1QWYA

Latent lytm at 1.3 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
234
Chain Sequence
VSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSSGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peptidoglycan hydrolase
publication title Latent LytM at 1.3A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Hydrolase
total genus 66
structure length 234
sequence length 270
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.290 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qwyA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 1qwyA02
2GU1A 3IT7A 1GPRA 4LXCA 4RNYA 3UZ0B 1GGRA 3IT5A 1F3GA 1F3ZA 3SLUA 1AX3A 4BH5A 5KVPA 2B13A 2MP0B 3NYYA 4QPBA 4ZYBA 3OURB 4RNZA 2B0PA 2GPRA 4QP5A 5B0HA 1GLEF 1GLBF 1GLAF 1GLCF 4JBWM 2HSIA 3CSQA 1O2FA 2B44A 3TUFB 2F3GA 1GLDF 1QWYA
chains in the Genus database with same CATH superfamily
4P73A 3A7AB 2F3IA 2F3VA 3T56B 4UY8C 2K75A 3HOXB 1WTOA 1HNZL 3CQZB 2H5XA 1EFID 4BWGB 2CH4A 1ILQA 4OHJA 2V1CC 1JOQA 2GVBA 2F0KA 2YYZA 1I6HB 1BCPB 1Q7YC 4UP9A 3CC4A 3MXNB 1SNMA 1RKNA 1UEAB 2NTSA 3HFZB 1GLAF 1QNKA 1SMXA 2IX1A 2HSIA 1BBUA 3M4YA 3U4VA 1LV9A 4LF4Q 2FFKB 4IOCA 3OTOL 5GROA 3S1RH 4LF9L 2F0PA 1K73C 1VQPA 1TWHH 4A3BB 1EEID 2Z8LA 1D6EC 1D5ZC 2O2LD 3H09A 3BZDB 3TP6A 2VQFL 3GTKB 2JA6G 2B2YA 2RBMA 3KJPA 4NXNQ 4FO2A 3S2HB 1EY5A 1TVXA 1JB3A 2B2VC 2IPKD 4IFDH 2K05A 2A6HC 4DPGA 4M1UB 2VQEQ 4AQYL 4RGTA 3UDIA 4NP5A 1A63A 3I55A 4DR1Q 2F0IA 3S17H 4A3EH 3J81i 2EQSA 2PMZE 1HPCA 1IZ6A 3SK8A 1C7YA 2RF4A 5CYUA 2A5HA 5IWAQ 3I4NG 2Q8RE 1LABA 1J9OA 1CM9A 2OXPA 1XPRA 3HRZC 2HIXA 4HAEA 3J81c 1RF2D 5IGCA 4OO1I 3M9BA 1NR2A 1V1PB 2SOBA 2A69C 3FEWX 3I8ZA 3PF5A 1L0XB 5IGGA 2OTJA 4PMBA 2QILA 1L0YB 2TMPA 1WFQA 1PH7A 4K0KQ 3T13A 4BY1G 4DV5Q 2VB2X 1SSOA 1JWUD 5HGTA 2JXMB 4ZYSA 2YU9B 2D0PA 4WFN3 3OMGA 2ZM6L 3FMCA 1D5XC 3H0GB 3M7GA 1X56A 3E0JA 1YNJC 2NBFA 5LMNQ 2UXCL 1KXLA 2B8GA 4GN3B 4B3TQ 5BR8L 5AFWA 4XXEA 3D4RA 4C1NK 1PH6A 2WV6D 4AH6A 5J22A 1U4PA 3HOYB 5ELOA 3EA6A 3NELA 4PZ6A 1NBWA 1QZHA 3NE5B 2AHOB 4A3MB 1KAWA 3CMEA 5KNDA 4XT1B 3GTPB 3F8TA 2R7ZH 3HOVB 1GVPA 1D1KA 1JJ2A 1M4VA 4B3SL 1UUPA 1BUVT 1VMPA 3HKZG 3O13A 4K2LA 3W5OA 4Y52H 1YBYA 1WD0A 3OMCA 3BZKA 1ESRA 4RGNA 4DR7L 1TWFH 1FR3A 2AQ2B 3HS0C 5TSSA 4TVAB 1ENAA 3HKZE 5D3IB 3U9OA 4DR5Q 4CJ0B 1LACA 2L4NA 1YHBA 1H9MA 3SLUA 5HGQA 4C3IH 4DAYB 2NVXH 1IL2A 3ULPA 1JOOA 2QCPX 1PFBA 2F1MA 2ZTDA 5M5XB 1EIYB 3VR5A 4KY5A 2VS1A 4PZ8A 4JI5L 2PNRC 1N34Q 4A3LH 5IIFA 2EY6A 2JE6I 4GNXC 2R92G 2CFMA 3NTIA 1STBA 1N36Q 2WB1G 1BKBA 4Z9CB 3CRLC 1RCVD 4U68A 5LMNW 2CQOA 4K5XA 3WOFA 4E6IA 1LTTD 4JI3L 2DY8A 2QEXA 4IUTA 4UAIA 3D6WA 2RHSB 3HOZH 2KCNA 1E2ZA 1LTLA 1M90C 1J5EQ 4R1JA 5FJ8G 1F9SA 1EU4A 3DWQA 4A93B 2GU1A 5IYDG 3DM3A 5C0XI 3S1QB 3GTMB 3TDQA 4DV6L 3L7ZC 2VUMH 4YHHL 4HIMA 1NE3A 1S5CD 1VQ8A 1WTQA 5I4DA 3S1MH 2LXJA 2PZWA 2F0TA 1PH3A 4DUYQ 2K5VA 3C3LA 1TWCH 3BS1A 5HURA 1W3SA 1PTOD 1TWAH 2ZJQA 4IJLA 5IYBG 1B9NA 2UUCQ 3KBXA 3GDEA 2DNCA 1VQ4A 4QQBX 1O7ZA 2MPMA 4DR6L 4CDFC 1HCZA 1G2SA 3S15H 1G91A 2F03A 3M3YB 3FP9A 3BVMA 5CV8A 2RCNA 5C3EG 5T1IA 4KKTA 2OQKA 3LGJA 3ULLA 3RMHA 4GLVB 2A74C 1GJXA 1I4PA 3GTOB 3EIVA 5E4WC 2B44A 4A3IB 5CV7A 2A19A 1ET9A 3H94A 1BBXC 1WOCA 4A3JG 1Q8IA 4LFAQ 2QDBA 3L9AX 3VYRA 3QOLA 5M5WH 3F2BA 3GTGH 1MI2A 3J80i 3CXCA 2KBNA 1B53A 1B9MA 3PO2G 4BBRB 3HZXA 1S5FD 2B2TA 1G6PA 1Q46A 2HIVA 2CCZA 4A3DH 1EQVA 4CDDC 4X62Q 5LHY1 3WWVA 2NZOA 3ICEA 4YWLA 3T1HQ 1LTAD 4RA8A 4EQ5A 1PRTB 4QMGA 3J7AF 2NN6I 1HR0L 4QUCA 4CHTB 1KNEA 2VL6A 4JI4L 2F3WA 4IO9A 4ALPA 5M5YH 1SRUA 3IRBA 5D3DA 3I4MB 3A54A 1VQNA 4KKSA 1G6ZA 5IP7G 4H0LC 2EOTA 4C3HB 4GNXA 1PZKD 1Y1WB 1TXYA 1EFWA 1RL2A 2SNSA 2L11A 4UP7A 4BXXG 4X66L 2CKZB 3NBIA 1PH4A 1QCBD 1HNWL 2RA4A 4TSSA 3MC0B 1SNDA 4AYBE 3NUCA 3QJYA 3CP0A 1E1OA 5JVH3 2EYJA 3MXNA 3DEPA 1CUKA 1HZCA 1YITA 1Y14B 4MIUA 1LT5D 4NB3A 1X3FA 4L5RC 1I6VC 3PUYA 4HCEA 2F0FA 3CCEA 2K33A 3RLNA 2E74C 3HOXH 1SROA 3I73A 4P74A 1LTRD 1E22A 3PSIA 4EQPA 4IPGA 2MQHA 1A2TA 5IT9c 1GOZA 5CV4A 4POGA 2WB1B 2RDFA 1I6HH 1LTSD 2OTLA 3AYHB 2KHJA 1Y69U 1T5EA 2ICEC 1X3GA 2ZTEA 1JC7A 4LUVA 4DAMA 2QW7A 4XYOA 1K0RA 2KCCA 1WTPA 5JJLA 1KDCA 1VQHA 3K5OA 3ERQA 1LLRD 1TS5A 5KYLA 2EIFA 2JK8A 2A73B 3GTKH 2UUBQ 2NVYB 2Z6KC 4V190 2PQAA 3S2HH 5CC4A 3OIQA 1PLFA 5J3BA 1STEA 2I5LX 1I50B 4HMIA 1BDOA 3E9IA 5M3FB 5F2DA 3D6CA 3S1NH 3BDOA 4A3DG 4EVOA 2OF1A 4QP5A 1MBYA 2DJFC 3TZDA 5C44G 3ONAB 1SFOH 5JEAG 2BH2A 3K59A 3D31A 4C3JG 4OO1G 1ICWA 4YWMA 3S2DB 1GUSA 3NBHB 4Q0FA 1Y8PB 2RCFA 4DUZL 4G7OC 5C0XH 5IP9G 1HUMA 1XMQQ 5M3MG 1NNXA 2IJ0A 1X9NA 4CDEC 1S5ED 3V05A 3ITPA 1XMOL 2R93H 3AMUA 1OO9B 2DN8A 5IGEA 4LF4L 1RIPA 3ND8A 4LUZA 3HP3A 1GGRA 3S24A 2HCIA 3EQLC 4DV2Q 2YU9H 3CKIB 1TS4A 2ZXPA 5ELBA 1WTXA 3H0GH 4IJHA 1LTGD 1EYDA 2F4VL 3GTQB 2P5ZX 4P75A 1E0BA 3PO2B 4EQOA 4DKAC 2AQ3B 4DR2L 1XXGA 1EYGA 2A68C 3KK7A 4KD4A 1IBML 2VQEL 4ILWA 2NZHA 5K36G 3HOYH 4IFDI 2E75C 1U5KA 1F2LA 1PVOA 1C4QA 1WD1A 5EKKA 3NP8A 2O5IC 1JCKB 4B3MQ 4IQZA 5LL6X 2BE5D 3SVMA 3IAYA 4RHRA 2JP1A 1PFSA 4PZ7A 3CCVA 1N32L 4RCOA 1WTVA 1M8AA 5I9OA 2FINB 4RCNA 1W6JA 5CV5A 1FJGQ 4BY7G 3I2ZA 1KTKA 5EPKA 1BVSA 3VA5A 4ABNA 1PMRA 1AH9A 3VYSA 2ES2A 4G7ZC 3CF5A 5M5XH 2AWNA 4CDCC 4F88A 1QZGA 2UXDQ 2MP0B 3GQBA 1Q8KA 1SJED 4YIJA 3CAMA 1A6XA 3KF6B 4R4TA 2GPRA 1R9TB 3K80C 4BA2I 2R6GA 1VQIA 2B2YC 3C1FA 3FPUB 2EYFA 1MSHA 1QILA 3OPOA 4TQUS 1EQRA 2HHHQ 1UWVA 1QVFA 1BQQT 4QCLA 2KHIA 1BXTA 2Z6KA 1KRTA 2RVLA 3J7A5 1ZYRC 1EOTA 5EJWA 1CKOA 2Q2HA 1PRTD 2XVSA 2Q2TA 4DNTB 3K0YA 3OW2A 4ODGA 1GM5A 3AQQA 2CW0D 3SDZA 4G57A 4DV4Q 1K3BC 3S1QH 3W3AA 5I6YA 3GTMH 2MFIA 1S40A 2O4XA 3IT7A 4RNYA 4BBSG 5EQ0A 2HDMA 4LMQD 2F4IA 1XYIA 4LFBL 4KHZA 3HOUG 1VQDA 4PNYA 1E3PA 1QVCA 1VMCA 4A3KG 1PH8A 1AX3A 1C9OA 1EY0A 2PNHA 2WFWA 2UUAQ 4OX9Q 2BOSA 2R3ZA 3R2IA 3NWSA 1PYBA 1Q3LA 1BO0A 1F9QA 2JA9A 4QIWB 1JOKA 3NTKA 1I94L 3M3YH 1CSPA 1Z6HA 2RDHA 2F0OA 5GAHC 1XNQQ 1VQMA 2MGSA 1B2TA 4CKCA 4JI2L 2IT1A 2B29A 1F77A 4GKKQ 4DV0Q 3GTOH 2MNAA 3GTJB 2B63H 4ME3A 1Y1VG 4K8IA 4R9WA 3I56A 3ER0A 2WINB 2VB3X 3K7UC 3UDFA 3ULJA 4G7HC 4A3IH 2KEEA 3I7FA 3F2CA 2JA8G 2NZ1D 1YNNC 2QKIC 4MNOA 3T1YL 1H9RA 1T9HA 5IGFA 1HR0W 4JBMA 1FNWA 3J80L 4IN3A 4RHSA 4BBRH 4GNXB 4LF8Q 1UNSA 2K6AA 3D4WA 4KV6A 3KDFA 4OIKA 4LW1A 1NTGA 1K83B 5AJ3Q 2JQOA 1IW7D 2NN6G 2OWOA 4DV1L 2NVQB 2ALYB 3MAQA 3NENA 3JAMi 4DV3L 4BA1I 1MJCA 1LT4D 4DA2A 3F1ZA 4I7ZC 5KGUA 3CPFA 1YNXA 3UI2A 2YTYA 3H15A 2L15A 3A8JE 3CC2A 3HKSA 3JAMc 4KJOA 2VXWA 1O7IA 4A3FG 3SK5A 3I4MH 3BU2A 1QE6A 3FKIG 1EIFA 5LMUL 1SLJA 2LXKA 5IOCA 3DM1A 1Y1WH 3R2TA 2FMCA 4M8AA 5K5PA 3AB9A 3DEOA 3CMAA 1SBBB 2FXQA 5I2YA 3OWEB 4JI6Q 2HQEA 5CV9A 4C56C 1VQCA 2KUMA 4BY7B 3T16A 4JBKA 4KKUA 4XIGS 2HCCA 5DM73 2EXZA 4FP5D 1DXMA 4CJ1B 4OELB 2Y0SB 3M4PA 5IT9L 4B3RL 1L1OC 4GS3A 1R4PB 4J6HA 5KIXA 5FLMH 4MTNA 2PQAB 3BYTB 3EROA 4UP8A 1J8IA 1LTID 1WCMG 1D1IA 3TMEA 1QVGA 3QWNA 4DR4L 4JBWM 2QEJC 4WJWA 2G9DA 4PMWA 3I4LA 3IFDA 2C9OA 2CHBD 2ZJRA 5EKLA 2E76C 1QWYA 1CZWA 4ULLA 2JA7G 3MVVA 4NDXA 2PQEA 1N33L 1TR5A 3HG9A 3OWFA 5C4HA 2EVBA 4F7XA 2MP1A 2PYKA 4LF7Q 1BR9A 2BA0A 5FLXc 1XTDA 1H9KA 3CCMA 5ISRA 2F0WA 1VQGA 4H02A 2F0HA 4JI1Q 5IGBA 2JA5G 3RZDB 1B50A 4HIKA 1ENFA 3MXUA 2L0CA 2NVYH 4JYAQ 2PZUA 3NBHA 5C4XG 2ZJPA 4A3GB 4JW0A 4YWKA 4CBVA 3NTHA 2A6EC 3SEBA 2E2HB 1I50H 5BN4A 2L5TA 1ENCA 5M3FH 1WTHA 3RZOB 2PPBC 1VQEA 3HGBA 5DAUA 1OXSC 4CKEA 3URYA 2A6HD 5A2QL 2K52A 2B2TC 5GQOA 2L1BA 3FPPA 3PCOB 4CJ2C 1RODA 2WKDA 1F2YA 2C35B 2XSCA 1EWHA 2VZAA 3M7NA 1CHQD 2RDGA 4P2CB 1LM0A 2DY7A 1K8MA 4IUPA 3OIPA 3C46A 5L37A 2I07B 2OQ0A 1PTOF 4LFCQ 2A69D 1A0IA 3OYYA 1DCZA 1QB5D 2KA7A 4X6AH 1Y1VB 2N55A 2DNEA 4QF4A 4FF4A 4KHVA 1O7YA 1B4OA 3ZJYC 3PO3B 1MIUA 3HOWH 2IWHA 3P7JA 4K6LA 3STBC 1B1ZA 4ZK9B 4IOAA 4IFDG 1FL0A 4K14A 5IGDA 3TEHB 1WVLA 1U4MA 1YNJD 2QDLA 1F9RA 1NSNS 2K32A 2EZVA 1UE6A 1EY7A 3L3OC 5KVPA 4A3EG 2CWPA 4GKJL 1I5FA 3E9HA 3R8BA 1XNRQ 3G6JB 5T1GA 5FO8B 2XGTA 3NPPA 2KHSA 5COYA 4FXGC 1V1QA 2B3GA 5JJKA 4CKBA 1VQBA 1Q81C 1L1OA 4B9XA 3G6EA 1LT6D 4LF6L 4N8X1 2JN4A 2PZTA 1D5MC 3KF6A 4X64Q 3RUZA 1HNXQ 4KY6A 3I70A 1RD9D 1SEBD 1IHZA 1SNQA 2JA6B 4YCUA 4WJ4A 1AP0A 1KAAA 5A35A 3MHBA 3EFXD 3C1EA 3H91A 3SE0A 1YJWA 3KLWA 2D9UA 