The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
257
|
structure length |
227
|
Chain Sequence |
SFIMRLLNKPVPGGVAVVDLGEEGPPPRAFYQGKPVLVVREEGRRWIAVVGIPLSTKPGPQKLEVRAATGNHEERFSVGSKPEDLKRIERELAEQTAAYRRFSPGLPSNLMLDKPVDGPLSSPFPHSGLDFAVPAGTPIKAPAAGKVILIGDYFFNGKTVFVDHGQGFISMFCHLSKIDVKLGQQVPRGGVLGKVGATGRATGPHMHWNVSLNDARVDPAIFIGAFQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of M23 Peptidase from Pseudomonas Aeruginosa
rcsb |
source organism |
Pseudomonas aeruginosa pao1
|
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
Putative peptidase M23
|
total genus |
58
|
structure length |
227
|
sequence length |
257
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2006-07-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01551 | Peptidase_M23 | Peptidase family M23 |
A | PF18421 | Peptidase_M23_N | Peptidase family M23 N-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Peptidoglycan hydrolase domains | ||
Mainly Beta | Distorted Sandwich | Glucose Permease (Domain IIA) | Glucose Permease (Domain IIA) |