KHQA 3TURA 4BBWA 4S1SH 3MRLA 1JOIA 3O4OC 2VM4A 3VXOB 2IMNA 4OLXL 3BUYB 3VXTB 4Z7WE 2AANA 3L5XL 2V7HB 5DRXB 5IHUL 3ULUL 1IGJA 2VZSA 4HHGA 5JQ6L 4B9YA 1ZANL 4OZFG 3U7YL 3DROA 1R17A 1QYGH 1GPOH 1OTSC 1UD2A 2VQTA 1FFNA 3WUWB 5JNYB 1AP2B 4P2AA 1T6VN 5D7JC 4U1IA 2ZP0T 3AXHA 1EBAA 2XV3A 1S5IH 1XGZA 5C70A 3JTBA 4F15C 3WS6A 3Q8AA 4PJ5E 3RX5A 3KCPB 3O4LB 5AD0A 2YD0A 2IDSA 4MB4A 4LRNH 4POZD 4XCFL 5DHMC 2A6DB 2QKSA 1LD9A 4EKJA 1JHLH 4M62L 4ZOBA 3KLHC 1NJ9B 2EE2A 3OHXA 4M7ZC 4E9WA 4GW5B 2YMOA 3QIBB 3QJXA 3O2DA 5CZVL 1XBRA 1TQSA 2W94A 4S1DD 1NFDB 4K94H 1YNLH 1NC2D 3SDAD 4HJ1A 1GZPB 2NR6D 3KZ8A 1S3KL 2BCKB 4JY4B 2I26N 5FO9A 3RAJL 3IVKA 1FFPA 4YWGH 2LE9A 1UZ8A 2Y1ZA 1XGTA 4LLYB 4OFYD 1XH2A 4R7DB 1MCQA 4OFDA 2AK1L 1PJWA 4ODUB 1DLHB 3BWZA 1LE9B 1BGXL 3LDBB 5KSVA 3JTTA 1BPLB 5E24E 5DGRA 4LEBA 3O0RL 2HJFA 4ZO9A 3CMOL 1NL0L 3WG7B 4F92B 4NC0B 3WLBB 1G7JB 5E6IC 2V8LA 4PRDA 4LSVH 4MHHG 1ESOA 2MFNA 5D4IA 3VFRA 1A4AA 5SWSA 2W81C 4MNQB 5GRXG 1DN0A 4RNZA 2R27A 3SY0A 4K3EH 3U25A 1QLEH 3ECUA 5DMKB 3RNQA 4FI8A 1TR7A 3NJIA 4L29A 1J8KA 1TZOA 3R18A 2FWOA 1ZGLP 3HC3L 3QC5X 5IMOB 1Y6NR 1MFBL 4LHQB 4X0KB 3VO0A 2ZWKA 4P2OB 4KZ0A 4Q97A 2Z35A 4HF5H 4Z77A 1XFPA 3PF2A 5HYJD 3DECA 1PZ5A 2VXUL 4P5TA 1ICTA 5BRPA 4RBPH 2ZCKL 3F85A 3JV6A 4WEUD 4WUUE 4XBPA 2BHZA 5F7UA 4P0DA 4ZPTB 2YN5A 3RL1B 2UYLB 4S1QH 2APVA 2ZCLL 4H8WH 5E1AA 3RY5A 1Q94B 3ZTNH 3D50A 4X7EC 4EI5C 3KJ6L 3KPRD 4H8VA 4JO2H 4Y5YB 4NQUA 2HN7A 5B1BB 2A99A 4LEEA 5DGQA 4KKLD 4FA7B 3U0PA 2DI9A 3EYFB 5BW7A 1HHGA 4L1HA 2R69L 1E67A 1A6TB 1AFVL 1OKEA 2E47A 3FCBA 2NY0D 3F62A 1B9KA 3VXRA 2VLRD 3TVMA 2NX5E 5A6IA 3WFDH 5HYEA 1RD6A 3BP7B 6FABH 3BQUD 3CFNA 1NSNH 3LKQA 1VCBC 5DMGD 4NZJA 1XIWA 4APXB 5FM8A 4X9GA 3BMWA 1BA9A 1O9VA 2JB5H 5KBDA 3NCMA 1T1WB 4JDEA 3PIQB 4FDWA 2C9VA 4NIKB 4JFUA 2FZ3B 1EVTC 3BZ4A 4GI9A 2BXYA 4KH2A 2M2DA 1K85A 3VFVA 4ZYBA 4BDVB 3LZQA 3FUDA 2A9CA 1FYTD 1UT1A 4ZMLA 3MLTA 1S7QB 3C5XA 4X7TB 4YH6A 2NZ1A 1NEZG 4QDGA 3FFCE 3CFEA 1MDAA 1XCTB 2OQJB 4ZFFB 1PAZA 1PD6A 3BAEH 1G9NH 3LS5H 1D6EB 3RIKA 1MIML 2PWFA 3OB0K 4F91B 2IANE 4IS6A 2MKWA 4MAYD 4XGZA 5C0BB 1B4JH 5TH2A 3GM8A 4P3DA 1PG7L 3MYZA 3OL2A 5E6SB 3T4AB 3BZEB 2H0JA 3AXIA 4K9EL 3SO3C 2APWA 3MRHA 5IV2A 2YC1A 3FOLA 3AY2A 3GSUB 2DM3A 2C3HA 5I19L 4RGNE 4FEIA 5G4NA 2OR7A 5GIRA 3V10A 2FJHB 1S7UA 3VWKA 5CP3H 1RIHL 3MRQB 4NKOA 1L9QA 1FL5A 1CT8B 4P4KA 3OAZK 4HPYH 5I6XB 3MFGB 3QYMA 3WO3B 3NPSB 1YC8A 3SGKA 3ZE0E 1EJOL 1MNUL 4BK8A 4MJ4A 1DCEA 3P4NB 4JDTH 1JZGA 4XPTL 2EVJA 4F7CA 2O72A 2EH7H 4KFMA 1BM3L 3NZUA 4XPGL 2P5WE 1X7QB 2VDRB 2WGXA 3W56A 1MJ8H 1OARH 3ARYA 4AM0A 4KDVA 1SEBA 2R4RH 3CXHJ 2FB4L 4OJFL 1H15B 4DEPC 5I0ZA 5JW4M 1JXGA 1SDDB 3RGVB 3TJHD 1FL3B 4NQEB 2WOBA 4ELMF 2BDNL 3FYIB 4L4JA 4TULH 5DT1H 1QOKA 2QGCA 2B5IB 5IOPB 4UZUA 5CIPA 5F1NB 1J0YA 4ECNA 1HE8A 4F2ME 3HRZA 4ZS7H 3AY4A 3QDGB 4QNPF 4MDJA 3EJCA 4KKBD 3WKYA 4OD3L 3VW3H 1F56A 3MLVH 4LFHD 2C8NA 5D2LE 1XH3B 2H0PA 3S98A 1HYSC 3E3QE 1NZRA 5AZEH 5EU5A 1GTFA 1OQOA 2HRPH 3IDNA 3MV8B 2AMGA 4PJDE 5ESAA 4Y4FD 3HFML 1DQJB 4DESA 1CC3A 3O4LD 1YPZE 4J3OC 4XMUA 3WY1A 1INQB 2CXGA 3I02B 4WSJA 5DD6A 2LLNA 3B43A 1F6LL 2OMZB 1CB4A 1NFIA 3QIBD 3OBAA 1NC2A 3SDAA 3V0VB 5IMLB 3SN6N 4C57C 2NR6A 4Y16C 5CKGA 5AW9B 5DTFA 