5E4XA 2PMZB 2AWOA 3TZUA 4HIDA 4NXML 1X55A 4OXPA 1PZID 2NUCA 4FF3A 3WOEA 4RFBA 1NY4A 3W1BA 4B9WA 4N8FA 1HNZQ 2IHFA 2K5NA 5FO9B 4Q5VA 1C0AA 3BDLA 5E3FA 2B2UA 2R7ZG 1V8QA 1NJIC 1WJJA 3GTLB 3I4NB 4PV1C 1GLEF 2FJ2A 1WCMB 3G48A 3NSWA 3SK6A 3U4ZA 2F3GA 1Y8NB 2E5LL 2X6GA 4QB4A 3DLLA 1BCPD 3Q23A 2JA7B 4AIMA 2NTTA 4LF9Q 2O5JC 1GKHA 2M9VA 1B3QA 4BY1B 4KK7A 1HQMC 4PMCA 5JJIA 4C3IG 4HR7B 2F0GA 2JJQA 3TP7A 4JI7Q 2JA5B 1H95A 3Q0AA 1HHVA 3TRZA 3JC66 4A3LG 1CT1D 2KJXA 1SR3A 1W6KA 3I91A 1YJ9A 1PH1A 1Q1EA 5C4JB 4Y7NB 2GN5A 2D62A 4AQYQ 5KNBA 4DXFA 1Z7TA 1AE3A 3I90A 4DV7Q 1F3GA 2BA1A 2FHTA 2PW7A 3KDFB 4HJ9A 3PQIA 4JK1C 3L2PA 4IPHA 2UXBL 3OOCA 2WP8J 3KF8A 1SE3A 3K7AB 2AMCB 3HOZG 2AQ1B 3HKZB 3LNNA 4JG2A 4AYBG 3P1HA 1ZEQX 3UE1A 2UU9Q 1B7YB 4WORA 2PO4A 4JV5L 2F0NA 3FDTA 1FGBD 5JEAJ 3S1RB 2VUMG 4HJAA 4EGVA 1IBKL 1STYA 4X3UA 5C6AA 4O1NA 4JI0Q 4IUQA 3MTSA 3P75A 4X65L 4F87A 2K03A 1K83H 4H7BA 5JVG3 5CBAE 1VQ6A 1A3UA 4HEDA 2NVQH 1XTCD 2R92B 3A8IE 3CQZH 1D7QA 1II3A 3P20A 4JC0A 3JAML 1E2VA 4OX9L 2ICIA 4DGZA 1MHWC 2N88A 1KNAA 1HTPA 3S16B 3S17B 1HZBA 1YI2A 3U50C 4A3EB 5E7NA 3L0OA 4C1NI 1SNOA 1PXUA 2QGQA 4DU9A 2Q8IB 4B3SQ 4YCWA 5JPNC 1GLBF 1VCIA 4WJ3M 1K28A 1UEBA 3EN2A 1GLCF 4A3BH 4LNQA 3H3VC 4DAVA 3Q8DA 2L9HA 4DR7Q 5IYCH 1JORA 2XN9C 4KHPL 1ICFB 1KQSA 3NK9A 1C8CA 3R93A 4KI0A 1SDFA 3OSOA 1P16A 4HTHA 3AFQA 1G8ZD 1AZQA 3F2UA 2BCOA 2MO0A 1V1OA 3N6RA 1DOLA 5AJ3L 4LWCA 2FMMA 3HEJA 1CA6A 1EEFD 3J81L 4NPSA 1VQ9A 1VQ7A 2EE1A 3J7AV 3UZ0B 1S4ZA 4XQQA 1DJRD 1Q1BA 2KECA 5I9PA 5DNFA 1BOSA 1DYQA 3TREA 1GUTA 1VQFA 2NWGA 1VS0A 1A3VA 2HQLA 1IYJB 1SYGA 2YTXA 5FLXL 3KFUA 1EZ6A 5C3EB 4JI3Q 4JCVE 1QOHA 3RD4A 4KJNA 2F0QA 2K04A 2A1AA 2WAQE 1JMCA 3EJIA 1KD1C 1QNUA 5D14A 2NYZD 4I65A 1E7ZA 2F0VA 4YY3Q 2HDLA 2QF7A 3ZYYX 4A3JB 3VDYA 1TWFB 1WYDA 3IT5A 1SNPA 3RZDH 1JWSD 3SGIA 1VDZA 1EIHA 1X6OA 2XRQD 4HMJA 4NXNL 4DK1A 4DV6Q 2B13A 4YHHQ 2SEBD 3MEHA 3V2TA 4QPBA 4A3GH 5FKAC 1TS3A 1HUNA 4GZYC 1HXYD 3K5LA 2RQXA 2NVXB 5GADC 1S72A 1NUCA 2E2HH 4XDXA 5I2XA 4EQNA 3NXWA 4RMFA 2E2JB 1PYWD 3BVZA 4FF1A 4DR1L 3F2DA 1NR4A 2F0SA 3NWTA 2EY2A 4A3MH 1PRTF 1VQ5A 4H44C 3HOXG 3GTPH 3HOVH 3PUXA 1SN8A 1L2FA 5IWAL 4L8JA 2F0LA 3H6MA 1FYCA 2EYOA 4YCVA 2RSNA 3KYHC 1EOVA 5ELEA 4UDUC 4NKLA 4OONA 4XYQA 4OL7A 5HY6A 1PDQA 3K81C 1A2UA 1EY4A 4K0KL 2EYMA 1J6QA 4AYBB 4DV5L 3RLFA 1EY9A 4A3BG 1ASZA 1V43A 1VQOA 3A8KE 3U9SA 4ME5A 3I72A 2IX0A 1FVIA 4OIJA 1MSGA 3T4AC 1L1OB 4BS9A 3RN2A 3PO3H 5LMNL 1SMYC 1G291 1EZ8A 1R4QB 4P71A 4LK1C 4RKLA 4B3TL 5B0HA 4LUOA 2L12A 3Q22A 2R7FA 1NCVA 3CC7A 1GUGA 1GXDC 4QJFA 4L5TA 3VYTA 2A68D 2GA4B 2K5HA 1K3RA 1YHQA 2DJGC 2PI2E 1HR0Q 1B8AA 4XQNA 4JI4Q 5C0XG 2JYOA 4JVZA 5M9OA 2Z9HA 3MZ5A 3S9WA 4JPBW 1STHA 1WTRA 4A93H 3S15B 4ZQ3A 2Z4HA 2R93G 3H3VH 3I3CA 3DMUA 2Z0SA 2MUYA 1KL9A 2OEOA 1AZPA 1KLGD 4DR5L 1SE4A 3IL8A 4X66Q 1CTMA 2X69A 1NMFA 1RTNA 5CGKA 1HNWQ 3WDNA 1YIJA 2JA6H 3J7YW 1I3QB 4R4CA 4FF2A 5M5WB 3H0GG 3EBEA 4MZ9A 1N34L 5CV6A 3DWAA 3TS0A 5I6WA 1ZXTA 5FO7B 4A3DB 2ASBA 1N36L 1LT3D 5C44B 3HOYG 4OEMB 4C3JB 3DHQA 1AE2A 4A3MG 1RHPA 1S5BD 2Q2IA 3KOJA 4GN5A 1UE5A 2M2LA 4ZLTF 1Z47A 1J5EL 5M3MB 4ZYBA 1GUOA 5GAGC 1ZYRD 4GOPA 1TU2B 4OGQC 1JE5A 4R4IA 1KIXA 2IY5B 5KRUA 4K6DA 3KF8B 2WIIB 4BY1H 1F2MA 3GP7A 1B70B 5GAEC 1HNXL 3IFTA 1KABA 2EDGA 1I4RA 1PTOB 3LWEA 1XPOA 4XTCS 4A76A 1H9SB 5EPJA 4QUFA 1X32A 2AUJD 3BJUA 4DUYL 1BF4A 3OW7A 3OURB 3RLOA 2YV5A 3FHWA 1TKWB 2D5DA 5C4JH 4Y7NH 3PIP3 2ZT9C 1OXUA 2K14A 5CR3A 2UUCL 1I4HA 2YTVA 5C4ZA 3TUFB 5ELNA 1U9RA 2CWAA 3CCLA 1VQKA 5BN5A 5G3LD 3TSSA 4P72A 1AEXA 4PG3A 3A0JA 1Q82C 4ZKCB 1IXRA 1STNA 3K7AH 4C3HH 4DUZQ 1IYVA 4POFA 4OWWB 1DD2A 3LX0A 4HIOA 2J0TD 1VQLA 3VR2A 2H1EA 1QUQA 3IKJA 5EAYA 4A93G 1XMOQ 3EVQA 4LFAL 5EPLA 2RKSA 4HJ8A 2X6LA 1LUZA 3SHLA 2ZXOA 1GPRA 3S14B 4DR3Q 1D2BA 4R4QA 4DK3C 1EYAA 4RGOS 3NQIA 1YNND 2K5DA 3QR8A 2Z1CA 4X62L 3CHBD 3CD6A 4JI7L 2F4VQ 3MXGA 3T1HL 5EBDA 2R92H 3DUZA 4DR2Q 3BYYB 3FVQA 2F0MA 3D0FA 2K1BA 2F0DA 2SNMA 4L5QA 1EQQA 2HT1A 1IBMQ 4MTKA 3S1NB 3VR6A 4JOIC 4R4OA 4DV7L 4RAUC 1EIGA 4K8JA 2G5DA 3S16H 1EU3A 1SFOB 1EY8A 1X3EA 4ID6A 2F0UA 4FNFA 4C2MB 1ML0D 3M4OB 4X3KA 1JICA 2Q8TA 4NW2A 4IFDJ 1OXXK 4PQXA 5JOBA 2IL8A 5FJ8H 1Y8OB 5C3WA 1CSQA 2B63G 2UU9L 1N32Q 4A3IG 3RNUA 3G7LA 4QL5A 2B2UC 2R93B 2MJ8A 5IYDH 4JI8Q 3A56A 1ONLA 4XT3B 1VQJA 2N78A 1E2WA 4BBRG 2D2CC 2N8NA 1MGSA 3MEFA 4BBSB 2K5WA 3BVGA 4JI0L 1F3ZA 2WACA 3VYUA 2KQ3A 3HOUB 2MO1A 4A3KB 1MKHA 4DAPA 1B44D 3MFYA 1E24A 2EY5A 1C48A 3KLRA 5IYBH 3S2DH 2K50A 3LWUA 4LF5Q 3DXJC 4HSPA 1GHKA 1IBLQ 5DLQE 5DM63 3R3OA 3A7LA 2EJMA 3TQYA 3BG3A 3VR4A 1JJCB 2ENBA 3I4MG 5C3EH 1CK1A 2EJFC 4C3HG 3K58A 2XWJB 1Y1WG 3KJOA 3J80E 4EX5A 5EKIA 4A3JH 2JA8B 5BN3A 3PIPA 3CW2C 1ZKOA 2UUBL 1ESFA 1XPUA 1IKMA 3GTQH 2F0JA 3I4OA 2K7VA 3PO2H 1W2BA 1PTOC 2I46A 2EPBA 2CVRA 3GD7A 2IW3A 1HFGA 4IURA 4LFBQ 2E2JH 1UE7A 3K5MA 5JJZA 3UDGA 1CQVA 5JAVA 2A6ED 4K2KA 4QY7A 5J1ZA 5FLMG 1SJHD 3A55A 1KLUD 1BCPF 4O0AA 1SYCA 1EYCA 1EL0A 3K0XA 1TT2A 1NAPA 1HH2P 2LS01 2ID0A 1YZ6A 1XMQL 1Q86C 2WKCA 3GV3A 1RDPD 1I94Q 2NVTB 3MXPA 4A3FB 3ERSX 2XRSD 2H4OA 4R8IA 3FKIB 1PYSB 1O78A 5IP7H 4JI2Q 2WB1E 1BCPC 3KBGA 1HFNA 1PFMA 2EYPA 1QJOA 2B2VA 2EYLA 1U0LA 1G51A 4RH6A 2B0PA 5J39A 3SR1A 4IZ8A 4BXXH 2V4DA 5C5MA 2JEAI 4WRDA 4JOIA 4YY3L 4DV2L 2QA4A 3T1YQ 1FGUA 3D3RA 5IT9E 4UPAA 3QOJA 1CKNB 1XX8A 3PUWA 3J81j 1E1TA 1LYLA 5M3FG 1R9TH 1ILPA 4OWXB 5FK9C 5EBCA 1JB7A 3A5UA 4DV1Q 1CFMA 3STBD 2N3SA 1VF7A 1V9PA 2HUGA 2K01A 4O2DA 4DV3Q 2RHQB 3PF4A 4MN3A 3CPWA 4GLXA 1B3AA 2LSSA 3CCUA 1YVCA 1SE2A 2E8GA 2Z6BA 4N9PA 4K5WA 4B3ML 4TRDA 3OHXC 3TN2A 1GUNA 1STGA 1KC8C 4ZKBB 3PMFA 2SDFA 3OTOQ 1IKLA 3PGZA 1CI3M 1XJVA 1SAPA 2E2IB 5LMUQ 1JE4A 4N9TA 1VQAA 2F52A 1FJGL 1HZAA 4V0BA 2XNAC 2VQFQ 1TWGB 3CU7A 2B63B 4UHVA 4KN4C 1AFPA 4FYDA 4KY7A 1FD7D 3T51B 1GLDF 1O80A 1I3QH 4GOPB 3HOWG 5C4XB 4LAAA 4JBWA 2UXDL 1Z9FA 2J7ZA 2VNUD 5A2QE 2MHVA 4NMZA 4X3SA 4IPDA 5KYIA 2VY3A 3NEMA 1WI5A 4B3RQ 1KDBA 1Q90A 5CBEE 5C44H 2AUKA 4L6TB 3J80c 2HHHL 2XWBB 3TS2A 5JEAH 2J4XA 2LMCB 1YEZA 3E6ZX 4C3JH 4OO1H 1I4GA 1HRJA 3CSQA 3TP8A 2CH4W 3KUPA 4DR4Q 1F9PA 1KHIA 5IP9H 4A3CH 1O7LA 1DGSA 2BDOA 5M3MH 3GTJH 1PH2A 1K0SA 1H9SA 1JT8A 1SE8A 3QG1A 1N33Q 1S5DD 2B8FA 1PHJA 4FVMA 2KCMA 4DV4L 4J1MA 1KDAA 1TWHB 1PZJD 1QG7A 3X3NA 3RN5A 3H3VI 3J7ZC 2B39A 1A62A 4DNRB 2ZM6Q 3BZCA 4IUVA 4RGMA 1U4RA 1QUQB 1PTOH 2C5CA 3PIO3 1NMGA 2UXCQ 1N9WA 4K5VA 2ZXRA 3KLSA 5BR8Q 1K8GA 2UUAL 2N49A 2I5MX 3CRKC 3MFGA 1S3OA 1SYEA 1VF5C 4L63B 5IE8A 2I0QA 4OWTB 5LL6S 1RJTA 1JJGA 4DK6C 3PUZA 2XIWA 1TY0A 5K36H 1T5XD 5EGTA 3SK4A 1A3TA 3B6YA 1AW7A 2LY7A 1XNQL 3BDCA 1TIID 3NQTA 2D0OA 2R61A 4L5SA 3AEVA 1UAPA 2A8VA 5KNCA 1GD7A 4GKKL 4DV0L 2XTIA 1FNUA 4F8MA 4QGUA 4FXDA 1LTBD 1SYFA 1H9JA 3E3XA 3MWYW 1K9MC 3V96A 4RNZA 4DNIA 1YJNA 4BY7H 1OXVA 1CA5A 3S14H 2M00A 1N8RC 2PI2A 4LF8L 2Q2UA 4JI5Q 1A8VA 4IPCA 1EWCA 4APVA 3GV6A 2I5HA 3TBIB 4FXKC 1IYUA 2NB0A 1RTOA 1JQYD 1M1KC 3Q24A 1MD2D 2WAQG 2K28A 3W1GA 1V1PA 3A5ZB 4GKJQ 4XQJA 3K8AA 2BE5C 3K6OA 2R7ZB 1O2FA 4CGYB 1EY6A 4KLKA 1TY2A 5E1FA 3E0EA 2B2WC 3CCRA 4C2MH 4H13C 1UE1A 4U673 3QIAA 2EYHA 5IY0A 3M4OH 4LXCA 3ND9A 4QIWE 4A3CG 1Q12A 4DFAA 4BH5A 1HQRD 5FOBB 3DWPA 1F2ZA 2PW5A 3U58A 4LF6Q 1HA5A 3G71A 2LFNA 2ATWA 3UDXA 1P8LA 4IUUA 4JI6L 4C3IB 4ZUIA 2RSOA 1HA6A 3CCJA 5C0XJ 4DR3L 4J15A 5C3XA 2AKWB 4KN7C 1GHJA 3VR3A 4BBSH 1X3PA 3RZOH 1PH5A 4GOPC 4HSVA 3HOUH 3W2DA 1GUWA 3K5NA 1CKMA 1YHAA 3QO2A 4A3KH 3HOWB 1LO5D 5KEEA 2K4KA 1OXTA 2JEBI 1AN8A 4NXMQ 1TQOA 4IUNA 5ELFA 3SXHA 1GO3E 1A15A 4DR6Q 4DN4M 1JWMD 3UE0A 1HJPA 1PRTC 4HCSA 3M85A 3HOZB 1CHPD 1BNZA 2E2DC 4LJZC 3KLSX 4RWSC 4J8QA 1PFNA 2CW0C 4RG1A 4DAYA 3PIOA 2ZTCA 4A75A 4RKBA 4LF7L 2E5LQ 4IALA 3D4DA 5IYCG 4HJ5A 4I7AA 1KRSA 1Y1VH 4DK0A 1SYDA 1D8LA 4JI1L 3MA2B 1DOMA 3FRPB 2JA8H 1EQTA 5D65A 2Z4IA 1HTLD 2VUMB 3PUVA 4ZRZA 4JI8L 4JYAL 3T53B 1L0WA 5CORA 1ET6A 2KVMA 2VW9A 2OCEA 2KOLA 3S1MB 4ZCKA 1SXTA 3E5SA 2BDNA 3JAME 2Y0SG 1MJEA 1TWCB 2NN6H 3NHHA 1HZ9A 1I4XA 1DONA 4FDBA 1TWAB 2KEDA 3K57A 2EJGC 5C5LA 3NYYA 2Y0SE 5IODA 2HD3A 1STAA 1K8AC 4LF5L 1EUJA 5CMDA 3A74A 1IBLL 3GO5A 2UXBQ 1SYBA 2CQAA 2NVTH 1FNVA 4HJ7A 1JR0D 4A3FH 4G4KA 2GVAA 1CKNA 2LKVA 3AFPA 3FKIH 1DM0B 5NUCA 3C2PA 3N52A 2OT2A 1BBWA 4LFCL 1K8OA 3PV0A 1G2TA 1CQFA 1EWIA 1X65A 4JV5Q 2DGYA 3X3MA 1X3QA 2PCFB 3GTGB 5H1SE 4GN4B 3M4QA 1IW7C 1U4LA 1IBKQ 1I4QA 2K5QA 5G3LF 4A3GG 3CCSA 1ASYA 4KD3A 2B2WA 5ELDA 3J81E 4ZAIA 4ZUJA 4X65Q 2IHEA 4R8NA 3AU7A 1OTCA 1SMYD 4MHEA 4JBJA 3CCQA 1XNRL 5ELCA 1X54A 3HOVG 2KCTA 3GTLH 3Q6SA 3I4NH 3TP5A 5FLXE 1WCMH 3G4SA 3VA7A 4KMUC 5JPMC 2WAQB 2EY1A 4TKOB 3D8GA 3QB3A 5M5YB 1CZGA 1IL8A 1PV4A 2TSSA 1XWEA 1SNCA 1PA6A 2JA7H 2BH8A 1DOKA 2G9HD 4S3SA 4DF7A 1WTWA 1PH9A 2E2IH 4X64L 1DZ1A 3RR5A 4HN7A 2IX3A 2KENA 1TWGH 4DXGA 2JA5H 4KHPQ 5DEHA 2L55A 4O42A 4GLAC 4KTAA 1TS2A 3PO3G 5C4XH 2F0EA 2EXDA 2R7DA 4X3TA 2JSOA 4B08A 4A4IA 2DUDA