1KGWA 1S7WB 3L95A 3NJGA 4P05A 4OTXL 4OFKA 2LW3A 3ARSA 1NGWA 5JW5A 3S88H 3BZFA 5DUML 4U3CA 4YHNA 4FA8A 4LSSL 2IAMC 1G6RA 2JCCE 3FT4A 4AUUA 5M94B 4Z8FL 5JOPD 4KAQH 2X70B 1A4BA 3FQ2A 4XZUA 2FBRA 4D7BA 1R5IB 4WIQA 1AI1H 3RZWA 2X4UB 2Z91B 4LBEA 4PR5B 4ZO7A 1OB0A 5JUEL 4LOEA 5EUKA 3C5ZB 2IBZX 3RG1C 1UD4A 4YUEL 3SLUA 2WSPA 1INDL 4MNQD 4XNZC 1JGDB 5BV7C 2Z4QA 4YDMA 3OKMB 1T22B 2HTLD 2XWXA 5DHDA 3VFMA 5E4IA 2A4CA 1Q72H 1IQDB 5AYQA 3O3DB 5CZXD 5EO0A 1FJ1B 2EH8H 1DLFL 2HJKB 4S0TD 5BZWB 4TM9A 5HYJA 5FA3A 3BGMB 3N6YA 5I71B 1NC4B 3CC5A 4NC1C 1FBIL 3AB0C 4E9TA 2XIIA 3DX1A 3I50H 1SXCA 3GBML 2XZZA 5CGTA 2J71A 5FGBA 3SPCA 1YUKB 4F7PA 2AVFA 2GCYA 1A6PA 1GA2A 4L1BA 4F7EA 1FFQA 3KNBA 4JGJA 4X9YA 3N9GH 3MRPB 2J6EH 3LN9A 4WWPA 2Z0UA 2OFQA 1K8IB 5I6NA 1CI3M 4MA8H 4PREA 4I3GA 3FTGA 2FWUA 2V9QA 4PG2C 5LGJB 5I8CB 1KCRL 3B1UA 4S1RH 3CDYA 2BVUA 4WSKA 2VLRA 1OTUD 5GGTL 3NGBC 4QHNA 2Y4SA 3SGEI 2ORBL 2PWHA 2W9DH 4L3CB 3J2PA 2LU5A 1RP8A 2CA3A 3GS0A 5DO8A 5HTSA 4MJHA 1PEWA 2CDGA 2RACA 4I3RH 3THMH 4G7VL 1JZ4A 5DJDA 1NAML 3WIHA 1TUPA 4TMPA 2QADB 4E9RA 3N44F 5KBKA 2D3NA 1NH6A 3DRQA 1D6VL 4F1SA 1KTKE 4RIRA 3BW9B 5EU3B 3UJTH 3FH7A 5IK3B 3KJ4B 2APBA 3RVUC 3RWFB 3VNYA 4X80H 4HXAL 1YEFL 4XMWA 5C2BH 1S7VA 5EWIL 4YS4A 1XCQA 2CO2A 2NYKA 3HBQA 1LMKA 3BCFA 5HYSA 5JIDA 3MLXL 3VXPB 4IIQB 2WTRA 4N2KA 5ESQA 4R26L 4DSYA 4D7PA 4HG4J 2HVJA 3MU3A 1QWNA 5L2JB 1X44A 3QAQA 3Q2NA 4N8UA 3G08B 4KBPA 4KI1A 5KOMC 2VW6A 2EUXA 4MAYA 3MTXA 5FW8A 4BELD 1QBBA 5LBVA 1JYNA 5TE4H 4B97A 4O51B 1U3ZA 2VGLM 2XIBA 2GT9A 3VRIB 2YD7A 4ENEC 3MLZH 4HKZB 4FQHA 1WFJA 4NQDD 1IL1B 3S34H 2H26B 4FOMA 4JPIB 4RZCA 3VI3B 2WJ5A 3ZYZA 5HHQB 4JVUA 3DI3B 3IGFA 5K69A 2J1XA 3BUTA 2WVVA 3T8MA 2C9RA 4DQOL 2FX7H 2OV0A 4RX4D 4Y19B 4EUPB 2ENSA 4KZDL 2VDPH 1W72A 1WAEA 4OAWA 2X4NA 3KDMB 3ZLQC 1U91A 1E4XH 2Y7NA 4HV8B 2N0MA 3V6FA 5MENE 1B4LA 1JYWA 4B27A 5AL0A 1JHKL 4JPWL 1FH2A 3GIZL 1U8JA 4HIJB 3N41F 2C9QA 3O6KH 4HDIA 4OUOA 5I5MA 4DGUA 1KEGH 2GK0A 3BH9B 3BPOC 4JX0A 1FNEA 3GI9H 5DQ9A 5F9OH 1GHFH 2MOVA 5BVJA 4CAGA 1D3CA 1X5YA 4H44C 4HK3J 1AXTL 4M6MH 4OM0L 2XC8A 4IGBB 4GKOA 3VXOA 4DAGL 2VRQA 3VXTA 1R46A 1ZPLA 4GMTH 1FG9C 5DRXA 5IQLA 2NUTA 1MNNA 4FXTA 5KBMA 4A6YA 4O9HL 2WJ7A 4O02B 3G6DH 5EORL 3RGVD 1RUPH 3C60C 4KQ4H 3FSWA 5FHAL 5ABDE 2YAMA 5E1IA 3WUWA 3B2VL 1AP2A 2XRAL 1MRFH 2FIRT 4JBSA 3S35X 4YHLL 4P9MH 4HG4K 1KB5H 3RJDA 4XAWH 3UAJD 1NKOA 3CVIH 4Y2NA 2MRYA 3N85L 5JMRA 4Z7NB 2J7LA 3U1SL 3BAWA 2HLFD 1T5KA 1UWGH 3KD4A 1FDLL 2BSTB 4P3CL 3O4LA 1LO2L 1NAKH 3FF8A 3GI8L 4XCNB 2XY1A 2ZOTA 2A6DA 5AB2A 1OY3B 2UUDH 1WDAA 4LLDB 1NJ9A 4FNLH 1QNZH 2BY2A 3TFKC 1GY1A 3LEVH 3ARXA 4E41E 4GW5A 1A6UL 3QIBA 1PEZA 1A7OH 2WUCL 2GB2A 1WSST 1LHZA 1NFDA 2AJYH 1UD5A 4HU8A 1E43A 3K91A 5GJSL 4UINL 3ZQXA 3QFDB 2VDMB 5D1ZB 4EOWL 2QQNH 4LLYA 4R7DA 2HFGH 3Q05A 4U1KB 2IDFA 1U8OB 2B1HH 1DLHA 4ODUA 1G7MB 1KN4L 1LE9A 1N0XH 4NWUL 2E6PA 2Z4TA 2H2SD 1HWHB 1ES0B 2HA1A 32C2B 4KROD 3VQ1C 4W9IC 1Z7JA 1Y07A 1F6FB 4OLZH 3WLBA 4Z7WB 1G7JA 4Y4HC 5I1KH 3COOA 3ZMRA 3C5ZD 4PWEA 3O2DL 4MNQA 3OHMB 3B9DA 4MWFB 2OYMA 2ZUWA 1GZHC 5T3XL 3R7QA 1A2YB 4B9FA 4J3OD 4O00A 2PYEE 4V11A 4GG6E 1WS7A 5EN2A 3U4BH 1HWWA 5IMOA 1CLZL 5AVXB 4X0KA 4HIQA 4P2OA 3RUGB 4XXWA 5A3ID 1G87A 4RRPM 4H88H 4PJ5B 5B38G 3B83A 1ZEAH 4JK0D 4K0OA 4HK3N 2ICES 3PWVB 2H4EA 3NZHH 2EDFA 4M6NL 4U2ZA 1GLDF 3QXVA 4MA1B 1HC1A 1A4KB 4HSAC 4ZPTA 3D6GA 3RL1A 5JZ7C 3CV5A 1J48A 2UYLA 3M17B 3KPQA 4KX7A 4NLHA 5DD3H 1Z3RA 4ZFZB 1PKQE 5T3ZE 5F3FA 4JZOA 4Y5YA 4FXKB 4RWHA 3LRKA 5DHYA 4YDVB 2GJZB 3BYYA 5I1AB 3EYFA 3FB7B 3CLEH 1RUMH 5CD5D 1A6TA 4MB1A 2WBJC 4OCLC 5DEGB 1S9XA 1DE4B 4OLEA 4YHOL 3S37H 2PCXA 3QWOB 4P23C 1O7DE 3RIAK 2R1WB 3BP7A 3QEGL 4JGUA 3QA3B 1OZTG 1J1OH 1XR9B 2ALWA 2L7JA 4EVNB 4APXA 5DUPL 4HOXA 4XP9H 2XVBA 1P84K 1A8ZA 1T1WA 4NKIL 3PIQA 4XH2B 3RWEB 1NCAL 3TS8A 1SXAA 3TO2B 1G7HA 2FZ3A 3V4PB 1DVXA 2DQUL 3SBWC 2RCSL 2J8UF 1SF5A 2D7TL 1IB5A 4BDVA 4DERA 4YXKL 4LIQH 2IWEA 5IBUG 5I66A 2P46B 4G8FA 2VH5L 3P2BA 4AMXA 3QIWD 3VB8A 3EFDH 2NT1A 1RIUL 5FCUH 1VA9A 1IC5L 2F15A 4CKVX 3MBEB 2JKJA 1S7QA 3LH2L 4GMSH 2VWEC 2P8PB 4LKXB 1NMBH 2W9LA 1Z9LA 1XCTA 2OQJA 2X2UA 4JKKA 5D70H 2DQTL 2GQHA 3LQAL 3SE4A 1D6EA 3X2QB 5FW6A 1OEZW 2Q8AH 3H2PA 4JO5A 5B4MC 2LABA 1P6AB 2WOYA 4WUUB 4ALAC 4QLRA 1MCDA 4I87A 4NQDA 2F5AL 3MXWH 3ZHKA 3IETB 3KYNB 4X6DF 4Z7OE 2WXRA 2B4CC 3BZEA 4FYRA 3TONA 1L7TL 3B7YA 4JHUA 3P3UA 1AQDB 3DSFH 4N2DA 1HXMB 1JRHH 3GSUA 1WFMA 4EDXA 4N5UA 3UCRA 4KNUA 2ZSWB 1TLMA 2CAKA 3O2WH 4RX4A 1G7PB 5KS9E 2FJHA 1BFVL 4GXUN 2W0FB 1HHIA 3MRQA 5DC4B 3ULVH 1PY0A 5AOZA 1MKFA 1CT8A 1YECL 2VXQL 3GB7B 3D9AL 3RVUD 4DVRL 3WY4A 3RIFF 4ZMZA 4E9XA 2P8LB 4POUB 2ZQKA 3W9EB 4UQ2B 1LO3L 2YARA 2YEVB 4AY0A 1ZKAA 4XB8A 2WB1A 3BP6A 4MTMA 4AZ8A 1H8LA 5I9QC 5E2VL 1W16A 2VXSL 3P4NA 1YEEH 3TIDB 3Q2VA 1XF2B 2RTTA 3C12A 4GT0A 4OGAC 3U4EB 3M1BA 3LPFA 1E8WA 3LNGA 4TQEH 4FD0A 5AAMC 4JPQA 1KTBA 5EN3A 4C56D 3VD3A 1OK0A 1H15A 5JW3L 1VFMA 1C16B 3FFCB 1SDDA 3RGVA 4LASH 1FL3A 4X83A 1GYAA 1UCBL 4OCMC 3PYCA 3U9PH 1DJGA 5CINH 1A66A 5IOPA 2IANB 3IGLA 1K5WA 1ZTMA 4PS4H 1VPOL 3AG4B 3FU8A 3DJ9A 3MZGB 5F1NA 3UAJA 2CXKA 3QDGA 1AIFB 3NPZB 4XNYL 3L4ZA 2GIMA 1XH3A 3IDYB 4L8DB 4XNXL 2AJ3B 2QQQA 3ALPA 3GSNH 3MV8A 3OR6B 3QULB 3R1GH 2AJXL 1DQJA 4KZCA 1GC1C 4X7DC 4FQQB 2G9HB 3LXAA 4KNQA 1INQA 3I02A 4RGNB 4R4NC 3U7AA 1NLDL 1P2CB 2VT0A 3OKLB 4NSKB 4GXUM 4XE0A 4WO0A 2VR8A 5B3JE 5B7MA 2Z1KA 2WXGA 5A2LH 4UDTB 4EJ1C 2BCMA 1S7WA 4Q6IA 2QVMA 3D4CA 2ZUSA 1A9EA 2OMXB 3MRMB 1T1YB 1UH2A 3ARGB 1B6DA 1F11B 1IM9D 3ZE0B 3FXIC 3TPKA 4XO9A 3EO1B 3FQ1A 1SLWA 3L3HB 2J1WA 4YVNA 1HH9B 4G5AA 4YXHL 5JW4Q 3FTXA 1R5IA 3MCG1 1G6VK 2X4UA 4IOFD 4LSPL 2P5WB 4PR5A 1N67A 3C5ZA 4IK6A 4FFYA 4KRPB 4K71C 4WWOA 5I2IB 1E5YA 5IESL 2AJUL 2BRQA 3NJHA 3KL3A 1NWOA 1EAOA 1MI5E 2QV4A 3BJ91 4N2LA 3L4VA 1ACCA 1YEKL 4QTIH 3UOAB 1JGDA 4FLQA 4JG9A 5C7ZA 3CD4A 3OKMA 1T22A 4UTAL 3KPPB 1IZKA 4XN5A 4F2MB 2Q5BA 1OD7A 4E9QA 1FJ1A 3TFKD 5E8PB 1X9RA 2HJKA 5BZWA 2IOMA 4QKTA 5D2LB 3RZCB 3BGMA 2BRRL 5D6CA 5IHLB 3CG8A 1G6RL 3FH5A 4NFBA 4PJDB 4GW1B 2Y2WA 4XODA 2EEXA 3O6ML 4IRJB 5EEVA 1YPZB 3DSNB 1KGIA 5E8DH 4NN7B 4QXUH 1D7BA 2R29H 4QRUB 1BQHA 4YDKH 4Z3FA 1E28B 2D9CA 3O45A 4CN1A 3MRPA 3FCTB 5EHFA 1TJGL 1DHKA 1P69B 4EAEA 2WO4A 5J11B 1F1GA 3S3SA 1M71B 3WTUA 3HHMA 1FPTL 4L5FH 4F8TA 2FEEL 2UV3A 4KPHH 4ELKB 5I8CA 5LGJA 4IBLT 1F58H 2E9BA 5KN5B 3BPNB 4N6RB 1A7PH 5D7SH 5JDSB 1GLBF 1U3HC 4N5ED 2CDFA 2ADFL 2ARJB 3T0EC 2JCCB 2NPLX 5DJAB 2Y07H 1AHWB 4L3CA 1G9ML 3CSTA 