chains in the Genus database with same CATH topology
3A7AB 2F3VA 3T56B 3HOXB 1WTOA 3CQZB 1EFID 4BWGB 1ILQA 4OHJA 1JOQA 2F0KA 2YYZA 1I6HB 1BCPB 1SNMA 1RKNA 1UEAB 2NTSA 1GLAF 1QNKA 2IX1A 2HSIA 3M4YA 1LV9A 2FFKB 2F0PA 4A3BB 1EEID 2Z8LA 1D6EC 1D5ZC 2O2LD 3H09A 3BZDB 3TP6A 3GTKB 2B2YA 2RBMA 4FO2A 3S2HB 1EY5A 1TVXA 1JB3A 2B2VC 2IPKD 4IFDH 2K05A 2A6HC 4M1UB 4RGTA 4NP5A 2F0IA 1HPCA 3SK8A 5CYUA 2A5HA 2Q8RE 1LABA 1J9OA 1CM9A 2OXPA 3HRZC 4HAEA 4OO1I 1RF2D 5IGCA 1NR2A 1V1PB 2SOBA 2A69C 3FEWX 3I8ZA 1L0XB 5IGGA 4PMBA 2QILA 1L0YB 2TMPA 3T13A 2VB2X 1SSOA 1JWUD 5HGTA 2JXMB 4ZYSA 2YU9B 4WFN3 3OMGA 3FMCA 1D5XC 3H0GB 3M7GA 3E0JA 1YNJC 2NBFA 2B8GA 5AFWA 4XXEA 3D4RA 4C1NK 2WV6D 5J22A 1U4PA 3HOYB 3EA6A 3NE5B 4A3MB 5KNDA 4XT1B 3GTPB 3HOVB 1D1KA 1M4VA 1UUPA 1BUVT 1VMPA 4K2LA 3O13A 1WD0A 3OMCA 1ESRA 4RGNA 1FR3A 2AQ2B 3HS0C 5TSSA 1ENAA 5D3IB 3U9OA 4CJ0B 1LACA 2L4NA 1H9MA 3SLUA 1JOOA 2QCPX 1PFBA 2F1MA 5M5XB 3VR5A 4KY5A 2PNRC 5IIFA 2EY6A 2JE6I 3NTIA 1STBA 4Z9CB 3CRLC 1RCVD 4U68A 4K5XA 3WOFA 4E6IA 1LTTD 2DY8A 4IUTA 4UAIA 3D6WA 2KCNA 1E2ZA 1F9SA 1EU4A 3DWQA 4A93B 2GU1A 5C0XI 3S1QB 3GTMB 3TDQA 3L7ZC 1S5CD 1WTQA 5I4DA 2PZWA 2F0TA 3C3LA 3BS1A 5HURA 1PTOD 1B9NA 3KBXA 2DNCA 1O7ZA 2MPMA 1HCZA 1G2SA 1G91A 2F03A 3M3YB 3BVMA 5CV8A 5T1IA 4KKTA 3RMHA 2A74C 1GJXA 1I4PA 3GTOB 5E4WC 2B44A 4A3IB 5CV7A 1ET9A 3H94A 1BBXC 1Q8IA 2QDBA 3L9AX 3VYRA 3QOLA 1MI2A 1B53A 1B9MA 4BBRB 3HZXA 1S5FD 2B2TA 1EQVA 5LHY1 1LTAD 4RA8A 1PRTB 4QMGA 3J7AF 2NN6I 4QUCA 4CHTB 1KNEA 2F3WA 5D3DA 3I4MB 3A54A 4KKSA 1G6ZA 4H0LC 2EOTA 4C3HB 1PZKD 1Y1WB 2SNSA 2L11A 3NBIA 1QCBD 2RA4A 4TSSA 3MC0B 1SNDA 3NUCA 3QJYA 5JVH3 2EYJA 3MXNA 3DEPA 4MIUA 1LT5D 1I6VC 3PUYA 4HCEA 2F0FA 2K33A 2E74C 3I73A 1LTRD 4EQPA 1A2TA 1GOZA 5CV4A 2WB1B 2RDFA 1LTSD 1Y69U 1T5EA 2ICEC 1JC7A 4XYOA 2KCCA 1WTPA 1KDCA 3K5OA 3ERQA 1LLRD 1TS5A 5KYLA 2A73B 2NVYB 4V190 5CC4A 3OIQA 1PLFA 1STEA 1I50B 4HMIA 1BDOA 5M3FB 5F2DA 3D6CA 3BDOA 4EVOA 2OF1A 4QP5A 1MBYA 3TZDA 3ONAB 5JEAG 3K59A 3D31A 4C3JG 4OO1G 1ICWA 3S2DB 1GUSA 4Q0FA 1Y8PB 4G7OC 5C0XH 1HUMA 2IJ0A 1S5ED 3V05A 3ITPA 3AMUA 1OO9B 2DN8A 5IGEA 3ND8A 3HP3A 1GGRA 2HCIA 3EQLC 3CKIB 1TS4A 2ZXPA 5ELBA 1WTXA 1LTGD 1EYDA 3GTQB 1E0BA 3PO2B 4EQOA 2AQ3B 1XXGA 2A68C 3KK7A 4KD4A 4ILWA 5K36G 4IFDI 2E75C 1F2LA 1C4QA 1WD1A 5EKKA 3NP8A 2O5IC 1JCKB 4IQZA 5LL6X 2BE5D 3SVMA 3IAYA 4RHRA 2JP1A 4RCOA 1WTVA 1M8AA 5I9OA 2FINB 4RCNA 1W6JA 5CV5A 1KTKA 5EPKA 3VA5A 4ABNA 1PMRA 3VYSA 4G7ZC 2AWNA 4F88A 2MP0B 3GQBA 1SJED 4YIJA 1A6XA 2GPRA 1R9TB 4BA2I 2R6GA 2B2YC 3C1FA 3FPUB 2EYFA 1MSHA 1QILA 3OPOA 4TQUS 1BQQT 4QCLA 1BXTA 2RVLA 1ZYRC 1EOTA 5EJWA 1PRTD 2XVSA 4DNTB 3K0YA 4ODGA 2CW0D 3SDZA 4G57A 3W3AA 5I6YA 2O4XA 3IT7A 4RNYA 5EQ0A 2HDMA 4LMQD 2F4IA 1XYIA 4KHZA 4PNYA 1VMCA 1AX3A 1EY0A 2BOSA 2R3ZA 3R2IA 3NWSA 1Q3LA 1BO0A 1F9QA 4QIWB 1JOKA 3NTKA 1Z6HA 2RDHA 2F0OA 2MGSA 1B2TA 4CKCA 2IT1A 1F77A 3GTJB 4R9WA 4K8IA 2WINB 2VB3X 4G7HC 2KEEA 2NZ1D 1YNNC 2QKIC 1H9RA 5IGFA 1FNWA 3J80L 4IN3A 4RHSA 1UNSA 2K6AA 3D4WA 4KV6A 4OIKA 1K83B 1IW7D 2NN6G 2NVQB 3MAQA 4BA1I 1LT4D 4DA2A 4I7ZC 5KGUA 3UI2A 3A8JE 4KJOA 2VXWA 3SK5A 1QE6A 5IOCA 3DM1A 3R2TA 2FMCA 4M8AA 5K5PA 3AB9A 3DEOA 1SBBB 5I2YA 3OWEB 2HQEA 5CV9A 4C56C 2KUMA 4BY7B 3T16A 4KKUA 4XIGS 2HCCA 5DM73 2EXZA 4FP5D 1DXMA 4CJ1B 2Y0SB 5IT9L 1R4PB 4J6HA 5KIXA 3BYTB 3EROA 1J8IA 1LTID 1D1IA 3TMEA 3QWNA 4JBWM 2QEJC 4WJWA 2G9DA 4PMWA 3I4LA 3IFDA 2C9OA 2CHBD 5EKLA 2E76C 1QWYA 1CZWA 4ULLA 3MVVA 4NDXA 2PQEA 1TR5A 3HG9A 3OWFA 5C4HA 2EVBA 4F7XA 2MP1A 2PYKA 1BR9A 2BA0A 1H9KA 5ISRA 2F0WA 1B50A 2F0HA 5IGBA 3RZDB 1ENFA 3MXUA 2L0CA 2PZUA 3NBHA 4A3GB 4CBVA 3NTHA 2A6EC 3SEBA 2E2HB 5BN4A 2L5TA 1ENCA 3RZOB 2PPBC 3HGBA 5DAUA 1OXSC 4CKEA 3URYA 2A6HD 5A2QL 2B2TC 2L1BA 3FPPA 4CJ2C 1RODA 2WKDA 1F2YA 2XSCA 1EWHA 3M7NA 1CHQD 2RDGA 4P2CB 2DY7A 1K8MA 4IUPA 3OIPA 3C46A 2I07B 1PTOF 2A69D 1DCZA 1QB5D 2KA7A 1Y1VB 2N55A 2DNEA 4QF4A 4FF4A 4KHVA 1O7YA 1B4OA 3PO3B 2IWHA 3P7JA 4K6LA 1B1ZA 4ZK9B 4IFDG 4K14A 5IGDA 1WVLA 1U4MA 1YNJD 1F9RA 1NSNS 2K32A 2EZVA 3L3OC 1EY7A 5KVPA 3R8BA 3G6JB 5T1GA 5FO8B 3NPPA 2KHSA 5COYA 4FXGC 4CKBA 4B9XA 1LT6D 2PZTA 1D5MC 3RUZA 4KY6A 3I70A 1RD9D 1SEBD 1IHZA 1SNQA 2JA6B 1AP0A 1KAAA 5A35A 3MHBA 3EFXD 3C1EA 3H91A 3SE0A 2D9UA 5E4XA 2PMZB 2AWOA 3TZUA 1PZID 2NUCA 4FF3A 3WOEA 4RFBA 4B9WA 5FO9B 4Q5VA 3BDLA 5E3FA 2B2UA 1V8QA 3GTLB 3I4NB 4PV1C 1GLEF 2FJ2A 1WCMB 3NSWA 3SK6A 2F3GA 1Y8NB 2X6GA 4QB4A 1BCPD 3Q23A 2JA7B 2NTTA 2O5JC 2M9VA 4BY1B 4KK7A 1HQMC 4PMCA 4C3IG 4HR7B 2F0GA 3TP7A 2JA5B 3Q0AA 1HHVA 1CT1D 2KJXA 1W6KA 3I91A 1Q1EA 5C4JB 4Y7NB 2D62A 5KNBA 4DXFA 1Z7TA 3I90A 1F3GA 2BA1A 2FHTA 2PW7A 4JK1C 3OOCA 2WP8J 3KF8A 1SE3A 3K7AB 2AQ1B 3HKZB 3LNNA 3P1HA 1ZEQX 4WORA 2PO4A 2F0NA 3FDTA 1FGBD 5JEAJ 3S1RB 4EGVA 1STYA 4X3UA 5C6AA 4O1NA 4IUQA 3MTSA 3P75A 4F87A 2K03A 4H7BA 5JVG3 5CBAE 1A3UA 4HEDA 1XTCD 2R92B 3A8IE 1II3A 3P20A 3JAML 1E2VA 2ICIA 4DGZA 2N88A 1KNAA 1HTPA 3S16B 3S17B 4A3EB 4C1NI 1SNOA 1PXUA 4DU9A 2Q8IB 1GLBF 5JPNC 1VCIA 1GLCF 3H3VC 4DAVA 2L9HA 1JORA 2XN9C 3NK9A 1C8CA 3R93A 4KI0A 1SDFA 3OSOA 4HTHA 1G8ZD 1AZQA 3F2UA 2BCOA 1V1OA 3N6RA 1DOLA 2FMMA 3HEJA 1CA6A 1EEFD 3J81L 2EE1A 3J7AV 3UZ0B 1S4ZA 4XQQA 1DJRD 1Q1BA 2KECA 5I9PA 5DNFA 1BOSA 1DYQA 1GUTA 2NWGA 1A3VA 1SYGA 5FLXL 1EZ6A 5C3EB 1QOHA 3RD4A 4KJNA 2F0QA 2K04A 3EJIA 1QNUA 5D14A 2NYZD 4I65A 2F0VA 2HDLA 2QF7A 3ZYYX 4A3JB 1TWFB 3IT5A 1SNPA 1JWSD 1VDZA 1EIHA 2XRQD 4HMJA 4DK1A 2B13A 2SEBD 3MEHA 3V2TA 4QPBA 5FKAC 1TS3A 1HUNA 4GZYC 1HXYD 3K5LA 2RQXA 2NVXB 1NUCA 4XDXA 5I2XA 4EQNA 3NXWA 2E2JB 1PYWD 3BVZA 4FF1A 1NR4A 2F0SA 3NWTA 2EY2A 1PRTF 4H44C 3PUXA 4L8JA 2F0LA 3H6MA 1FYCA 2EYOA 2RSNA 5ELEA 4UDUC 4NKLA 4XYQA 4OL7A 1PDQA 1A2UA 1EY4A 2EYMA 4AYBB 3RLFA 1EY9A 1V43A 3A8KE 3U9SA 4ME5A 3I72A 2IX0A 4OIJA 1MSGA 3T4AC 4BS9A 1SMYC 1G291 1EZ8A 1R4QB 4LK1C 4RKLA 5B0HA 2L12A 3Q22A 1NCVA 1GUGA 1GXDC 3VYTA 2A68D 2GA4B 4XQNA 5C0XG 2JYOA 5M9OA 3MZ5A 3S9WA 1STHA 1WTRA 3S15B 4ZQ3A 2Z4HA 3I3CA 3DMUA 2MUYA 2OEOA 1AZPA 1KLGD 1SE4A 3IL8A 1CTMA 2X69A 1RTNA 5CGKA 3WDNA 3J7YW 1I3QB 4FF2A 5M5WB 5CV6A 3DWAA 5I6WA 1ZXTA 5FO7B 4A3DB 1LT3D 5C44B 4C3JB 3DHQA 1RHPA 1S5BD 2M2LA 4ZLTF 1Z47A 5M3MB 4ZYBA 1GUOA 1ZYRD 1TU2B 4OGQC 5KRUA 4K6DA 2WIIB 1F2MA 3GP7A 3IFTA 1KABA 2EDGA 1I4RA 1PTOB 3LWEA 4XTCS 1H9SB 5EPJA 4QUFA 1X32A 2AUJD 1BF4A 3OW7A 3OURB 1TKWB 2D5DA 3PIP3 2ZT9C 1OXUA 5CR3A 1I4HA 5C4ZA 3TUFB 1U9RA 5BN5A 5G3LD 3TSSA 1AEXA 4ZKCB 1STNA 1IYVA 1DD2A 3LX0A 2J0TD 3VR2A 2H1EA 3IKJA 3EVQA 5EPLA 2RKSA 2X6LA 3SHLA 2ZXOA 1GPRA 3S14B 1D2BA 1EYAA 4RGOS 3NQIA 1YNND 2K5DA 2Z1CA 3CHBD 3MXGA 5EBDA 3DUZA 3BYYB 2F0MA 3FVQA 2K1BA 2F0DA 2SNMA 3S1NB 3VR6A 4RAUC 1EIGA 4K8JA 1EU3A 1SFOB 1EY8A 4ID6A 2F0UA 4FNFA 4C2MB 1ML0D 3M4OB 4X3KA 1JICA 2Q8TA 4NW2A 4IFDJ 1OXXK 4PQXA 5JOBA 2IL8A 5C3WA 1Y8OB 3G7LA 2B2UC 2R93B 2MJ8A 3A56A 1ONLA 4XT3B 1E2WA 2D2CC 1MGSA 4BBSB 2K5WA 3BVGA 1F3ZA 2WACA 3VYUA 2KQ3A 3HOUB 4A3KB 4DAPA 1B44D 3MFYA 2EY5A 1C48A 3KLRA 3LWUA 3DXJC 4HSPA 1GHKA 5DM63 3R3OA 3A7LA 2EJMA 3BG3A 3VR4A 2ENBA 1CK1A 2EJFC 4C3HG 3K58A 2XWJB 3J80E 5EKIA 2JA8B 5BN3A 1ZKOA 1ESFA 1IKMA 2F0JA 2K7VA 1PTOC 2I46A 2EPBA 2CVRA 3GD7A 2IW3A 1HFGA 4IURA 3K5MA 5JJZA 1CQVA 5JAVA 2A6ED 4K2KA 5J1ZA 1SJHD 3A55A 1KLUD 1BCPF 1SYCA 1EYCA 1EL0A 1TT2A 1NAPA 2LS01 2ID0A 2WKCA 3GV3A 1RDPD 2NVTB 3MXPA 4A3FB 2XRSD 2H4OA 4R8IA 3FKIB 1O78A 1BCPC 3KBGA 1HFNA 1PFMA 2EYPA 1QJOA 2B2VA 2EYLA 4RH6A 2B0PA 5J39A 3SR1A 4IZ8A 2V4DA 5C5MA 2JEAI 4WRDA 3D3RA 5IT9E 3QOJA 1XX8A 3PUWA 1ILPA 5FK9C 5EBCA 1CFMA 1VF7A 2HUGA 2K01A 4MN3A 1B3AA 1SE2A 4N9PA 4K5WA 4TRDA 3OHXC 3TN2A 1GUNA 1STGA 4ZKBB 3PMFA 2SDFA 1IKLA 1CI3M 1SAPA 2E2IB 1JE4A 4N9TA 4V0BA 2XNAC 1TWGB 3CU7A 2B63B 4KN4C 1AFPA 4FYDA 4KY7A 1FD7D 3T51B 1GLDF 1O80A 5C4XB 4LAAA 4JBWA 2J7ZA 2VNUD 5A2QE 2MHVA 4NMZA 4X3SA 5KYIA 1KDBA 1Q90A 5CBEE 2AUKA 4L6TB 2XWBB 5JEAH 2J4XA 2LMCB 3E6ZX 4OO1H 1I4GA 1HRJA 3CSQA 3TP8A 3KUPA 1F9PA 1O7LA 2BDOA 1H9SA 3QG1A 1S5DD 2B8FA 4FVMA 4J1MA 1KDAA 1TWHB 1PZJD 1QG7A 3X3NA 2B39A 4DNRB 4IUVA 4RGMA 1U4RA 1PTOH 2C5CA 3PIO3 4K5VA 2ZXRA 3KLSA 3CRKC 3MFGA 1SYEA 1VF5C 4L63B 5LL6S 1RJTA 3PUZA 2XIWA 1TY0A 5K36H 1T5XD 5EGTA 3SK4A 1A3TA 1AW7A 2LY7A 3BDCA 1TIID 3NQTA 2R61A 1UAPA 5KNCA 1FNUA 4F8MA 4FXDA 1LTBD 1SYFA 1H9JA 3MWYW 3V96A 4RNZA 1OXVA 1CA5A 2M00A 1EWCA 3GV6A 3TBIB 4FXKC 1IYUA 2NB0A 1RTOA 1JQYD 3Q24A 1MD2D 2K28A 1V1PA 4XQJA 2BE5C 3K6OA 2R7ZB 1O2FA 4CGYB 1EY6A 1TY2A 5E1FA 2B2WC 4U673 4H13C 4LXCA 3QIAA 2EYHA 3ND9A 1Q12A 4DFAA 4BH5A 1HQRD 5FOBB 3DWPA 1F2ZA 2PW5A 1HA5A 2LFNA 4IUUA 4C3IB 4ZUIA 2RSOA 1HA6A 5C0XJ 5C3XA 4KN7C 1GHJA 3VR3A 1X3PA 4HSVA 1GUWA 3W2DA 3K5NA 3QO2A 3HOWB 1LO5D 5KEEA 1OXTA 2JEBI 1AN8A 1TQOA 4IUNA 5ELFA 3SXHA 1A15A 4DN4M 1JWMD 1PRTC 4HCSA 3M85A 3HOZB 1CHPD 1BNZA 2E2DC 4LJZC 3KLSX 4RWSC 4J8QA 1PFNA 2CW0C 4DAYA 4RKBA 4IALA 3D4DA 4DK0A 1SYDA 3MA2B 1DOMA 3FRPB 1EQTA 5D65A 2Z4IA 1HTLD 2VUMB 3PUVA 4ZRZA 3T53B 5CORA 1ET6A 2KVMA 2KOLA 3S1MB 1SXTA 3E5SA 2BDNA 3JAME 1TWCB 2NN6H 3NHHA 1I4XA 1DONA 1TWAB 2KEDA 3K57A 2EJGC 5C5LA 3NYYA 5IODA 1STAA 5CMDA 3GO5A 1SYBA 2CQAA 1FNVA 1JR0D 4G4KA 2LKVA 1DM0B 5NUCA 3C2PA 3N52A 2OT2A 1K8OA 3PV0A 1G2TA 1CQFA 3X3MA 1X3QA 2PCFB 3GTGB 1IW7C 1U4LA 1I4QA 2K5QA 5G3LF 4KD3A 2B2WA 5ELDA 3J81E 4ZAIA 4ZUJA 4R8NA 3AU7A 1SMYD 4MHEA 5ELCA 3Q6SA 3TP5A 5FLXE 3VA7A 4KMUC 5JPMC 2WAQB 2EY1A 4TKOB 3D8GA 3QB3A 5M5YB 1CZGA 1IL8A 2TSSA 1XWEA 1SNCA 1DOKA 2G9HD 4S3SA 4DF7A 1WTWA 1DZ1A 4HN7A 2IX3A 4DXGA 5DEHA 2L55A 4O42A 4KTAA 1TS2A 2F0EA 4X3TA 2JSOA 4B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU1 A;  3IT7 A;  1GPR A;  4LXC A;  4RNY A;  3UZ0 B;  1GGR A;  3IT5 A;  1F3G A;  1F3Z A;  3SLU A;  1AX3 A;  4BH5 A;  5KVP A;  2B13 A;  2MP0 B;  3NYY A;  4QPB A;  4ZYB A;  3OUR B;  4RNZ A;  2B0P A;  2GPR A;  4QP5 A;  5B0H A;  1GLE F;  1GLB F;  1GLA F;  1GLC F;  4JBW M;  2HSI A;  3CSQ A;  1O2F A;  2B44 A;  3TUF B;  2F3G A;  1GLD F;  1QWY A; 
#chains in the Genus database with same CATH topology
 4P73 A;  3A7A B;  2F3I A;  2F3V A;  3T56 B;  4UY8 C;  2K75 A;  3HOX B;  1WTO A;  1HNZ L;  3CQZ B;  2H5X A;  1EFI D;  4BWG B;  2CH4 A;  1ILQ A;  4OHJ A;  2V1C C;  1JOQ A;  2GVB A;  2F0K A;  2YYZ A;  1I6H B;  1BCP B;  1Q7Y C;  4UP9 A;  3CC4 A;  3MXN B;  1SNM A;  1RKN A;  1UEA B;  2NTS A;  3HFZ B;  1GLA F;  1QNK A;  1SMX A;  2IX1 A;  2HSI A;  1BBU A;  3M4Y A;  3U4V A;  1LV9 A;  4LF4 Q;  2FFK B;  4IOC A;  3OTO L;  5GRO A;  3S1R H;  4LF9 L;  2F0P A;  1K73 C;  1VQP A;  1TWH H;  4A3B B;  1EEI D;  2Z8L A;  1D6E C;  1D5Z C;  2O2L D;  3H09 A;  3BZD B;  3TP6 A;  2VQF L;  3GTK B;  2JA6 G;  2B2Y A;  2RBM A;  3KJP A;  4NXN Q;  4FO2 A;  3S2H B;  1EY5 A;  1TVX A;  1JB3 A;  2B2V C;  2IPK D;  4IFD H;  2K05 A;  2A6H C;  4DPG A;  4M1U B;  2VQE Q;  4AQY L;  4RGT A;  3UDI A;  4NP5 A;  1A63 A;  3I55 A;  4DR1 Q;  2F0I A;  3S17 H;  4A3E H;  3J81 i;  2EQS A;  2PMZ E;  1HPC A;  1IZ6 A;  3SK8 A;  1C7Y A;  2RF4 A;  5CYU A;  2A5H A;  5IWA Q;  3I4N G;  2Q8R E;  1LAB A;  1J9O A;  1CM9 A;  2OXP A;  1XPR A;  3HRZ C;  2HIX A;  4HAE A;  3J81 c;  1RF2 D;  5IGC A;  4OO1 I;  3M9B A;  1NR2 A;  1V1P B;  2SOB A;  2A69 C;  3FEW X;  3I8Z A;  3PF5 A;  1L0X B;  5IGG A;  2OTJ A;  4PMB A;  2QIL A;  1L0Y B;  2TMP A;  1WFQ A;  1PH7 A;  4K0K Q;  3T13 A;  4BY1 G;  4DV5 Q;  2VB2 X;  1SSO A;  1JWU D;  5HGT A;  2JXM B;  4ZYS A;  2YU9 B;  2D0P A;  4WFN 3;  3OMG A;  2ZM6 L;  3FMC A;  1D5X C;  3H0G B;  3M7G A;  1X56 A;  3E0J A;  1YNJ C;  2NBF A;  5LMN Q;  2UXC L;  1KXL A;  2B8G A;  4GN3 B;  4B3T Q;  5BR8 L;  5AFW A;  4XXE A;  3D4R A;  4C1N K;  1PH6 A;  2WV6 D;  4AH6 A;  5J22 A;  1U4P A;  3HOY B;  5ELO A;  3EA6 A;  3NEL A;  4PZ6 A;  1NBW A;  1QZH A;  3NE5 B;  2AHO B;  4A3M B;  1KAW A;  3CME A;  5KND A;  4XT1 B;  3GTP B;  3F8T A;  2R7Z H;  3HOV B;  1GVP A;  1D1K A;  1JJ2 A;  1M4V A;  4B3S L;  1UUP A;  1BUV T;  1VMP A;  3HKZ G;  3O13 A;  4K2L A;  3W5O A;  4Y52 H;  1YBY A;  1WD0 A;  3OMC A;  3BZK A;  1ESR A;  4RGN A;  4DR7 L;  1TWF H;  1FR3 A;  2AQ2 B;  3HS0 C;  5TSS A;  4TVA B;  1ENA A;  3HKZ E;  5D3I B;  3U9O A;  4DR5 Q;  4CJ0 B;  1LAC A;  2L4N A;  1YHB A;  1H9M A;  3SLU A;  5HGQ A;  4C3I H;  4DAY B;  2NVX H;  1IL2 A;  3ULP A;  1JOO A;  2QCP X;  1PFB A;  2F1M A;  2ZTD A;  5M5X B;  1EIY B;  3VR5 A;  4KY5 A;  2VS1 A;  4PZ8 A;  4JI5 L;  2PNR C;  1N34 Q;  4A3L H;  5IIF A;  2EY6 A;  2JE6 I;  4GNX C;  2R92 G;  2CFM A;  3NTI A;  1STB A;  1N36 Q;  2WB1 G;  1BKB A;  4Z9C B;  3CRL C;  1RCV D;  4U68 A;  5LMN W;  2CQO A;  4K5X A;  3WOF A;  4E6I A;  1LTT D;  4JI3 L;  2DY8 A;  2QEX A;  4IUT A;  4UAI A;  3D6W A;  2RHS B;  3HOZ H;  2KCN A;  1E2Z A;  1LTL A;  1M90 C;  1J5E Q;  4R1J A;  5FJ8 G;  1F9S A;  1EU4 A;  3DWQ A;  4A93 B;  2GU1 A;  5IYD G;  3DM3 A;  5C0X I;  3S1Q B;  3GTM B;  3TDQ A;  4DV6 L;  3L7Z C;  2VUM H;  4YHH L;  4HIM A;  1NE3 A;  1S5C D;  1VQ8 A;  1WTQ A;  5I4D A;  3S1M H;  2LXJ A;  2PZW A;  2F0T A;  1PH3 A;  4DUY Q;  2K5V A;  3C3L A;  1TWC H;  3BS1 A;  5HUR A;  1W3S A;  1PTO D;  1TWA H;  2ZJQ A;  4IJL A;  5IYB G;  1B9N A;  2UUC Q;  3KBX A;  3GDE A;  2DNC A;  1VQ4 A;  4QQB X;  1O7Z A;  2MPM A;  4DR6 L;  4CDF C;  1HCZ A;  1G2S A;  3S15 H;  1G91 A;  2F03 A;  3M3Y B;  3FP9 A;  3BVM A;  5CV8 A;  2RCN A;  5C3E G;  5T1I A;  4KKT A;  2OQK A;  3LGJ A;  3ULL A;  3RMH A;  4GLV B;  2A74 C;  1GJX A;  1I4P A;  3GTO B;  3EIV A;  5E4W C;  2B44 A;  4A3I B;  5CV7 A;  2A19 A;  1ET9 A;  3H94 A;  1BBX C;  1WOC A;  4A3J G;  1Q8I A;  4LFA Q;  2QDB A;  3L9A X;  3VYR A;  3QOL A;  5M5W H;  3F2B A;  3GTG H;  1MI2 A;  3J80 i;  3CXC A;  2KBN A;  1B53 A;  1B9M A;  3PO2 G;  4BBR B;  3HZX A;  1S5F D;  2B2T A;  1G6P A;  1Q46 A;  2HIV A;  2CCZ A;  4A3D H;  1EQV A;  4CDD C;  4X62 Q;  5LHY 1;  3WWV A;  2NZO A;  3ICE A;  4YWL A;  3T1H Q;  1LTA D;  4RA8 A;  4EQ5 A;  1PRT B;  4QMG A;  3J7A F;  2NN6 I;  1HR0 L;  4QUC A;  4CHT B;  1KNE A;  2VL6 A;  4JI4 L;  2F3W A;  4IO9 A;  4ALP A;  5M5Y H;  1SRU A;  3IRB A;  5D3D A;  3I4M B;  3A54 A;  1VQN A;  4KKS A;  1G6Z A;  5IP7 G;  4H0L C;  2EOT A;  4C3H B;  4GNX A;  1PZK D;  1Y1W B;  1TXY A;  1EFW A;  1RL2 A;  2SNS A;  2L11 A;  4UP7 A;  4BXX G;  4X66 L;  2CKZ B;  3NBI A;  1PH4 A;  1QCB D;  1HNW L;  2RA4 A;  4TSS A;  3MC0 B;  1SND A;  4AYB E;  3NUC A;  3QJY A;  3CP0 A;  1E1O A;  5JVH 3;  2EYJ A;  3MXN A;  3DEP A;  1CUK A;  1HZC A;  1YIT A;  1Y14 B;  4MIU A;  1LT5 D;  4NB3 A;  1X3F A;  4L5R C;  1I6V C;  3PUY A;  4HCE A;  2F0F A;  3CCE A;  2K33 A;  3RLN A;  2E74 C;  3HOX H;  1SRO A;  3I73 A;  4P74 A;  1LTR D;  1E22 A;  3PSI A;  4EQP A;  4IPG A;  2MQH A;  1A2T A;  5IT9 c;  1GOZ A;  5CV4 A;  4POG A;  2WB1 B;  2RDF A;  1I6H H;  1LTS D;  2OTL A;  3AYH B;  2KHJ A;  1Y69 U;  1T5E A;  2ICE C;  1X3G A;  2ZTE A;  1JC7 A;  4LUV A;  4DAM A;  2QW7 A;  4XYO A;  1K0R A;  2KCC A;  1WTP A;  5JJL A;  1KDC A;  1VQH A;  3K5O A;  3ERQ A;  1LLR D;  1TS5 A;  5KYL A;  2EIF A;  2JK8 A;  2A73 B;  3GTK H;  2UUB Q;  2NVY B;  2Z6K C;  4V19 0;  2PQA A;  3S2H H;  5CC4 A;  3OIQ A;  1PLF A;  5J3B A;  1STE A;  2I5L X;  1I50 B;  4HMI A;  1BDO A;  3E9I A;  5M3F B;  5F2D A;  3D6C A;  3S1N H;  3BDO A;  4A3D G;  4EVO A;  2OF1 A;  4QP5 A;  1MBY A;  2DJF C;  3TZD A;  5C44 G;  3ONA B;  1SFO H;  5JEA G;  2BH2 A;  3K59 A;  3D31 A;  4C3J G;  4OO1 G;  1ICW A;  4YWM A;  3S2D B;  1GUS A;  3NBH B;  4Q0F A;  1Y8P B;  2RCF A;  4DUZ L;  4G7O C;  5C0X H;  5IP9 G;  1HUM A;  1XMQ Q;  5M3M G;  1NNX A;  2IJ0 A;  1X9N A;  4CDE C;  1S5E D;  3V05 A;  3ITP A;  1XMO L;  2R93 H;  3AMU A;  1OO9 B;  2DN8 A;  5IGE A;  4LF4 L;  1RIP A;  3ND8 A;  4LUZ A;  3HP3 A;  1GGR A;  3S24 A;  2HCI A;  3EQL C;  4DV2 Q;  2YU9 H;  3CKI B;  1TS4 A;  