4FABL 1OAXL 1XDTT 4Y9EA 2VABA 4DZ8B 2CIKA 4YN3A 3TT3L 4AJ0A 2HKAA 1G4MA 4M5YH 3NCEB 5CGMA 1G0YR 2PXYD 2WHVA 3Q2LA 4WEBH 3UJJL 9PCYA 2DJUA 1FFTB 5IK3A 5ICXA 3RWFA 3GRBA 1HNGA 4J4PC 3VXSD 2FDBP 5BCAA 2NDFA 3CHOA 1A6WL 4J27A 4K07A 1KTJA 4F8OA 3VXPA 4IIQA 3UPCA 1YY8B 4LBAA 4M5ZL 1OXYA 3AQXA 4Z1PA 4PBDA 3CTTA 3MBED 4KX8A 1AMXA 3ZRFC 1W91A 1E30A 4CU6A 2X4TB 5JPNA 2HVKB 1SYVB 3IFPB 4QPBA 3G08A 1VFAB 4YXLH 1A3QA 3IJ8A 2Q1EA 1E3ZA 3P4LA 4BQ6A 1WBZA 3AFLA 1SXNA 1T21B 1NCCH 4FYSA 1A7NH 3B2PA 3WIHL 1LEGB 3EYSL 4O51A 4WUUD 2WBJD 1CDHA 1RJZB 5DQJB 3IU3A 4HKZA 4YSCA 1P5UB 3RP1A 1IL1A 3II1A 2H26A 3G5ZB 1EEZA 3VMOA 1N6QH 3ZDYE 4JPIA 1JFHA 2MCMA 3VI3A 3OLDA 1CK0H 1MFEH 2CLZA 4G8GD 2AQQA 5HHQA 2Q8BL 2QPFA 3MDJA 1DZ0A 5KYWB 3VU2A 2BHUA 1E8ZA 1FO0A 2V2XB 5FAAA 5GS2D 5IVXB 1OWRM 5J7CC 4C54A 4GO6B 4XC3H 3KDMA 1N5YL 3KPTA 5AW7B 1MCWW 3CBJB 4HV8A 3SE3A 2JVUA 5ETUB 1RUKL 1AQKH 1Y0LB 1JXDA 4FMKA 3MCKB 2C4XA 4HIJA 1H5BC 4XNBA 4PJFF 4ZJ9A 1UM5H 4NZDA 4I1RA 1LMIA 2EDBA 3IS1X 5F8RC 3BH9A 3EADA 3WTVA 1ZE3H 1YEJH 2ID5A 1O7SA 3L3OC 4PMFA 4IOIB 1T4KB 4AC2A 4HWZB 4OGXL 3U4AA 2RA1A 1NEZB 4YFLI 1XL6A 1N59B 1MPAL 1DQIA 1I8IB 1E42A 5BUPA 6PAZA 1NA8A 3X3GL 1P1VA 3BUBA 2WTOA 4O02A 3U82B 5GS1C 1GS7A 1PD1A 1W72L 1QFOA 2A9MH 3GHEL 3UAAA 1KIRB 2BHYA 2J88L 3FN3A 3GJFH 3T77B 5KVFL 3FT3A 5HD8C 5FYJE 4TVPE 2FATH 1ZLUK 4R2GB 3AUVA 1AKPA 4KK5C 3SODB 2WNKA 2GSMB 5FYKH 1YSOA 4FN0A 3AMLA 4TPRL 1WWCA 4ZW7A 4PJXF 2BSTA 2X38A 3PQYB 2Z7ZA 2ZUUA 1F90H 2MH4A 5E8NB 1S9VB 4HS3B 5AOMA 4RDQG 3KM2A 4LLDA 3A23A 1JWSB 4RGND 1RK1B 4QTFA 1KCVH 2NXZB 3WNPA 4H8WC 4N0RA 4JO4L 4A6YL 1OW0C 3P0VH 4DK5A 1ECYA 3UJIH 4LLMA 3FQUB 2NY5L 3I9GH 2Y1YA 5MENB 1ACYH 2K6ZA 4PS7A 4FFVC 4K7PL 4OI8A 1IM9A 4IU2B 5D1ZA 1EDQA 3GRWA 4Y1SA 1LXMA 3ARGD 1T89C 1WA1X 1A7RL 2GAZB 1G7MA 4FZ8H 3T3PB 4JGNA 4AH2A 4BFJA 5J6SA 3O0LA 2AI0L 1ES0A 32C2A 4R0LB 3LPPA 4MD5B 4UUJB 1OE2A 5BZDB 1E27B 1GRWA 3I9PA 1YZZA 4AQOA 5HXMA 4Z7WA 4IK7A 2P5WD 1Z9MA 3WTYA 4IBVA 4GRLC 2QTEA 5FHBH 4KRPD 4FXGB 1ZLWK 5IJCC 2HCZX 4CMMB 3IU4L 1BJ8A 4MWFA 1KXVC 4Q9BA 3RDTC 2W0PA 4P07A 4LGSB 1I53A 1A2YA 5AKSA 4L8SB 4M43H 3LCYA 4E5XB 3LRGA 1VHPA 2VC2H 4K15A 2KPWA 3MRRB 2IOIA 3QIUB 1XSIA 3RUGA 3ZO0A 1DDTA 4QO1B 1SOKA 4LLQA 1A0QH 1AY1H 3PDDA 4PJ5A 3RZCD 4H1LH 4WSGA 1G9NC 4JN2B 3WELA 3PWVA 4KQ3L 2K4AA 1B0WA 4GXVH 5TK4A 3WLWC 3MUGB 1M3JA 4IRJD 4RRPA 3OGOE 2UWEE 1CZ8H 3M17A 4B9CA 4LB8A 4FJYA 1UHVA 4E41B 2JQMA 4ZRGA 5CKAA 3B2XA 2EINB 3FBKA 3I3DA 4FXKA 3WFZA 2F68X 1BEXA 3AABA 3V4UH 1J7VR 4A7TA 4HUMB 4V2CB 3EOTL 3ESPA 3Q7JA 3GSQB 3W57A 4DN3H 3SPGA 3NJFA 3FB7A 2ZUTA 1KYOK 1T03L 5LDSA 3U0TA 5DEGA 1DE4A 2ZCHH 3QWOA 2HZHA 4LCIL 5C0FA 2HMIC 4HK0B 1WD8A 4XVJL 5DD5H 1F3JA 3TA4D 3QUXB 3MNZB 1XR9A 1YEGH 4EVNA 1KBPA 5CBEB 1AZUA 1J18A 1ZK5A 3KL0A 3P2DA 3JUZA 4PJEF 4Y2LA 2GU1A 5E00B 4JZJA 4GYBA 2PXYA 4XH2A 3H3BC 3RWEA 1RVFH 2NY3B 3L9RB 4HH8A 1X5GA 4YE4H 3V4PA 5F3HB 3ZHLA 3NACH 3NJNA 4BHUA 3X13B 1FNLA 1BHGA 2EDDA 2PYEB 4Z3TA 4GG6B 3C08H 4DETA 3KL5A 3MBEA 1BAWA 4P04A 5EOCH 4GKZB 3WJJC 4LKXA 2ZYHA 1E50A 3CQFA 4U6XB 1MCLA 1DVUA 4PLNC 1L9SA 4RISL 1JGVH 2IQ9H 4R90L 1UKQA 2JJUA 1X5HA 3RTQC 1V54B 2A83B 2QHLA 4WUUA 2YGNA 4W81A 1NMAH 3BDXA 4ZFOA 5E2WL 3IETA 3KYNA 1I1RA 2GPRA 