2ZXP A;  5ELB A;  1WTX A;  3H0G H;  4IJH A;  1LTG D;  1EYD A;  2F4V L;  3GTQ B;  2P5Z X;  4P75 A;  1E0B A;  3PO2 B;  4EQO A;  4DKA C;  2AQ3 B;  4DR2 L;  1XXG A;  1EYG A;  2A68 C;  3KK7 A;  4KD4 A;  1IBM L;  2VQE L;  4ILW A;  2NZH A;  5K36 G;  3HOY H;  4IFD I;  2E75 C;  1U5K A;  1F2L A;  1PVO A;  1C4Q A;  1WD1 A;  5EKK A;  3NP8 A;  2O5I C;  1JCK B;  4B3M Q;  4IQZ A;  5LL6 X;  2BE5 D;  3SVM A;  3IAY A;  4RHR A;  2JP1 A;  1PFS A;  4PZ7 A;  3CCV A;  1N32 L;  4RCO A;  1WTV A;  1M8A A;  5I9O A;  2FIN B;  4RCN A;  1W6J A;  5CV5 A;  1FJG Q;  4BY7 G;  3I2Z A;  1KTK A;  5EPK A;  1BVS A;  3VA5 A;  4ABN A;  1PMR A;  1AH9 A;  3VYS A;  2ES2 A;  4G7Z C;  3CF5 A;  5M5X H;  2AWN A;  4CDC C;  4F88 A;  1QZG A;  2UXD Q;  2MP0 B;  3GQB A;  1Q8K A;  1SJE D;  4YIJ A;  3CAM A;  1A6X A;  3KF6 B;  4R4T A;  2GPR A;  1R9T B;  3K80 C;  4BA2 I;  2R6G A;  1VQI A;  2B2Y C;  3C1F A;  3FPU B;  2EYF A;  1MSH A;  1QIL A;  3OPO A;  4TQU S;  1EQR A;  2HHH Q;  1UWV A;  1QVF A;  1BQQ T;  4QCL A;  2KHI A;  1BXT A;  2Z6K A;  1KRT A;  2RVL A;  3J7A 5;  1ZYR C;  1EOT A;  5EJW A;  1CKO A;  2Q2H A;  1PRT D;  2XVS A;  2Q2T A;  4DNT B;  3K0Y A;  3OW2 A;  4ODG A;  1GM5 A;  3AQQ A;  2CW0 D;  3SDZ A;  4G57 A;  4DV4 Q;  1K3B C;  3S1Q H;  3W3A A;  5I6Y A;  3GTM H;  2MFI A;  1S40 A;  2O4X A;  3IT7 A;  4RNY A;  4BBS G;  5EQ0 A;  2HDM A;  4LMQ D;  2F4I A;  1XYI A;  4LFB L;  4KHZ A;  3HOU G;  1VQD A;  4PNY A;  1E3P A;  1QVC A;  1VMC A;  4A3K G;  1PH8 A;  1AX3 A;  1C9O A;  1EY0 A;  2PNH A;  2WFW A;  2UUA Q;  4OX9 Q;  2BOS A;  2R3Z A;  3R2I A;  3NWS A;  1PYB A;  1Q3L A;  1BO0 A;  1F9Q A;  2JA9 A;  4QIW B;  1JOK A;  3NTK A;  1I94 L;  3M3Y H;  1CSP A;  1Z6H A;  2RDH A;  2F0O A;  5GAH C;  1XNQ Q;  1VQM A;  2MGS A;  1B2T A;  4CKC A;  4JI2 L;  2IT1 A;  2B29 A;  1F77 A;  4GKK Q;  4DV0 Q;  3GTO H;  2MNA A;  3GTJ B;  2B63 H;  4ME3 A;  1Y1V G;  4K8I A;  4R9W A;  3I56 A;  3ER0 A;  2WIN B;  2VB3 X;  3K7U C;  3UDF A;  3ULJ A;  4G7H C;  4A3I H;  2KEE A;  3I7F A;  3F2C A;  2JA8 G;  2NZ1 D;  1YNN C;  2QKI C;  4MNO A;  3T1Y L;  1H9R A;  1T9H A;  5IGF A;  1HR0 W;  4JBM A;  1FNW A;  3J80 L;  4IN3 A;  4RHS A;  4BBR H;  4GNX B;  4LF8 Q;  1UNS A;  2K6A A;  3D4W A;  4KV6 A;  3KDF A;  4OIK A;  4LW1 A;  1NTG A;  1K83 B;  5AJ3 Q;  2JQO A;  1IW7 D;  2NN6 G;  2OWO A;  4DV1 L;  2NVQ B;  2ALY B;  3MAQ A;  3NEN A;  3JAM i;  4DV3 L;  4BA1 I;  1MJC A;  1LT4 D;  4DA2 A;  3F1Z A;  4I7Z C;  5KGU A;  3CPF A;  1YNX A;  3UI2 A;  2YTY A;  3H15 A;  2L15 A;  3A8J E;  3CC2 A;  3HKS A;  3JAM c;  4KJO A;  2VXW A;  1O7I A;  4A3F G;  3SK5 A;  3I4M H;  3BU2 A;  1QE6 A;  3FKI G;  1EIF A;  5LMU L;  1SLJ A;  2LXK A;  5IOC A;  3DM1 A;  1Y1W H;  3R2T A;  2FMC A;  4M8A A;  5K5P A;  3AB9 A;  3DEO A;  3CMA A;  1SBB B;  2FXQ A;  5I2Y A;  3OWE B;  4JI6 Q;  2HQE A;  5CV9 A;  4C56 C;  1VQC A;  2KUM A;  4BY7 B;  3T16 A;  4JBK A;  4KKU A;  4XIG S;  2HCC A;  5DM7 3;  2EXZ A;  4FP5 D;  1DXM A;  4CJ1 B;  4OEL B;  2Y0S B;  3M4P A;  5IT9 L;  4B3R L;  1L1O C;  4GS3 A;  1R4P B;  4J6H A;  5KIX A;  5FLM H;  4MTN A;  2PQA B;  3BYT B;  3ERO A;  4UP8 A;  1J8I A;  1LTI D;  1WCM G;  1D1I A;  3TME A;  1QVG A;  3QWN A;  4DR4 L;  4JBW M;  2QEJ C;  4WJW A;  2G9D A;  4PMW A;  3I4L A;  3IFD A;  2C9O A;  2CHB D;  2ZJR A;  5EKL A;  2E76 C;  1QWY A;  1CZW A;  4ULL A;  2JA7 G;  3MVV A;  4NDX A;  2PQE A;  1N33 L;  1TR5 A;  3HG9 A;  3OWF A;  5C4H A;  2EVB A;  4F7X A;  2MP1 A;  2PYK A;  4LF7 Q;  1BR9 A;  2BA0 A;  5FLX c;  1XTD A;  1H9K A;  3CCM A;  5ISR A;  2F0W A;  1VQG A;  4H02 A;  2F0H A;  4JI1 Q;  5IGB A;  2JA5 G;  3RZD B;  1B50 A;  4HIK A;  1ENF A;  3MXU A;  2L0C A;  2NVY H;  4JYA Q;  2PZU A;  3NBH A;  5C4X G;  2ZJP A;  4A3G B;  4JW0 A;  4YWK A;  4CBV A;  3NTH A;  2A6E C;  3SEB A;  2E2H B;  1I50 H;  5BN4 A;  2L5T A;  1ENC A;  5M3F H;  1WTH A;  3RZO B;  2PPB C;  1VQE A;  3HGB A;  5DAU A;  1OXS C;  4CKE A;  3URY A;  2A6H D;  5A2Q L;  2K52 A;  2B2T C;  5GQO A;  2L1B A;  3FPP A;  3PCO B;  4CJ2 C;  1ROD A;  2WKD A;  1F2Y A;  2C35 B;  2XSC A;  1EWH A;  2VZA A;  3M7N A;  1CHQ D;  2RDG A;  4P2C B;  1LM0 A;  2DY7 A;  1K8M A;  4IUP A;  3OIP A;  3C46 A;  5L37 A;  2I07 B;  2OQ0 A;  1PTO F;  4LFC Q;  2A69 D;  1A0I A;  3OYY A;  1DCZ A;  1QB5 D;  2KA7 A;  4X6A H;  1Y1V B;  2N55 A;  2DNE A;  4QF4 A;  4FF4 A;  4KHV A;  1O7Y A;  1B4O A;  3ZJY C;  3PO3 B;  1MIU A;  3HOW H;  2IWH A;  3P7J A;  4K6L A;  3STB C;  1B1Z A;  4ZK9 B;  4IOA A;  4IFD G;  1FL0 A;  4K14 A;  5IGD A;  3TEH B;  1WVL A;  1U4M A;  1YNJ D;  2QDL A;  1F9R A;  1NSN S;  2K32 A;  2EZV A;  1UE6 A;  1EY7 A;  3L3O C;  5KVP A;  4A3E G;  2CWP A;  4GKJ L;  1I5F A;  3E9H A;  3R8B A;  1XNR Q;  3G6J B;  5T1G A;  5FO8 B;  2XGT A;  3NPP A;  2KHS A;  5COY A;  4FXG C;  1V1Q A;  2B3G A;  5JJK A;  4CKB A;  1VQB A;  1Q81 C;  1L1O A;  4B9X A;  3G6E A;  1LT6 D;  4LF6 L;  4N8X 1;  2JN4 A;  2PZT A;  1D5M C;  3KF6 A;  4X64 Q;  3RUZ A;  1HNX Q;  4KY6 A;  3I70 A;  1RD9 D;  1SEB D;  1IHZ A;  1SNQ A;  2JA6 B;  4YCU A;  4WJ4 A;  1AP0 A;  1KAA A;  5A35 A;  3MHB A;  3EFX D;  3C1E A;  3H91 A;  3SE0 A;  1YJW A;  3KLW A;  2D9U A;  5E4X A;  2PMZ B;  2AWO A;  3TZU A;  4HID A;  4NXM L;  1X55 A;  4OXP A;  1PZI D;  2NUC A;  4FF3 A;  3WOE A;  4RFB A;  1NY4 A;  3W1B A;  4B9W A;  4N8F A;  1HNZ Q;  2IHF A;  2K5N A;  5FO9 B;  4Q5V A;  1C0A A;  3BDL A;  5E3F A;  2B2U A;  2R7Z G;  1V8Q A;  1NJI C;  1WJJ A;  3GTL B;  3I4N B;  4PV1 C;  1GLE F;  2FJ2 A;  1WCM B;  3G48 A;  3NSW A;  3SK6 A;  3U4Z A;  2F3G A;  1Y8N B;  2E5L L;  2X6G A;  4QB4 A;  3DLL A;  1BCP D;  3Q23 A;  2JA7 B;  4AIM A;  2NTT A;  4LF9 Q;  2O5J C;  1GKH A;  2M9V A;  1B3Q A;  4BY1 B;  4KK7 A;  1HQM C;  4PMC A;  5JJI A;  4C3I G;  4HR7 B;  2F0G A;  2JJQ A;  3TP7 A;  4JI7 Q;  2JA5 B;  1H95 A;  3Q0A A;  1HHV A;  3TRZ A;  3JC6 6;  4A3L G;  1CT1 D;  2KJX A;  1SR3 A;  1W6K A;  3I91 A;  1YJ9 A;  1PH1 A;  1Q1E A;  5C4J B;  4Y7N B;  2GN5 A;  2D62 A;  4AQY Q;  5KNB A;  4DXF A;  1Z7T A;  1AE3 A;  3I90 A;  4DV7 Q;  1F3G A;  2BA1 A;  2FHT A;  2PW7 A;  3KDF B;  4HJ9 A;  3PQI A;  4JK1 C;  3L2P A;  4IPH A;  2UXB L;  3OOC A;  2WP8 J;  3KF8 A;  1SE3 A;  3K7A B;  2AMC B;  3HOZ G;  2AQ1 B;  3HKZ B;  3LNN A;  4JG2 A;  4AYB G;  3P1H A;  1ZEQ X;  3UE1 A;  2UU9 Q;  1B7Y B;  4WOR A;  2PO4 A;  4JV5 L;  2F0N A;  3FDT A;  1FGB D;  5JEA J;  3S1R B;  2VUM G;  4HJA A;  4EGV A;  1IBK L;  1STY A;  4X3U A;  5C6A A;  4O1N A;  4JI0 Q;  4IUQ A;  3MTS A;  3P75 A;  4X65 L;  4F87 A;  2K03 A;  1K83 H;  4H7B A;  5JVG 3;  5CBA E;  1VQ6 A;  1A3U A;  4HED A;  2NVQ H;  1XTC D;  2R92 B;  3A8I E;  3CQZ H;  1D7Q A;  1II3 A;  3P20 A;  4JC0 A;  3JAM L;  1E2V A;  4OX9 L;  2ICI A;  4DGZ A;  1MHW C;  2N88 A;  1KNA A;  1HTP A;  3S16 B;  3S17 B;  1HZB A;  1YI2 A;  3U50 C;  4A3E B;  5E7N A;  3L0O A;  4C1N I;  1SNO A;  1PXU A;  2QGQ A;  4DU9 A;  2Q8I B;  4B3S Q;  4YCW A;  5JPN C;  1GLB F;  1VCI A;  4WJ3 M;  1K28 A;  1UEB A;  3EN2 A;  1GLC F;  4A3B H;  4LNQ A;  3H3V C;  4DAV A;  3Q8D A;  2L9H A;  4DR7 Q;  5IYC H;  1JOR A;  2XN9 C;  4KHP L;  1ICF B;  1KQS A;  3NK9 A;  1C8C A;  3R93 A;  4KI0 A;  1SDF A;  3OSO A;  1P16 A;  4HTH A;  3AFQ A;  1G8Z D;  1AZQ A;  3F2U A;  2BCO A;  2MO0 A;  1V1O A;  3N6R A;  1DOL A;  5AJ3 L;  4LWC A;  2FMM A;  3HEJ A;  1CA6 A;  1EEF D;  3J81 L;  4NPS A;  1VQ9 A;  1VQ7 A;  2EE1 A;  3J7A V;  3UZ0 B;  1S4Z A;  4XQQ A;  1DJR D;  1Q1B A;  2KEC A;  5I9P A;  5DNF A;  1BOS A;  1DYQ A;  3TRE A;  1GUT A;  1VQF A;  2NWG A;  1VS0 A;  1A3V A;  2HQL A;  1IYJ B;  1SYG A;  2YTX A;  5FLX L;  3KFU A;  1EZ6 A;  5C3E B;  4JI3 Q;  4JCV E;  1QOH A;  3RD4 A;  4KJN A;  2F0Q A;  2K04 A;  2A1A A;  2WAQ E;  1JMC A;  3EJI A;  1KD1 C;  1QNU A;  5D14 A;  2NYZ D;  4I65 A;  1E7Z A;  2F0V A;  4YY3 Q;  2HDL A;  2QF7 A;  3ZYY X;  4A3J B;  3VDY A;  1TWF B;  1WYD A;  3IT5 A;  1SNP A;  3RZD H;  1JWS D;  3SGI A;  1VDZ A;  1EIH A;  1X6O A;  2XRQ D;  4HMJ A;  4NXN L;  4DK1 A;  4DV6 Q;  2B13 A;  4YHH Q;  2SEB D;  3MEH A;  3V2T A;  4QPB A;  4A3G H;  5FKA C;  1TS3 A;  1HUN A;  4GZY C;  1HXY D;  3K5L A;  2RQX A;  2NVX B;  5GAD C;  1S72 A;  1NUC A;  2E2H H;  4XDX A;  5I2X A;  4EQN A;  3NXW A;  4RMF A;  2E2J B;  1PYW D;  3BVZ A;  4FF1 A;  4DR1 L;  3F2D A;  1NR4 A;  2F0S A;  3NWT A;  2EY2 A;  4A3M H;  1PRT F;  1VQ5 A;  4H44 C;  3HOX G;  3GTP H;  3HOV H;  3PUX A;  1SN8 A;  1L2F A;  5IWA L;  4L8J A;  2F0L A;  3H6M A;  1FYC A;  2EYO A;  4YCV A;  2RSN A;  3KYH C;  1EOV A;  5ELE A;  4UDU C;  4NKL A;  4OON A;  4XYQ A;  4OL7 A;  5HY6 A;  1PDQ A;  3K81 C;  1A2U A;  1EY4 A;  4K0K L;  2EYM A;  1J6Q A;  4AYB B;  4DV5 L;  3RLF A;  1EY9 A;  4A3B G;  1ASZ A;  1V43 A;  1VQO A;  3A8K E;  3U9S A;  4ME5 A;  3I72 A;  2IX0 A;  1FVI A;  4OIJ A;  1MSG A;  3T4A C;  1L1O B;  4BS9 A;  3RN2 A;  3PO3 H;  5LMN L;  1SMY C;  1G29 1;  1EZ8 A;  1R4Q B;  4P71 A;  4LK1 C;  4RKL A;  4B3T L;  5B0H A;  4LUO A;  2L12 A;  3Q22 A;  2R7F A;  1NCV A;  3CC7 A;  1GUG A;  1GXD C;  4QJF A;  4L5T A;  3VYT A;  2A68 D;  2GA4 B;  2K5H A;  1K3R A;  1YHQ A;  2DJG C;  2PI2 E;  1HR0 Q;  1B8A A;  4XQN A;  4JI4 Q;  5C0X G;  2JYO A;  4JVZ A;  5M9O A;  2Z9H A;  3MZ5 A;  3S9W A;  4JPB W;  1STH A;  1WTR A;  4A93 H;  3S15 B;  4ZQ3 A;  2Z4H A;  2R93 G;  3H3V H;  3I3C A;  3DMU A;  2Z0S A;  2MUY A;  1KL9 A;  2OEO A;  1AZP A;  1KLG D;  4DR5 L;  1SE4 A;  3IL8 A;  4X66 Q;  1CTM A;  2X69 A;  1NMF A;  1RTN A;  5CGK A;  1HNW Q;  3WDN A;  1YIJ A;  2JA6 H;  3J7Y W;  1I3Q B;  4R4C A;  4FF2 A;  5M5W B;  3H0G G;  3EBE A;  4MZ9 A;  1N34 L;  5CV6 A;  3DWA A;  3TS0 A;  5I6W A;  1ZXT A;  5FO7 B;  4A3D B;  2ASB A;  1N36 L;  1LT3 D;  5C44 B;  3HOY G;  4OEM B;  4C3J B;  3DHQ A;  1AE2 A;  4A3M G;  1RHP A;  1S5B D;  2Q2I A;  3KOJ A;  4GN5 A;  1UE5 A;  2M2L A;  4ZLT F;  1Z47 A;  1J5E L;  5M3M B;  4ZYB A;  1GUO A;  5GAG C;  1ZYR D;  4GOP A;  1TU2 B;  4OGQ C;  1JE5 A;  4R4I A;  1KIX A;  2IY5 B;  5KRU A;  4K6D A;  3KF8 B;  2WII B;  4BY1 H;  1F2M A;  3GP7 A;  1B70 B;  5GAE C;  1HNX L;  3IFT A;  1KAB A;  2EDG A;  1I4R A;  1PTO B;  3LWE A;  1XPO A;  4XTC S;  4A76 A;  1H9S B;  5EPJ A;  4QUF A;  1X32 A;  2AUJ D;  3BJU A;  4DUY L;  1BF4 A;  3OW7 A;  3OUR B;  3RLO A;  2YV5 A;  3FHW A;  1TKW B;  2D5D A;  5C4J H;  4Y7N H;  3PIP 3;  2ZT9 C;  1OXU A;  2K14 A;  5CR3 A;  2UUC L;  1I4H A;  2YTV A;  5C4Z A;  3TUF B;  5ELN A;  1U9R A;  2CWA A;  3CCL A;  1VQK A;  5BN5 A;  5G3L D;  3TSS A;  4P72 A;  1AEX A;  4PG3 A;  3A0J A;  1Q82 C;  4ZKC B;  1IXR A;  1STN A;  3K7A H;  4C3H H;  4DUZ Q;  1IYV A;  4POF A;  4OWW B;  1DD2 A;  3LX0 A;  4HIO A;  2J0T D;  1VQL A;  3VR2 A;  2H1E A;  1QUQ A;  3IKJ A;  5EAY A;  4A93 G;  1XMO Q;  3EVQ A;  4LFA L;  5EPL A;  2RKS A;  4HJ8 A;  2X6L A;  1LUZ A;  3SHL A;  2ZXO A;  1GPR A;  3S14 B;  4DR3 Q;  1D2B A;  4R4Q A;  4DK3 C;  1EYA A;  4RGO S;  3NQI A;  1YNN D;  2K5D A;  3QR8 A;  2Z1C A;  4X62 L;  3CHB D;  3CD6 A;  4JI7 L;  2F4V Q;  3MXG A;  3T1H L;  5EBD A;  2R92 H;  3DUZ A;  4DR2 Q;  3BYY B;  3FVQ A;  2F0M A;  3D0F A;  2K1B A;  2F0D A;  2SNM A;  4L5Q A;  1EQQ A;  2HT1 A;  1IBM Q;  4MTK A;  3S1N B;  3VR6 A;  4JOI C;  4R4O A;  4DV7 L;  4RAU C;  1EIG A;  4K8J A;  2G5D A;  3S16 H;  1EU3 A;  1SFO B;  1EY8 A;  1X3E A;  4ID6 A;  2F0U A;  4FNF A;  4C2M B;  1ML0 D;  3M4O B;  4X3K A;  1JIC A;  2Q8T A;  4NW2 A;  4IFD J;  1OXX K;  4PQX A;  5JOB A;  2IL8 A;  5FJ8 H;  1Y8O B;  5C3W A;  1CSQ A;  2B63 G;  2UU9 L;  1N32 Q;  4A3I G;  3RNU A;  3G7L A;  4QL5 A;  2B2U C;  2R93 B;  2MJ8 A;  5IYD H;  4JI8 Q;  3A56 A;  1ONL A;  4XT3 B;  1VQJ A;  2N78 A;  1E2W A;  4BBR G;  2D2C C;  2N8N A;  1MGS A;  3MEF A;  4BBS B;  2K5W A;  3BVG A;  4JI0 L;  1F3Z A;  2WAC A;  3VYU A;  2KQ3 A;  3HOU B;  2MO1 A;  4A3K B;  1MKH A;  4DAP A;  1B44 D;  3MFY A;  1E24 A;  2EY5 A;  1C48 A;  3KLR A;  5IYB H;  3S2D H;  2K50 A;  3LWU A;  4LF5 Q;  3DXJ C;  4HSP A;  1GHK A;  1IBL Q;  5DLQ E;  5DM6 3;  3R3O A;  3A7L A;  2EJM A;  3TQY A;  3BG3 A;  3VR4 A;  1JJC B;  2ENB A;  3I4M G;  5C3E H;  1CK1 A;  2EJF C;  4C3H G;  3K58 A;  2XWJ B;  1Y1W G;  3KJO A;  3J80 E;  4EX5 A;  5EKI A;  4A3J H;  2JA8 B;  5BN3 A;  3PIP A;  3CW2 C;  1ZKO A;  2UUB L;  1ESF A;  1XPU A;  1IKM A;  3GTQ H;  2F0J A;  3I4O A;  2K7V A;  3PO2 H;  1W2B A;  1PTO C;  2I46 A;  2EPB A;  2CVR A;  3GD7 A;  2IW3 A;  1HFG A;  4IUR A;  4LFB Q;  2E2J H;  1UE7 A;  3K5M A;  5JJZ A;  3UDG A;  1CQV A;  5JAV A;  2A6E D;  4K2K A;  4QY7 A;  5J1Z A;  5FLM G;  1SJH D;  3A55 A;  1KLU D;  1BCP F;  4O0A A;  1SYC A;  1EYC A;  1EL0 A;  3K0X A;  1TT2 A;  1NAP A;  1HH2 P;  2LS0 1;  2ID0 A;  1YZ6 A;  1XMQ L;  1Q86 C;  2WKC A;  3GV3 A;  1RDP D;  1I94 Q;  2NVT B;  3MXP A;  4A3F B;  3ERS X;  2XRS D;  2H4O A;  4R8I A;  3FKI B;  1PYS B;  1O78 A;  5IP7 H;  4JI2 Q;  2WB1 E;  1BCP C;  3KBG A;  1HFN A;  1PFM A;  2EYP A;  1QJO A;  2B2V A;  2EYL A;  1U0L A;  1G51 A;  4RH6 A;  2B0P A;  5J39 A;  3SR1 A;  4IZ8 A;  4BXX H;  2V4D A;  5C5M A;  2JEA I;  4WRD A;  4JOI A;  4YY3 L;  4DV2 L;  2QA4 A;  3T1Y Q;  1FGU A;  3D3R A;  5IT9 E;  4UPA A;  3QOJ A;  1CKN B;  1XX8 A;  3PUW A;  3J81 j;  1E1T A;  1LYL A;  5M3F G;  1R9T H;  1ILP A;  4OWX B;  5FK9 C;  5EBC A;  1JB7 A;  3A5U A;  4DV1 Q;  1CFM A;  3STB D;  2N3S A;  1VF7 A;  1V9P A;  2HUG A;  2K01 A;  4O2D A;  4DV3 Q;  2RHQ B;  3PF4 A;  4MN3 A;  3CPW A;  4GLX A;  1B3A A;  2LSS A;  3CCU A;  1YVC A;  1SE2 A;  2E8G A;  2Z6B A;  4N9P A;  4K5W A;  4B3M L;  4TRD A;  3OHX C;  3TN2 A;  1GUN A;  1STG A;  1KC8 C;  4ZKB B;  3PMF A;  2SDF A;  3OTO Q;  1IKL A;  3PGZ A;  1CI3 M;  1XJV A;  1SAP A;  2E2I B;  5LMU Q;  1JE4 A;  4N9T A;  1VQA A;  2F52 A;  1FJG L;  1HZA A;  4V0B A;  2XNA C;  2VQF Q;  1TWG B;  3CU7 A;  2B63 B;  4UHV A;  4KN4 C;  1AFP A;  4FYD A;  4KY7 A;  1FD7 D;  3T51 B;  1GLD F;  1O80 A;  1I3Q H;  4GOP B;  3HOW G;  5C4X B;  4LAA A;  4JBW A;  2UXD L;  1Z9F A;  2J7Z A;  2VNU D;  5A2Q E;  2MHV A;  4NMZ A;  4X3S A;  4IPD A;  5KYI A;  2VY3 A;  3NEM A;  1WI5 A;  4B3R Q;  1KDB A;  1Q90 A;  5CBE E;  5C44 H;  2AUK A;  4L6T B;  3J80 c;  2HHH L;  2XWB B;  3TS2 A;  5JEA H;  2J4X A;  2LMC B;  1YEZ A;  3E6Z X;  4C3J H;  4OO1 H;  1I4G A;  1HRJ A;  3CSQ A;  3TP8 A;  2CH4 W;  3KUP A;  4DR4 Q;  1F9P A;  1KHI A;  5IP9 H;  4A3C H;  1O7L A;  1DGS A;  2BDO A;  5M3M H;  3GTJ H;  1PH2 A;  1K0S A;  1H9S A;  1JT8 A;  1SE8 A;  3QG1 A;  1N33 Q;  1S5D D;  2B8F A;  1PHJ A;  4FVM A;  2KCM A;  4DV4 L;  4J1M A;  1KDA A;  1TWH B;  1PZJ D;  1QG7 A;  3X3N A;  3RN5 A;  3H3V I;  3J7Z C;  2B39 A;  1A62 A;  4DNR B;  2ZM6 Q;  3BZC A;  4IUV A;  4RGM A;  1U4R A;  1QUQ B;  1PTO H;  2C5C A;  3PIO 3;  1NMG A;  2UXC Q;  1N9W A;  4K5V A;  2ZXR A;  3KLS A;  5BR8 Q;  1K8G A;  2UUA L;  2N49 A;  2I5M X;  3CRK C;  3MFG A;  1S3O A;  1SYE A;  1VF5 C;  4L63 B;  5IE8 A;  2I0Q A;  4OWT B;  5LL6 S;  1RJT A;  1JJG A;  4DK6 C;  3PUZ A;  2XIW A;  1TY0 A;  5K36 H;  1T5X D;  5EGT A;  3SK4 A;  1A3T A;  3B6Y A;  1AW7 A;  2LY7 A;  1XNQ L;  3BDC A;  1TII D;  3NQT A;  2D0O A;  2R61 A;  4L5S A;  3AEV A;  1UAP A;  2A8V A;  5KNC A;  1GD7 A;  4GKK L;  4DV0 L;  2XTI A;  1FNU A;  4F8M A;  4QGU A;  4FXD A;  1LTB D;  1SYF A;  1H9J A;  3E3X A;  3MWY W;  1K9M C;  3V96 A;  4RNZ A;  4DNI A;  1YJN A;  4BY7 H;  1OXV A;  1CA5 A;  3S14 H;  2M00 A;  1N8R C;  2PI2 A;  4LF8 L;  2Q2U A;  4JI5 Q;  1A8V A;  4IPC A;  1EWC A;  4APV A;  3GV6 A;  2I5H A;  3TBI B;  4FXK C;  1IYU A;  2NB0 A;  1RTO A;  1JQY D;  1M1K C;  3Q24 A;  1MD2 D;  2WAQ G;  2K28 A;  3W1G A;  1V1P A;  3A5Z B;  4GKJ Q;  4XQJ A;  3K8A A;  2BE5 C;  3K6O A;  2R7Z B;  1O2F A;  4CGY B;  1EY6 A;  4KLK A;  1TY2 A;  5E1F A;  3E0E A;  2B2W C;  3CCR A;  4C2M H;  4H13 C;  1UE1 A;  4U67 3;  3QIA A;  2EYH A;  5IY0 A;  3M4O H;  4LXC A;  3ND9 A;  4QIW E;  4A3C G;  1Q12 A;  4DFA A;  4BH5 A;  1HQR D;  5FOB B;  3DWP A;  1F2Z A;  2PW5 A;  3U58 A;  4LF6 Q;  1HA5 A;  3G71 A;  2LFN A;  2ATW A;  3UDX A;  1P8L A;  4IUU A;  4JI6 L;  4C3I B;  4ZUI A;  2RSO A;  1HA6 A;  3CCJ A;  5C0X J;  4DR3 L;  4J15 A;  5C3X A;  2AKW B;  4KN7 C;  1GHJ A;  3VR3 A;  4BBS H;  1X3P A;  3RZO H;  1PH5 A;  4GOP C;  4HSV A;  3HOU H;  3W2D A;  1GUW A;  3K5N A;  1CKM A;  1YHA A;  3QO2 A;  4A3K H;  3HOW B;  1LO5 D;  5KEE A;  2K4K A;  1OXT A;  2JEB I;  