3ZL1A 1PKQB 2EDOA 1UCTA 4U3HA 3DI2B 4G8GA 3TBYB 4F20A 3G6JE 1AQDA 5D93B 1HXMA 3D06A 3GTTA 3V9FA 3HMXA 3DGGB 2ZSWA 4LXFA 4L23A 1G7PA 4FFZH 3S48A 5KVDE 4NENB 2NOYA 2XQYA 3LHPH 2Z7WA 1ITCA 3WNOA 3OLIA 3MTRA 2QPDB 2EQDA 2P8LA 1PS3A 2RBLA 2ICWJ 4TRPL 3S5ZA 3W9EA 3QEHB 3WFCH 4B3EA 4X4ME 3TUFB 4U1NB 2ATKB 3QJHB 3LPGA 4QGTA 2R8SL 4W1TA 5IVZB 4JM2D 4NBZB 4OSUL 4K73A 1WC7B 1XF2A 3GXDA 2RMNA 2FQFA 3U4EA 3BD4A 4PB0H 3T1FB 3WNIA 1T1XB 2DYPB 2B20A 2KLRA 3C8DA 1JFQL 5I1IL 3GMMA 4KVCL 5LN8A 4LL9A 2XNAB 4I89A 1U95B 1M1XB 1C16A 1N19A 1OGPA 4L1LA 5C0CA 2N59A 3HI1A 1RJCA 4PTUB 1N2RB 4U1SB 2AITA 3R8BB 2F9BT 4E36A 2IANA 3OSKA 5EIIB 4H1LG 3ZX1A 1LDPL 1OOWA 3QDJD 3P4OB 1LO4H 1IGMH 1AIFA 4GI8A 2H1PH 1DUYB 1G5AA 2X3BA 3K0YA 5T5FH 3RU8L 4ELDA 4Z7OB 2RD0A 4NJ9H 4L8DA 5DO2C 1PIGA 3QNFA 2AJ3A 3OR6A 3QULA 4R83A 3PQYD 4HUXA 2VQUA 3P3TA 3OZ9L 3ZL2A 3FB8B 3K6OA 4XO3A 2RIKA 3ARDC 1IBGL 2FX8L 4PCTA 3HIZA 2Z1PA 4CDGC 5KS9B 3PG2A 1P2CA 3OKLA 4NSKA 4PW9A 1WS8A 4M7JL 1WT5A 3M88A 3EG9B 3K2IA 2YMXL 5L88L 4NPJA 4GRMB 3QRFM 4B0MM 2XWTB 1H3PH 5I0WA 3CUPB 5MEND 4P4RB 2OMXA 2Z64C 1T1YA 3ARGA 1DBAL 4L8BA 4U6HB 3S97C 5K33A 1I1YB 3OJ2C 1X6NA 3QFGA 1YUHB 3DTXB 3ZKXC 5CEZH 1RZKH 3HW7A 3L3HA 3QISA 5D7IE 5BUAA 1HH9A 4WU7A 3C6SB 3NFPB 4JFXA 4MDRA 2DQDH 2VXVL 2IC2A 4KO9A 4YSSA 2HG5B 2AXWA 1R3JA 2P5WA 3TP4A 3BIBX 4ODBD 5AAWA 4OCRL 5DLMH 3WKML 3DTUB 5TF1H 3U6RB 1OM9A 3MA7B 3B8YA 2HUHA 2IPTH 5AW0B 5J13B 2EUZA 5MHSE 2R2EB 2WKGA 1A3LH 2G5BB 3DX2A 3KPPA 4UAOC 4WNSA 4F2MA 2DQJH 2XI9A 3JV5A 1EDYA 3QUMB 4YBQD 1F02I 4ODXA 5E8PA 4PV8B 4N8VG 3SKMB 3DOIA 5D2LA 2GI0A 3RZCA 1JHTB 2ENPA 3QIUD 1WRFA 2XLLA 2GY7B 4HAKA 3UTSD 3SBPA 4PJDA 2G0KA 4GW1A 3W82A 1RUQL 3EW3B 3GSRA 4QYOB 4IRJA 1YPZA 3DSNA 5DRZB 1QI5A 4QRUA 5F0PB 2EDXA 3P0YL 1E28A 4RA3A 4FFVD 4FFYL 4GAYB 4YHZL 2XA8L 5FW7A 4E41D 4H5SB 4MAZA 4YGAB 3NUKA 1KJ2H 1HEJC 2J3SA 2ZG3A 4G6JL 3C6LC 1OOAA 4KO5A 2BVOB 4ELKA 1DQDL 2WZ5A 2XX0A 3NK3A 3T8VA 3U79A 3LPOA 5KN5A 4BSJA 4N6RA 4DKTA 4NZUH 5JDSA 5C07E 4F9LC 2GHZA 2NLJB 2DBLL 3L6FB 2P1YA 2ARJA 2V6HA 4UNTA 1AHWA 4QKXB 3BYTA 3CFQA 4DZ8A 1IKNC 2G5RA 4U7SA 2WAHA 4LQFH 5F6IC 5KANI 5D1QE 4XOAA 5FOJA 2KH2B 2BJMH 4KI5F 3HE7C 3UTTE 3B9KC 4JO1L 1MI5B 3QNXB 4NM4H 5D4JA 4OZGB 4DKEL 3HE6C 2VUYA 3S3BB 3WLWD 5LLIC 2ESVB 2IBBA 2IWFA 4TNGA 2CO3A 2L8AA 1YY8A 2IFFH 3WN5C 3FHEA 3RY4A 4AYSA 5L8LB 4XBEL 4JY5L 4POYA 2IEPA 3LPWA 1A14H 3O4OB 1PKOA 5B1AB 2X4TA 5TE7L 2HVKA 4IBUA 4NN6B 3H9HA 4NZRL 1VFAA 3MLSH 3L17A 2HWZH 5I1DB 2QSCL 1T21A 4H13C 4L9DA 3OKDB 4P99A 1C8QA 4A2HA 4B5EA 4TSCL 3TH2T 1LEGA 2QGEA 3S7GA 2MOQA 4D3CL 3CZNA 2OLDA 1DBJH 1RJZA 4OM1H 1EFXB 1NCWL 3S36H 4WTZG 4DP1X 5D7JB 1Z5LB 5DWUL 2CIIA 5T3ZD 3DIFB 2NY6C 4ZS6D 4ANKA 4PGCA 4KKPA 4WK2B 1CD9B 2C4FT 4F15B 1IE5A 3MLRH 1MCOL 1ZV5A 3HB3D 4XN4A 3UPAA 5MP6L 5C0RH 2YA1A 5KYWA 3C09B 1SOXA 1XHHA 4RNYA 1SLVA 3OKNB 2V2XA 2FH6A 4WHTB 5IVXA 4S10A 5EC1B 2FEEI 3FRUA 3HC2A 4OLXH 2BZDA 2QQLL 3L5XH 1QRNE 5IHUH 5I1JL 4Y5XC 4A2MA 1CXLA 5ETUA 2BY3A 2ROYA 1BQKA 1X9QA 1Y0LA 3BKJL 4MXWL 5DEFA 3MCKA 1ND0B 5KZCD 1ZANH 3U7YH 3P4MB 2YAPA 4JM2A 2IPKA 1PCXA 4R4FL 1XGPB 1CXEA 4U1GB 3NEOA 3N42F 4ODWB 2QEJA 4ATTA 1FNGB 1JZEA 1MHCA 2GHWB 2I69A 1T4KA 4ORGB 4HWZA 3OX8B 4HEMA 1NEZA 4G82A 