1AN8 A;  4NXM Q;  1TQO A;  4IUN A;  5ELF A;  3SXH A;  1GO3 E;  1A15 A;  4DR6 Q;  4DN4 M;  1JWM D;  3UE0 A;  1HJP A;  1PRT C;  4HCS A;  3M85 A;  3HOZ B;  1CHP D;  1BNZ A;  2E2D C;  4LJZ C;  3KLS X;  4RWS C;  4J8Q A;  1PFN A;  2CW0 C;  4RG1 A;  4DAY A;  3PIO A;  2ZTC A;  4A75 A;  4RKB A;  4LF7 L;  2E5L Q;  4IAL A;  3D4D A;  5IYC G;  4HJ5 A;  4I7A A;  1KRS A;  1Y1V H;  4DK0 A;  1SYD A;  1D8L A;  4JI1 L;  3MA2 B;  1DOM A;  3FRP B;  2JA8 H;  1EQT A;  5D65 A;  2Z4I A;  1HTL D;  2VUM B;  3PUV A;  4ZRZ A;  4JI8 L;  4JYA L;  3T53 B;  1L0W A;  5COR A;  1ET6 A;  2KVM A;  2VW9 A;  2OCE A;  2KOL A;  3S1M B;  4ZCK A;  1SXT A;  3E5S A;  2BDN A;  3JAM E;  2Y0S G;  1MJE A;  1TWC B;  2NN6 H;  3NHH A;  1HZ9 A;  1I4X A;  1DON A;  4FDB A;  1TWA B;  2KED A;  3K57 A;  2EJG C;  5C5L A;  3NYY A;  2Y0S E;  5IOD A;  2HD3 A;  1STA A;  1K8A C;  4LF5 L;  1EUJ A;  5CMD A;  3A74 A;  1IBL L;  3GO5 A;  2UXB Q;  1SYB A;  2CQA A;  2NVT H;  1FNV A;  4HJ7 A;  1JR0 D;  4A3F H;  4G4K A;  2GVA A;  1CKN A;  2LKV A;  3AFP A;  3FKI H;  1DM0 B;  5NUC A;  3C2P A;  3N52 A;  2OT2 A;  1BBW A;  4LFC L;  1K8O A;  3PV0 A;  1G2T A;  1CQF A;  1EWI A;  1X65 A;  4JV5 Q;  2DGY A;  3X3M A;  1X3Q A;  2PCF B;  3GTG B;  5H1S E;  4GN4 B;  3M4Q A;  1IW7 C;  1U4L A;  1IBK Q;  1I4Q A;  2K5Q A;  5G3L F;  4A3G G;  3CCS A;  1ASY A;  4KD3 A;  2B2W A;  5ELD A;  3J81 E;  4ZAI A;  4ZUJ A;  4X65 Q;  2IHE A;  4R8N A;  3AU7 A;  1OTC A;  1SMY D;  4MHE A;  4JBJ A;  3CCQ A;  1XNR L;  5ELC A;  1X54 A;  3HOV G;  2KCT A;  3GTL H;  3Q6S A;  3I4N H;  3TP5 A;  5FLX E;  1WCM H;  3G4S A;  3VA7 A;  4KMU C;  5JPM C;  2WAQ B;  2EY1 A;  4TKO B;  3D8G A;  3QB3 A;  5M5Y B;  1CZG A;  1IL8 A;  1PV4 A;  2TSS A;  1XWE A;  1SNC A;  1PA6 A;  2JA7 H;  2BH8 A;  1DOK A;  2G9H D;  4S3S A;  4DF7 A;  1WTW A;  1PH9 A;  2E2I H;  4X64 L;  1DZ1 A;  3RR5 A;  4HN7 A;  2IX3 A;  2KEN A;  1TWG H;  4DXG A;  2JA5 H;  4KHP Q;  5DEH A;  2L55 A;  4O42 A;  4GLA C;  4KTA A;  1TS2 A;  3PO3 G;  5C4X H;  2F0E A;  2EXD A;  2R7D A;  4X3T A;  2JSO A;  4B08 A;  4A4I A;  2DUD A; 
#chains in the Genus database with same CATH homology
 3A7A B;  2F3V A;  3T56 B;  3HOX B;  1WTO A;  3CQZ B;  1EFI D;  4BWG B;  1ILQ A;  4OHJ A;  1JOQ A;  2F0K A;  2YYZ A;  1I6H B;  1BCP B;  1SNM A;  1RKN A;  1UEA B;  2NTS A;  1GLA F;  1QNK A;  2IX1 A;  2HSI A;  3M4Y A;  1LV9 A;  2FFK B;  2F0P A;  4A3B B;  1EEI D;  2Z8L A;  1D6E C;  1D5Z C;  2O2L D;  3H09 A;  3BZD B;  3TP6 A;  3GTK B;  2B2Y A;  2RBM A;  4FO2 A;  3S2H B;  1EY5 A;  1TVX A;  1JB3 A;  2B2V C;  2IPK D;  4IFD H;  2K05 A;  2A6H C;  4M1U B;  4RGT A;  4NP5 A;  2F0I A;  1HPC A;  3SK8 A;  5CYU A;  2A5H A;  2Q8R E;  1LAB A;  1J9O A;  1CM9 A;  2OXP A;  3HRZ C;  4HAE A;  4OO1 I;  1RF2 D;  5IGC A;  1NR2 A;  1V1P B;  2SOB A;  2A69 C;  3FEW X;  3I8Z A;  1L0X B;  5IGG A;  4PMB A;  2QIL A;  1L0Y B;  2TMP A;  3T13 A;  2VB2 X;  1SSO A;  1JWU D;  5HGT A;  2JXM B;  4ZYS A;  2YU9 B;  4WFN 3;  3OMG A;  3FMC A;  1D5X C;  3H0G B;  3M7G A;  3E0J A;  1YNJ C;  2NBF A;  2B8G A;  5AFW A;  4XXE A;  3D4R A;  4C1N K;  2WV6 D;  5J22 A;  1U4P A;  3HOY B;  3EA6 A;  3NE5 B;  4A3M B;  5KND A;  4XT1 B;  3GTP B;  3HOV B;  1D1K A;  1M4V A;  1UUP A;  1BUV T;  1VMP A;  4K2L A;  3O13 A;  1WD0 A;  3OMC A;  1ESR A;  4RGN A;  1FR3 A;  2AQ2 B;  3HS0 C;  5TSS A;  1ENA A;  5D3I B;  3U9O A;  4CJ0 B;  1LAC A;  2L4N A;  1H9M A;  3SLU A;  1JOO A;  2QCP X;  1PFB A;  2F1M A;  5M5X B;  3VR5 A;  4KY5 A;  2PNR C;  5IIF A;  2EY6 A;  2JE6 I;  3NTI A;  1STB A;  4Z9C B;  3CRL C;  1RCV D;  4U68 A;  4K5X A;  3WOF A;  4E6I A;  1LTT D;  2DY8 A;  4IUT A;  4UAI A;  3D6W A;  2KCN A;  1E2Z A;  1F9S A;  1EU4 A;  3DWQ A;  4A93 B;  2GU1 A;  5C0X I;  3S1Q B;  3GTM B;  3TDQ A;  3L7Z C;  1S5C D;  1WTQ A;  5I4D A;  2PZW A;  2F0T A;  3C3L A;  3BS1 A;  5HUR A;  1PTO D;  1B9N A;  3KBX A;  2DNC A;  1O7Z A;  2MPM A;  1HCZ A;  1G2S A;  1G91 A;  2F03 A;  3M3Y B;  3BVM A;  5CV8 A;  5T1I A;  4KKT A;  3RMH A;  2A74 C;  1GJX A;  1I4P A;  3GTO B;  5E4W C;  2B44 A;  4A3I B;  5CV7 A;  1ET9 A;  3H94 A;  1BBX C;  1Q8I A;  2QDB A;  3L9A X;  3VYR A;  3QOL A;  1MI2 A;  1B53 A;  1B9M A;  4BBR B;  3HZX A;  1S5F D;  2B2T A;  1EQV A;  5LHY 1;  1LTA D;  4RA8 A;  1PRT B;  4QMG A;  3J7A F;  2NN6 I;  4QUC A;  4CHT B;  1KNE A;  2F3W A;  5D3D A;  3I4M B;  3A54 A;  4KKS A;  1G6Z A;  4H0L C;  2EOT A;  4C3H B;  1PZK D;  1Y1W B;  2SNS A;  2L11 A;  3NBI A;  1QCB D;  2RA4 A;  4TSS A;  3MC0 B;  1SND A;  3NUC A;  3QJY A;  5JVH 3;  2EYJ A;  3MXN A;  3DEP A;  4MIU A;  1LT5 D;  1I6V C;  3PUY A;  4HCE A;  2F0F A;  2K33 A;  2E74 C;  3I73 A;  1LTR D;  4EQP A;  1A2T A;  1GOZ A;  5CV4 A;  2WB1 B;  2RDF A;  1LTS D;  1Y69 U;  1T5E A;  2ICE C;  1JC7 A;  4XYO A;  2KCC A;  1WTP A;  1KDC A;  3K5O A;  3ERQ A;  1LLR D;  1TS5 A;  5KYL A;  2A73 B;  2NVY B;  4V19 0;  5CC4 A;  3OIQ A;  1PLF A;  1STE A;  1I50 B;  4HMI A;  1BDO A;  5M3F B;  5F2D A;  3D6C A;  3BDO A;  4EVO A;  2OF1 A;  4QP5 A;  1MBY A;  3TZD A;  3ONA B;  5JEA G;  3K59 A;  3D31 A;  4C3J G;  4OO1 G;  1ICW A;  3S2D B;  1GUS A;  4Q0F A;  1Y8P B;  4G7O C;  5C0X H;  1HUM A;  2IJ0 A;  1S5E D;  3V05 A;  3ITP A;  3AMU A;  1OO9 B;  2DN8 A;  5IGE A;  3ND8 A;  3HP3 A;  1GGR A;  2HCI A;  3EQL C;  3CKI B;  1TS4 A;  2ZXP A;  5ELB A;  1WTX A;  1LTG D;  1EYD A;  3GTQ B;  1E0B A;  3PO2 B;  4EQO A;  2AQ3 B;  1XXG A;  2A68 C;  3KK7 A;  4KD4 A;  4ILW A;  5K36 G;  4IFD I;  2E75 C;  1F2L A;  1C4Q A;  1WD1 A;  5EKK A;  3NP8 A;  2O5I C;  1JCK B;  4IQZ A;  5LL6 X;  2BE5 D;  3SVM A;  3IAY A;  4RHR A;  2JP1 A;  4RCO A;  1WTV A;  1M8A A;  5I9O A;  2FIN B;  4RCN A;  1W6J A;  5CV5 A;  1KTK A;  5EPK A;  3VA5 A;  4ABN A;  1PMR A;  3VYS A;  4G7Z C;  2AWN A;  4F88 A;  2MP0 B;  3GQB A;  1SJE D;  4YIJ A;  1A6X A;  2GPR A;  1R9T B;  4BA2 I;  2R6G A;  2B2Y C;  3C1F A;  3FPU B;  2EYF A;  1MSH A;  1QIL A;  3OPO A;  4TQU S;  1BQQ T;  4QCL A;  1BXT A;  2RVL A;  1ZYR C;  1EOT A;  5EJW A;  1PRT D;  2XVS A;  4DNT B;  3K0Y A;  4ODG A;  2CW0 D;  3SDZ A;  4G57 A;  3W3A A;  5I6Y A;  2O4X A;  3IT7 A;  4RNY A;  5EQ0 A;  2HDM A;  4LMQ D;  2F4I A;  1XYI A;  4KHZ A;  4PNY A;  1VMC A;  1AX3 A;  1EY0 A;  2BOS A;  2R3Z A;  3R2I A;  3NWS A;  1Q3L A;  1BO0 A;  1F9Q A;  4QIW B;  1JOK A;  3NTK A;  1Z6H A;  2RDH A;  2F0O A;  2MGS A;  1B2T A;  4CKC A;  2IT1 A;  1F77 A;  3GTJ B;  4R9W A;  4K8I A;  2WIN B;  2VB3 X;  4G7H C;  2KEE A;  2NZ1 D;  1YNN C;  2QKI C;  1H9R A;  5IGF A;  1FNW A;  3J80 L;  4IN3 A;  4RHS A;  1UNS A;  2K6A A;  3D4W A;  4KV6 A;  4OIK A;  1K83 B;  1IW7 D;  2NN6 G;  2NVQ B;  3MAQ A;  4BA1 I;  1LT4 D;  4DA2 A;  4I7Z C;  5KGU A;  3UI2 A;  3A8J E;  4KJO A;  2VXW A;  3SK5 A;  1QE6 A;  5IOC A;  3DM1 A;  3R2T A;  2FMC A;  4M8A A;  5K5P A;  3AB9 A;  3DEO A;  1SBB B;  5I2Y A;  3OWE B;  2HQE A;  5CV9 A;  4C56 C;  2KUM A;  4BY7 B;  3T16 A;  4KKU A;  4XIG S;  2HCC A;  5DM7 3;  2EXZ A;  4FP5 D;  1DXM A;  4CJ1 B;  2Y0S B;  5IT9 L;  1R4P B;  4J6H A;  5KIX A;  3BYT B;  3ERO A;  1J8I A;  1LTI D;  1D1I A;  3TME A;  3QWN A;  4JBW M;  2QEJ C;  4WJW A;  2G9D A;  4PMW A;  3I4L A;  3IFD A;  2C9O A;  2CHB D;  5EKL A;  2E76 C;  1QWY A;  1CZW A;  4ULL A;  3MVV A;  4NDX A;  2PQE A;  1TR5 A;  3HG9 A;  3OWF A;  5C4H A;  2EVB A;  4F7X A;  2MP1 A;  2PYK A;  1BR9 A;  2BA0 A;  1H9K A;  5ISR A;  2F0W A;  1B50 A;  2F0H A;  5IGB A;  3RZD B;  1ENF A;  3MXU A;  2L0C A;  2PZU A;  3NBH A;  4A3G B;  4CBV A;  3NTH A;  2A6E C;  3SEB A;  2E2H B;  5BN4 A;  2L5T A;  1ENC A;  3RZO B;  2PPB C;  3HGB A;  5DAU A;  1OXS C;  4CKE A;  3URY A;  2A6H D;  5A2Q L;  2B2T C;  2L1B A;  3FPP A;  4CJ2 C;  1ROD A;  2WKD A;  1F2Y A;  2XSC A;  1EWH A;  3M7N A;  1CHQ D;  2RDG A;  4P2C B;  2DY7 A;  1K8M A;  4IUP A;  3OIP A;  3C46 A;  2I07 B;  1PTO F;  2A69 D;  1DCZ A;  1QB5 D;  2KA7 A;  1Y1V B;  2N55 A;  2DNE A;  4QF4 A;  4FF4 A;  4KHV A;  1O7Y A;  1B4O A;  3PO3 B;  2IWH A;  3P7J A;  4K6L A;  1B1Z A;  4ZK9 B;  4IFD G;  4K14 A;  5IGD A;  1WVL A;  1U4M A;  1YNJ D;  1F9R A;  1NSN S;  2K32 A;  2EZV A;  3L3O C;  1EY7 A;  5KVP A;  3R8B A;  3G6J B;  5T1G A;  5FO8 B;  3NPP A;  2KHS A;  5COY A;  4FXG C;  4CKB A;  4B9X A;  1LT6 D;  2PZT A;  1D5M C;  3RUZ A;  4KY6 A;  3I70 A;  1RD9 D;  1SEB D;  1IHZ A;  1SNQ A;  2JA6 B;  1AP0 A;  1KAA A;  5A35 A;  3MHB A;  3EFX D;  3C1E A;  3H91 A;  3SE0 A;  2D9U A;  5E4X A;  2PMZ B;  2AWO A;  3TZU A;  1PZI D;  2NUC A;  4FF3 A;  3WOE A;  4RFB A;  4B9W A;  5FO9 B;  4Q5V A;  3BDL A;  5E3F A;  2B2U A;  1V8Q A;  3GTL B;  3I4N B;  4PV1 C;  1GLE F;  2FJ2 A;  1WCM B;  3NSW A;  3SK6 A;  2F3G A;  1Y8N B;  2X6G A;  4QB4 A;  1BCP D;  3Q23 A;  2JA7 B;  2NTT A;  2O5J C;  2M9V A;  4BY1 B;  4KK7 A;  1HQM C;  4PMC A;  4C3I G;  4HR7 B;  2F0G A;  3TP7 A;  2JA5 B;  3Q0A A;  1HHV A;  1CT1 D;  2KJX A;  1W6K A;  3I91 A;  1Q1E A;  5C4J B;  4Y7N B;  2D62 A;  5KNB A;  4DXF A;  1Z7T A;  3I90 A;  1F3G A;  2BA1 A;  2FHT A;  2PW7 A;  4JK1 C;  3OOC A;  2WP8 J;  3KF8 A;  1SE3 A;  3K7A B;  2AQ1 B;  3HKZ B;  3LNN A;  3P1H A;  1ZEQ X;  4WOR A;  2PO4 A;  2F0N A;  3FDT A;  1FGB D;  5JEA J;  3S1R B;  4EGV A;  1STY A;  4X3U A;  5C6A A;  4O1N A;  4IUQ A;  3MTS A;  3P75 A;  4F87 A;  2K03 A;  4H7B A;  5JVG 3;  5CBA E;  1A3U A;  4HED A;  1XTC D;  2R92 B;  3A8I E;  1II3 A;  3P20 A;  3JAM L;  1E2V A;  2ICI A;  4DGZ A;  2N88 A;  1KNA A;  1HTP A;  3S16 B;  3S17 B;  4A3E B;  4C1N I;  1SNO A;  1PXU A;  4DU9 A;  2Q8I B;  1GLB F;  5JPN C;  1VCI A;  1GLC F;  3H3V C;  4DAV A;  2L9H A;  1JOR A;  2XN9 C;  3NK9 A;  1C8C A;  3R93 A;  4KI0 A;  1SDF A;  3OSO A;  4HTH A;  1G8Z D;  1AZQ A;  3F2U A;  2BCO A;  1V1O A;  3N6R A;  1DOL A;  2FMM A;  3HEJ A;  1CA6 A;  1EEF D;  3J81 L;  2EE1 A;  3J7A V;  3UZ0 B;  1S4Z A;  4XQQ A;  1DJR D;  1Q1B A;  2KEC A;  5I9P A;  5DNF A;  1BOS A;  1DYQ A;  1GUT A;  2NWG A;  1A3V A;  1SYG A;  5FLX L;  1EZ6 A;  5C3E B;  1QOH A;  3RD4 A;  4KJN A;  2F0Q A;  2K04 A;  3EJI A;  1QNU A;  5D14 A;  2NYZ D;  4I65 A;  2F0V A;  2HDL A;  2QF7 A;  3ZYY X;  4A3J B;  1TWF B;  3IT5 A;  1SNP A;  1JWS D;  1VDZ A;  1EIH A;  2XRQ D;  4HMJ A;  4DK1 A;  2B13 A;  2SEB D;  3MEH A;  3V2T A;  4QPB A;  5FKA C;  1TS3 A;  1HUN A;  4GZY C;  1HXY D;  3K5L A;  2RQX A;  2NVX B;  1NUC A;  4XDX A;  5I2X A;  4EQN A;  3NXW A;  2E2J B;  1PYW D;  3BVZ A;  4FF1 A;  1NR4 A;  2F0S A;  3NWT A;  2EY2 A;  1PRT F;  4H44 C;  3PUX A;  4L8J A;  2F0L A;  3H6M A;  1FYC A;  2EYO A;  2RSN A;  5ELE A;  4UDU C;  4NKL A;  4XYQ A;  4OL7 A;  1PDQ A;  1A2U A;  1EY4 A;  2EYM A;  4AYB B;  3RLF A;  1EY9 A;  1V43 A;  3A8K E;  3U9S A;  4ME5 A;  3I72 A;  2IX0 A;  4OIJ A;  1MSG A;  3T4A C;  4BS9 A;  1SMY C;  1G29 1;  1EZ8 A;  1R4Q B;  4LK1 C;  4RKL A;  5B0H A;  2L12 A;  3Q22 A;  1NCV A;  1GUG A;  1GXD C;  3VYT A;  2A68 D;  2GA4 B;  4XQN A;  5C0X G;  2JYO A;  5M9O A;  3MZ5 A;  3S9W A;  1STH A;  1WTR A;  3S15 B;  4ZQ3 A;  2Z4H A;  3I3C A;  3DMU A;  2MUY A;  2OEO A;  1AZP A;  1KLG D;  1SE4 A;  3IL8 A;  1CTM A;  2X69 A;  1RTN A;  5CGK A;  3WDN A;  3J7Y W;  1I3Q B;  4FF2 A;  5M5W B;  5CV6 A;  3DWA A;  5I6W A;  1ZXT A;  5FO7 B;  4A3D B;  1LT3 D;  5C44 B;  4C3J B;  3DHQ A;  1RHP A;  1S5B D;  2M2L A;  4ZLT F;  1Z47 A;  5M3M B;  4ZYB A;  1GUO A;  1ZYR D;  1TU2 B;  4OGQ C;  5KRU A;  4K6D A;  2WII B;  1F2M A;  3GP7 A;  3IFT A;  1KAB A;  2EDG A;  1I4R A;  1PTO B;  3LWE A;  4XTC S;  1H9S B;  5EPJ A;  4QUF A;  1X32 A;  2AUJ D;  1BF4 A;  3OW7 A;  3OUR B;  1TKW B;  2D5D A;  3PIP 3;  2ZT9 C;  1OXU A;  5CR3 A;  1I4H A;  5C4Z A;  3TUF B;  1U9R A;  5BN5 A;  5G3L D;  3TSS A;  1AEX A;  4ZKC B;  1STN A;  1IYV A;  1DD2 A;  3LX0 A;  2J0T D;  3VR2 A;  2H1E A;  3IKJ A;  3EVQ A;  5EPL A;  2RKS A;  2X6L A;  3SHL A;  2ZXO A;  1GPR A;  3S14 B;  1D2B A;  1EYA A;  4RGO S;  3NQI A;  1YNN D;  2K5D A;  2Z1C A;  3CHB D;  3MXG A;  5EBD A;  3DUZ A;  3BYY B;  2F0M A;  3FVQ A;  2K1B A;  2F0D A;  2SNM A;  3S1N B;  3VR6 A;  4RAU C;  1EIG A;  4K8J A;  1EU3 A;  1SFO B;  1EY8 A;  4ID6 A;  2F0U A;  4FNF A;  4C2M B;  1ML0 D;  3M4O B;  4X3K A;  1JIC A;  2Q8T A;  4NW2 A;  4IFD J;  1OXX K;  4PQX A;  5JOB A;  2IL8 A;  5C3W A;  1Y8O B;  3G7L A;  2B2U C;  2R93 B;  2MJ8 A;  3A56 A;  1ONL A;  4XT3 B;  1E2W A;  2D2C C;  1MGS A;  4BBS B;  2K5W A;  3BVG A;  1F3Z A;  2WAC A;  3VYU A;  2KQ3 A;  3HOU B;  4A3K B;  4DAP A;  1B44 D;  3MFY A;  2EY5 A;  1C48 A;  3KLR A;  3LWU A;  3DXJ C;  4HSP A;  1GHK A;  5DM6 3;  3R3O A;  3A7L A;  2EJM A;  3BG3 A;  3VR4 A;  2ENB A;  1CK1 A;  2EJF C;  4C3H G;  3K58 A;  2XWJ B;  3J80 E;  5EKI A;  2JA8 B;  5BN3 A;  1ZKO A;  1ESF A;  1IKM A;  2F0J A;  2K7V A;  1PTO C;  2I46 A;  2EPB A;  2CVR A;  3GD7 A;  2IW3 A;  1HFG A;  4IUR A;  3K5M A;  5JJZ A;  1CQV A;  5JAV A;  2A6E D;  4K2K A;  5J1Z A;  1SJH D;  3A55 A;  1KLU D;  1BCP F;  1SYC A;  1EYC A;  1EL0 A;  1TT2 A;  1NAP A;  2LS0 1;  2ID0 A;  2WKC A;  3GV3 A;  1RDP D;  2NVT B;  3MXP A;  4A3F B;  2XRS D;  2H4O A;  4R8I A;  3FKI B;  1O78 A;  1BCP C;  3KBG A;  1HFN A;  1PFM A;  2EYP A;  1QJO A;  2B2V A;  2EYL A;  4RH6 A;  2B0P A;  5J39 A;  3SR1 A;  4IZ8 A;  2V4D A;  5C5M A;  2JEA I;  4WRD A;  3D3R A;  5IT9 E;  3QOJ A;  1XX8 A;  3PUW A;  1ILP A;  5FK9 C;  5EBC A;  1CFM A;  1VF7 A;  2HUG A;  2K01 A;  4MN3 A;  1B3A A;  1SE2 A;  4N9P A;  4K5W A;  4TRD A;  3OHX C;  3TN2 A;  1GUN A;  1STG A;  4ZKB B;  3PMF A;  2SDF A;  1IKL A;  1CI3 M;  1SAP A;  2E2I B;  1JE4 A;  4N9T A;  4V0B A;  2XNA C;  1TWG B;  3CU7 A;  2B63 B;  4KN4 C;  1AFP A;  4FYD A;  4KY7 A;  1FD7 D;  3T51 B;  1GLD F;  1O80 A;  5C4X B;  4LAA A;  4JBW A;  2J7Z A;  2VNU D;  5A2Q E;  2MHV A;  4NMZ A;  4X3S A;  5KYI A;  1KDB A;  1Q90 A;  5CBE E;  2AUK A;  4L6T B;  2XWB B;  5JEA H;  2J4X A;  2LMC B;  3E6Z X;  4OO1 H;  1I4G A;  1HRJ A;  3CSQ A;  3TP8 A;  3KUP A;  1F9P A;  1O7L A;  2BDO A;  1H9S A;  3QG1 A;  1S5D D;  2B8F A;  4FVM A;  4J1M A;  1KDA A;  1TWH B;  1PZJ D;  1QG7 A;  3X3N A;  2B39 A;  4DNR B;  4IUV A;  4RGM A;  1U4R A;  1PTO H;  2C5C A;  3PIO 3;  4K5V A;  2ZXR A;  3KLS A;  3CRK C;  3MFG A;  1SYE A;  1VF5 C;  4L63 B;  5LL6 S;  1RJT A;  3PUZ A;  2XIW A;  1TY0 A;  5K36 H;  1T5X D;  5EGT A;  3SK4 A;  1A3T A;  1AW7 A;  2LY7 A;  3BDC A;  1TII D;  3NQT A;  2R61 A;  1UAP A;  5KNC A;  1FNU A;  4F8M A;  4FXD A;  1LTB D;  1SYF A;  1H9J A;  3MWY W;  3V96 A;  4RNZ A;  1OXV A;  1CA5 A;  2M00 A;  1EWC A;  3GV6 A;  3TBI B;  4FXK C;  1IYU A;  2NB0 A;  1RTO A;  1JQY D;  3Q24 A;  1MD2 D;  2K28 A;  1V1P A;  4XQJ A;  2BE5 C;  3K6O A;  2R7Z B;  1O2F A;  4CGY B;  1EY6 A;  1TY2 A;  5E1F A;  2B2W C;  4U67 3;  4H13 C;  4LXC A;  3QIA A;  2EYH A;  3ND9 A;  1Q12 A;  4DFA A;  4BH5 A;  1HQR D;  5FOB B;  3DWP A;  1F2Z A;  2PW5 A;  1HA5 A;  2LFN A;  4IUU A;  4C3I B;  4ZUI A;  2RSO A;  1HA6 A;  5C0X J;  5C3X A;  4KN7 C;  1GHJ A;  3VR3 A;  1X3P A;  4HSV A;  1GUW A;  3W2D A;  3K5N A;  3QO2 A;  3HOW B;  1LO5 D;  5KEE A;  1OXT A;  2JEB I;  1AN8 A;  1TQO A;  4IUN A;  5ELF A;  3SXH A;  1A15 A;  4DN4 M;  1JWM D;  1PRT C;  4HCS A;  3M85 A;  3HOZ B;  1CHP D;  1BNZ A;  2E2D C;  4LJZ C;  3KLS X;  4RWS C;  4J8Q A;  1PFN A;  2CW0 C;  4DAY A;  4RKB A;  4IAL A;  3D4D A;  4DK0 A;  1SYD A;  3MA2 B;  1DOM A;  3FRP B;  1EQT A;  5D65 A;  2Z4I A;  1HTL D;  2VUM B;  3PUV A;  4ZRZ A;  3T53 B;  5COR A;  1ET6 A;  2KVM A;  2KOL A;  3S1M B;  1SXT A;  3E5S A;  2BDN A;  3JAM E;  1TWC B;  2NN6 H;  3NHH A;  1I4X A;  1DON A;  1TWA B;  2KED A;  3K57 A;  2EJG C;  5C5L A;  3NYY A;  5IOD A;  1STA A;  5CMD A;  3GO5 A;  1SYB A;  2CQA A;  1FNV A;  1JR0 D;  4G4K A;  2LKV A;  1DM0 B;  5NUC A;  3C2P A;  3N52 A;  2OT2 A;  1K8O A;  3PV0 A;  1G2T A;  1CQF A;  3X3M A;  1X3Q A;  2PCF B;  3GTG B;  1IW7 C;  1U4L A;  1I4Q A;  2K5Q A;  5G3L F;  4KD3 A;  2B2W A;  5ELD A;  3J81 E;  4ZAI A;  4ZUJ A;  4R8N A;  3AU7 A;  1SMY D;  4MHE A;  5ELC A;  3Q6S A;  3TP5 A;  5FLX E;  3VA7 A;  4KMU C;  5JPM C;  2WAQ B;  2EY1 A;  4TKO B;  3D8G A;  3QB3 A;  5M5Y B;  1CZG A;  1IL8 A;  2TSS A;  1XWE A;  1SNC A;  1DOK A;  2G9H D;  4S3S A;  4DF7 A;  1WTW A;  1DZ1 A;  4HN7 A;  2IX3 A;  4DXG A;  5DEH A;  2L55 A;  4O42 A;  4KTA A;  1TS2 A;  2F0E A;  4X3T A;  2JSO A;  4B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...