5A6LA 1N59A 3QB7C 1AZBA 1I8IA 1O6SA 3CSFA 3RVTC 5LNDA 5D6DA 3ILDA 3NAAL 5FDWB 1FO0L 3G5WA 3ORJA 2YRPA 4XCFH 5AVUB 3ZKQD 1KIRA 3T77A 1VFOA 3QDJA 2WVTA 2E75C 3TL5A 1QR4A 4DP2X 1A7BA 4JFWA 5CZVH 4F3FB 4P2RE 5D55A 1AGBB 2WXFA 5DUBB 1ECZA 3O6LL 1P4UA 4TQ8A 4Y5VA 3ME0B 4MGXA 2H41A 4DP4X 4GUPB 1W0WB 3PQYA 4JKPL 3ZDYB 2Q86B 4ZX3A 3RAJH 5CSBA 1CLVA 4CDHA 1FAIL 4G1MA 2V9TA 1KLGB 5E8NA 3WJLA 4RGMC 3TXAA 1AG6A 1JWSA 2AK1H 1EHKB 3FB6B 3ZW3A 1BGXH 1SM3L 2A6IB 4HIEB 5IF0A 1FNSL 4WV1B 3UG3A 3O0RH 4M7LL 2I07B 1NL0H 3CMOH 2C7UB 5HDBE 1J5OL 2PO6B 4KJPC 1I85A 3FQUA 1KBVA 3PL6C 3F64A 3FRPG 4EI5B 2O5YL 5C0JB 5MENA 5AW5B 3D0AA 1JGIA 2EDKA 4RQQB 1GS8A 4IU2A 4PN6A 5DR5L 3CU1A 2GBAA 2F19L 5A40E 4DP8X 2GAZA 3MFFB 5F7EL 4G9DB 3VGHA 2AEPL 3BUDA 2BW5A 4R0LA 1R3IL 1UA6L 2J43A 3HC3H 4MD5A 4UUJA 4Y9CA 5AOLA 1E27A 1MFBH 2XT1B 4U6VL 5BQ7B 1HCZA 3MRBB 1EEUA 3MRNB 5FA4A 5KYUB 2B1AH 3ZDXE 3ZZ1A 3LNDA 3KYMA 3IK2A 2VXUH 5I1HL 4CMMA 2KZBA 5J6HB 2BOBB 2ZCKH 5DO2D 1J9SA 3BWAB 4JFQB 3TH3T 3E1ZA 1Q9OB 4GG8B 4BD4A 1WFIA 1R5VB 2ZCLH 5DUJA 3L3JB 4ONOA 4KV5E 4L8SA 3AMKA 3KJ6H 2CO6B 4LEOB 2VDML 3D4YA 3MRRA 3GRWL 3QIUA 2WXHA 4Z95L 2XZCL 4QO1A 2IVFC 3NJKA 5EU6E 1YG9A 3QJTB 4JN2A 3PY9A 3EH3B 4RMVA 5DJ0B 2MPVA 3VWJC 5GGRY 4JKLA 3MUGA 2A73B 1OPGL 3ETTA 1NUFA 3ESUF 2OP4L 3PCYA 1CL7I 4XXCC 5EV7A 4E41A 2WBWB 4W4OC 2YBRB 1OK8A 3U2IA 3FQWB 4JRXD 2GK2A 3GDCA 1AXSB 3ZR5A 3Q13A 5EBMB 1LP9A 5FWRA 3GSQA 1JZHA 3GXUB 4A7VA 3F58L 2Y7SA 5KSAB 3PWPE 4HPOL 3V7AG 5F71A 3ILQC 4H4NA 1DZBA 1WD9A 3NVQA 5IVNA 5F7BA 2FYVA 3ZZQA 2DIAA 4H0HB 3ULVC 3MNZA 25C8H 5CJOL 1DR9A 4YSDA 2LV4A 1C12A 3VSQA 1OT4A 2XWRA 2W38A 1AGFA 1E5ZA 1SOQA 5E00A 1FLTX 5I6KA 4ZMNA 3BWSA 3HAEH 5ID1B 1EA9C 1MIMH 3L9RA 1DP0A 4A7UA 5F3HA 5MI0C 4QWWC 4ZMYA 3FHQA 3SYAA 2B08A 3DMMC 2Q6WB 3K4DA 1QG3A 2AEWA 1S6NA 1PG7H 1QABA 2FQGA 2QLVB 2PYEA 4G42A 4G71B 4Y9BA 2C26A 5DZPA 5C09E 3WEMA 4GG6A 2ESVD 4K9EH 4JFED 3QEQE 4GKZA 5DLLA 2ZWLT 1W0VB 5CWSA 5FECB 1FNAA 4U6XA 5I19H 1CVRA 2VIRB 5IEHA 3C6LD 3IEAA 3M8OH 5JDJA 4QI3A 1RIHH 2A83A 3DJSA 3QG7L 4HW6A 5I75B 2UWEB 1C7TA 1JMXA 2D9QB 3FCSB 1MCEA 3JVGC 3Q2WA 3HHSB 3QPKA 4ODSL 1PKQA 1LO5A 1AZZC 1EFXD 2P5EB 4AEHL 2ADJA 2YPKB 1W8NA 4QYAA 3V4PL 4ACPA 3VCLB 4HIPA 3TBYA 1QP1A 4TUJB 1YY9C 1CI5A 1EJOH 3DGGA 4M02A 1MNUH 5E23A 1AD0B 1U0QA 1KV3A 3ML8A 4G70B 4KTYA 4I13B 5B8CB 5DS1A 1Z0MA 4NENA 4DP0X 1E2VA 1T83A 3HE7D 1BM3H 2YUWA 1J05B 3B9KD 1UM4H 4PJCE 4QRQB 3JWNG 4XPGH 4DF9A 5HYIA 3D87B 4LCCB 1MIEL 4MZ3A 2F8IA 5GXBB 5HDLA 1DQQB 4KKCD 2ZYIA 3EDDA 2YQBA 2FB4H 4OJFH 3MRGB 2XTJC 3QEHA 4KRNA 2BDNH 2ATKA 4U1NA 3ASNB 3QJHA 4Y16B 4O4YL 4ZFOL 4LVHC 4WW1B 5IVZA 4UMGA 1TG8A 2ENYA 1WC7A 3T1WA 1R6VA 3ARFC 3TCLB 3AAZB 1QI4A 1IBDA 4M8RA 3T1FA 1D9KC 2DYPA 3KR3L 2ZJSL 3QQDB 4OD3H 5LKNA 3HMXL 3KPLB 3T0EE 3VH8B 2IAMB 2W0KA 2JQAA 5ALBL 2XNAA 4BYHA 1U95A 3FW6A 1KLUB 2VL5B 1M1XA 2KERA 4R3SB 3HFMH 1T7XA 4QOKE 4BWWA 4HSQA 4OZ4B 3TM6A 3LNHA 4PTUA 3QARA 5FOBB 3QJOA 4U1SA 1QSFE 3DGCR 1NFDF 1WIOA 5EIIA 5I6OA 2VTFA 1WAAF 3P4OA 4XBGB 1MVUB 4G11A 1F3GA 4JMXA 15C8L 3QWRD 4QJ5B 1B0RB 4OTXH 5C6TL 1EJ8A 1GOFA 2M83A 2X28A 1REIA 3FB8A 4N0YL 4OVVA 4YGVA 5DUMH 2CBQA 5MERB 1M7DB 1HL9A 4IOSA 2PMZA 4JFZL 5PAZA 3QQNA 4Z8FH 5KS9A 1IM3D 2WP3T 1NGQL 3ET9F 4KKZA 1CGUA 4HMCA 1NEUA 3S8WA 3EG9A 3GXIA 1P1ZA 4I9XA 4GRMA 4K8RH 2PO6D 4PHZA 2XWTA 3UZ0B 3Q1SL 4UM8B 4G3YL 3CUPA 3AG2B 4P4RA 4YUEH 3BKYL 1INDH 1DO5A 1I1YA 4AQZA 1P7HL 1PY4A 4AYDC 3V79C 1QZNA 3DTXA 3GFUA 3HAEG 3QJVB 1ZLVK 1SXZA 1HEZB 1IIIA 2XYCA 2Y5TB 4WWKC 3C6SA 3NFPA 2NNXA 1G5GA 2HG5A 5GGSB 2V5RA 1ZTXE 4OKDA 2G4EA 1E5AA 5EEZA 4PI0A 3H9SD 3GBMH 2WZAA 1W0YT 1T5WA 2PPFA 4ETQB 3MA7A 1SQ2N 1L9OA 2YZ8A 2R2EA 2Z9TA 2G5BA 2GG1A 1P9MA 5H37A 2Q76B 4CJ0A 1RULL 3QUMA 4JUTA 5BXFB 4YLQT 4PV8A 3SKMA 2IAAC 1QTYT 1JHTA 5FUCE 2IXQB 1N12A 1KBKA 1K2DB 2ZCZA 4G6KL 1KCRH 3FULA 1CICD 1AYOA 2OMTB 1PJ9A 3OMIB 4YBLB 3NYYA 4WO4C 3W81A 4F8LA 3GIVB 1MHHB 5DRZA 3ESMA 4M8UA 4C4KT 3QZNA 4UF7C 2XN2A 4WZ9A 3AT9A 1KJMA 1XZWA 4AQEB 2ORBH 3HMWL 4GAYA 5IB4B 4KMLB 3MX0B 4H5SA 3WHE0 3NP3A 3TV3L 1RKRA 1GLCF 2GC4C 2BVOA 3P40A 3FTUA 4Q4IA 1D6VH 4V2BA 5FV2A 1XSKA 4ERSH 4JJ5B 3I6LE 4V33A 3CMGA 3L6FA 4ZW8A 4HXAH 2YQ2A 3HG5A 1YEFH 5JIPA 2ZYSA 5EWIH 4N28A 4OLWL 1ZXQA 5GPRA 3SQRA 5D7IB 1FNHA 3CXDL 1JDCA 1HE7A 4R26H 3OTTA 5KVPA 4X99A 5IP4A 5BJTB 4O5LL 1XF4A 3UCQA 4JDVB 3N0PB 3A4EA 1K5NB 3T8XB 4WW2A 3UTOA 3QNXA 2J1ZA 1ZE3C 4AJYV 1RHHB 2WLJA 3L4YA 4OZGA 1OSPL 4MYPA 4D0DB 2EZ0C 1IV8A 1L9RA 2ESVA 4JFEA 5D71L 2WD0A 4OCSL 3M45A 2FEDC 4LSQL 4WY7L 3A24A 4FS0A 1V05A 1KY6A 4J2XA 3ELAT 2ICWA 2PABA 4FGMA 2VOTA 3L2LA 3PPSA 4QEGA 5I1DA 4DQOH 3GHBH 1NCIA 2AQRA 4QR7A 3OKDA 5E9NA 3G5VB 2IDUA 1DVFC 3C60B 1IKFL 4KZDH 2E9GA 2LU3A 1EFXA 3LH9A 4PJ6A 4D0CB 4L4VE 3ECBB 1Z5LA 1ZY9A 2P5ED 3DIFA 3OLEA 4FNQA 1XTMA 4FA6A 4JPWH 3GIZH 2D03L 1E4KA 5FR3A 3AU0A 1OQXA 4HCFA 5A1AA 3HG1E 2MCPL 5C07B 3F7KA 4HJIA 2WGNB 2YIHA 3JWNE 3OKNA 2FX9H 4WHTA 1AXTH 3IMTA 1RMFH 4I3SL 5EC1A 1M53A 2TRHA 3UG5A 3BP5B 5AYUL 4DAGH 2AQPA 4LDEB 5GGUB 2R7EB 3ABLB 5DD1L 2WSDA 4NDMB 3DMMD 4AEIL 2CK0L 1ND0A 5E94B 5T1JA 5D1QB 4FLOA 3P4MA 3BX7C 5EZLB 4J8QA 1DQTA 5FHAH 1XGPA 3UTTB 2Y7QB 2XRAH 1CDBA 3CH1A 2Y06L 2XFXB 3PE9A 3PGFL 3Q6FB 4ODWA 4YHLH 1FNGA 4TS6A 5EULV 4V1DE 1KBGL 4PRID 3X17A 4ORGA 1MRCL 3OX8A 4N8CL 4PLJC 4ZO8A 3U1SH 5C97A 2D7MA 4R96A 4P3CH 4UT6A 1LO2H 5FDWA 2EXYD 2YR3A 1AG0A 4G6ML 2HXAA 3AM8A 3T2LA 1IBHA 1IFGA 3O2VL 4Y4HB 1U2CA 1XXFC 5KYNA 3VD1A 1ZGLM 3VDCA 2EADA 3WXWL 2PPAA 5BO0D 1B0GB 1A6UH 1YY9D 3H54A 2OL3B 4UB0L 4ZO6A 4F3FA 2WUCH 1DANU 1AGBA 1GS6X 5DUBA 1J0JA 1MJUL 4G59C 2A9NL 2ZAGA 3ME0A 5GISL 3LZPA 2VDLB 4UQCA 4DH2A 5T1MB 2YBGA 3P77B 4GUPA 5KOVC 1W0WA 3S3PA 3DX6A 5GJSH 3SBQA 2Q86A 4KRMB 4UINH 5EOTB 3H9ZA 4EOWH 1KLGA 5FB8B 4N90D 2F58L 3D5OF 5F1IB 4K5MA 4YHYB 4L05A 3FB6A 1FIGL 1HEHC 1KN4H 4NWUH 2A6IA 4HIEA 3MBWB 4L4TE 4GUOA 1S5IL 4WV1A 4TNWF 2I07A 2C7UA 3NP4A 1NIFA 2JI3A 2PO6A 2EDNA 2YD3A 1T3FB 3IXAA 4MLSA 1AD9A 1QRNB 4U3SB 4EI5A 1PX3A 3O2DH 5FUZH 5C1MB 3IF1A 1IZJA 2I60L 3TBBA 2E0PA 1VGKB 4R4BA 5GS3A 5AW4B 5DZNA 5T3XH 3MFFA 4NJAL 3S9DB 5BOPA 4G9DA 4KJQD 2L4OA 5IFJB 1HS6A 3A5VA 3D34A 4K94L 4XC1L 1YNLL 2B7DT 3OJDB 1CLZH 4GXFA 2EUVA 2AXJA 5BQ7A 1GCYA 2K45A 3AREC 3MRNA 5KYUA 3H9SA 2AW2A 3G04B 1T7YA 2EXWC 4KTEL 1LK3L 4KDTA 4A2DA 2I32A 2MOGA 4M6NH 4OCNC 5J6HA 2BOBA 3ARBD 3NCCB 4MKTA 4W6YB 3IJHB 3BWAA 4JFQA 1Q9OA 4PS8A 3OAYK 1R5VA 1V55B 2N0KA 3SIKA 3ATFA 3L3JA 3P2TA 2ZKYA 5ISZD 3WTWA 3L9YA 1KFAL 1JZ6A 2XJKA 3BUIA 2MTPA 4LEOA 4P2RB 2CO6A 3U1PA 3CFTA 5E6UB 5D7HA 1CD1B 1L6ZA 35C8L 1CICA 2VL4A 2BW4A 4F8QA 2DYSB 3D08A 4M6AA 2DTSA 1OTTC 5DJ0A 3ATAA 2VQ4A 4YHOH 1EXGA 2A73A 2H47C 1A5FL 3QEGH 3G6AB 1FAKT 2H3NB 3WMQA 3APDA 2FJGB 2YBRA 2NY4B 1DL7L 3FQWA 4JJHA 1FC2D 1AXSA 3HG4A 1UFGA 5EBMA 1QMUA 3H53A 3Q2CA 4NKIH 3F00A 1FVDB 2QZ5A 4AE1A 4J3UA 1NCAH 5KSAA 2VLLB 4P2QE 2CH8A 3CDGB 3R19A 3OD3A 2RCSH 4NUGL 2D7TH 4YDJB 3SDXA 3CVBA 3QWQB 4YXKH 1R5WB 5B1JC 5GGQL 2VH5H 4PGDA 3DHUA 2WZ0A 2VDNH 2Y2YA 3D12B 4JO2L 1RIUH 1RZ7L 3IT7A 1IC5H 4AK1A 3GMQB 1OT1A 5C08E 2E7LA 4DGWC 3LH2H 4AV0A 1E5CA 4Z7UE 1XH1A 2F6AA 2DQTH 3EO9L 1MSPA 3LQAH 4TL4A 3QDAA 2E56A 2Z8VC 4PUBH 3ZDXB 5ID1A 4IM8A 1S5HA 5CUSL 1M05B 3H0TB 5DHEA 4JVWA 2GJJA 4MXVF 1CD0A 3MRIB 1NSNL 4LVOC 4TTDD 4FYTA 4GIOA 3VI3F 4HGWB 2Q6WA 2F5AH 4WO4D 2G2RB 5I6PA 2UVFA 2OM5A 1GY2A 3KGTA 4UT9A 3QHTC 4QRPD 3DX9B 1DUZB 1W0VA 3BGFB 3GTNA 5FECA 5E8OB 1JK9A 3Q5OA 5DZOA 5EU6B 1RI8A 1EHLL 1TO5A 3ZN6A 4OW6A 1T0OA 4HJGB 2VIRA 3MKGA 4YHPB 2NT0A 4HWBA 4LGPB 1WCBB 1UOWA 4BFKA 1BFVH 3TU6A 4WKZB 1B4TA 4IJ3C 5IBTL 4XP4L 3NJVA 3FCSA 3OKKB 4NI6A 3B2DC 1YECH 3HS0C 3D9AH 3HHSA 3T04D 4DVRH 1QSZA 3U0WL 1B3IA 2P5EA 4Y89A 2YPKA 2RJMA 3ZKMC 3T6XA 5JOEA 1OL0A 1VLXA 2TAAA 4JJOA 4TUJA 1LO3H 2X87A 4GS7B 5E2VH 3NIGE 3PWPB 3GZOA 5B8CA 1B4JL 5IROD 2W8CA 5KJ7E 2CGYA 1J05A 4QRQA 4RH4A 3GGWB 4LCCA 1DQVA 1DQQA 1QHQA 5H4YA 4EN3D 3GXFA 5AG8A 3RFZA 3FUKA 2J44A 3MRGA 2ALAA 4JPSA 3SKNB 1UCBH 4OR1A 2FEDD 1B9ZA 4WW1A 1J8HD 4ABVA 5T3ZL 4PRPE 3N1QC 4ZD3L 4Z7NF 1VPOH 3GLZA 4PRIA 3ECVA 3AAZA 4LLWA 2QL1A 4EXKA 2XA3A 1X5AA 2EKJA 3KYKH 5EMYA 4XNYH 5F9WB 3KPLA 3VH8A 2IAMA 2IH1A 4I77L 5C09B 3WY3A 1SUJA 1DVFD 4XNXH 3QEQB 1KLUA 1ID2A 2VL5A 4R3SA 4FKEA 2AJXH 3KYOB 4W68A 1FGNL 4OZ4A 5FYKD 1L9NA 2VRKA 1ID5I 2AJZB 3J7HA 5F9JA 3ILPB 4CA4A 3SB3A 3WNKA 1NLDH 4KKRA 3IGAA 1PZ2A 5C3LD 1MCJA 2VLMD 2X6MA 1N0LB 3B56A 1LNUB 1BQLL 3VGAC 2WP3O 1NCDH 2VERN 3WI9A 3CN4A 5CIPH 1OAUL 1B0RA 4FRWA 4PLKC 2Y3AA 3IXTA 3STZB 4CC4A 1JPEA 3SDDB 1JWMB 4TULL 3B6SB 4HEPG 4DFHA 1CBVL 1DVQA 3DBXB 5MERA 5E1GA 1M7DA 2GEEA 5GSVA 2ZOKA 1AJ7L 2YFOA 5CM1A 4B7IA 1ZWIB 4YXHH 4Z7WF 2OTPA 2QHRL 2OPCA 1BXAA 2CR6A 2O30A 4PJCB 5KSBB 1KWGA 1BYOA 3SGJA 4APQC 3US9A 1L3WA 1SUHA 2MQ3A 3VYOA 1ZHKB 3QFJE 4WHDA 5IESH 1QRND 2AJUH 2VZ1A 4UM8A 1BF5A 1NTDA 1UOVA 4X4MA 1EXUA 4CSPA 1JZIA 1ZA3B 3HC4L 3RUGF 2Z31C 2Y5TA 3POCA 4GAAA 4W9EC 2XG4B 1U3HB 1RZ8B 4RZKA 2X4PB 2ED9A 4AEEA 4WFFE 3T0EB 2GBUA 5GGSA 2BRRH 5HYFA 1A9BB 3FT0A 4U31A 1H3VA 1G6RH 2A6KB 4Q14A 1TTCA 3RKDC 3ARBA 4QOKB 3O6MH 3MVSA 1KEML 3ZT5A 5J12C 3QI9B 4ETQA 1MHEB 3FHAA 5F1OB 4KAQL 1U8HB 1QSFB 1AAJA 4C4KO 2Q76A 2ZXAA 5BXFA 3C9NB 1Q0YL 2ARWA 1UJ3C 4JY6B 4QPEA 3WOVA 3H85A 4NAQA 1TF4A 2K3TA 1P0SE 2IXQA 2LU7A 1K2DA 3SYQA 2B0PA 3BP4B 2Y5EA 2FSDA 2FJFB 3H3PL 1YNTB 1MHHA 4YK4C 3FZUC 5FK9B 3LZLA 2W60B 2ADFH 2ADGB 1QLRB 3RPIA 4JG1L 3ABKB 4KWUA 2YGQA 2BS71 3LJ3A 3HZYB 2AHIA 1QWYA 1G9MH 4TUKH 3S35L 3EYQC 4H8UA 1OAXH 3VM7A 1RQ5A 5FS5A 3MX0A 4YC2B 5IB4A 5DVLA 2NY4D 3TT3H 3V2AR 1KBWA 3KH3A 3C5JB 5AL8A 2BFGA 3OURB 2YHGA 4AIEA 4XX5A 2I9TB 3UJJH 3QUML 4B96A 4B5ZA 5DWPA 4HJJL 5EZPA 1Z6JT 2WK2A 4ZZFA 1A6WH 2PW1A 2UXFA 4UQEA 2WWMD 5D7IA 4DOHE 1NICA 4KMQA 4FQL<