1QWYA

Latent lytm at 1.3 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
234
Chain Sequence
VSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSSGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords peptidoglycan hydrolase
publication title Latent LytM at 1.3A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
total genus 66
structure length 234
sequence length 270
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.290 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qwyA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 1qwyA02
3IT5A 2B0PA 2GPRA 2HSIA 2B13A 1F3ZA 4ZYBA 1GGRA 3SLUA 3UZ0B 4RNYA 1AX3A 4RNZA 1GLBF 1QWYA 1GLAF 2B44A 1GLCF 3NYYA 3OURB 4QP5A 1O2FA 2F3GA 3IT7A 4LXCA 4QPBA 1GLEF 3CSQA 1F3GA 5KVPA 4BH5A 2GU1A 1GLDF 5B0HA 4JBWM 2MP0B 1GPRA 3TUFB
chains in the Genus database with same CATH superfamily
1NMGA 2E2JB 1G91A 2MHVA 4LF6L 2K03A 4JI3Q 3PO2B 1JJGA 1SJHD 4RKLA 3QOLA 4YY3L 2UU9Q 3KBGA 1E1TA 1L2FA 2L4NA 2PCFB 3BDOA 3K0YA 1X54A 1G2SA 2MNAA 1SFOB 4DV2Q 2A6HC 5IGBA 4IUVA 4NDXA 1I6HH 4V0BA 2EXZA 2KENA 2E5LQ 4FO2A 2F0JA 5JVG3 1VQNA 2ZJQA 1GUSA 4DV5L 3GTQH 4X66L 3E3XA 1A8VA 1H9JA 3UE1A 2VB3X 3F2CA 5C3EB 3H0GG 1YJ9A 2I07B 4JI6Q 4OXPA 4IUTA 2ZJPA 2O5IC 5FLMG 5BN4A 4QMGA 4B3TQ 3EBEA 1EU3A 2ICEC 4UP8A 3GTPH 2UUAQ 3FKIH 1L1OC 4ME3A 1YITA 2VQEL 1B7YB 1Y1VH 3K7UC 4KN7C 4RH6A 1SROA 1L0XB 2HHHL 2HCCA 2JYOA 2L11A 1QUQB 1SMYC 2VB2X 2YV5A 4K6DA 4DV3Q 3J81j 1KNEA 2WAQE 4BS9A 1L1OA 2NVQB 4HJ7A 1CKOA 2IX0A 2N49A 2I5LX 3M85A 1Q90A 4J6HA 1BBWA 1UWVA 2UXCL 2DNEA 3A56A 3I4NH 4RAUC 1U4LA 2PZWA 4UP9A 1I4XA 3IFDA 2NZ1D 4DR2L 3HOUB 4UY8C 4IPDA 4IPGA 4YY3Q 1D6EC 5IYDH 5C0XH 3DWPA 4LNQA 4RMFA 4L5RC 2L12A 4HIKA 1XNRL 2B29A 5FJ8G 3LNNA 3Q24A 4A93G 1Q81C 2JA8H 2ZXRA 1FD7D 1V43A 5JAVA 3I55A 2MP0B 3A7LA 3G6JB 3OWEB 1Y1WB 1EY5A 2RVLA 2K32A 4DNTB 4DR5Q 1JWMD 2F0DA 4R4QA 3HKSA 4X66Q 3I73A 4JOIC 2RCNA 2OQKA 3CCSA 1HPCA 3GTKH 3EIVA 4ZK9B 1NTGA 1SNQA 1STGA 4IJLA 1GLBF 3JAME 2XRSD 1HR0L 2JE6I 5FOBB 3E6ZX 1YHQA 1FNVA 4JYAQ 2PW7A 2PYKA 3C46A 1FGUA 3A8JE 4JOIA 1I4QA 1LTGD 4AYBB 2VQEQ 1EWIA 1U9RA 2F0OA 1EIFA 1I5FA 3PF5A 2EOTA 3TP5A 4EQPA 1N33L 4BY1G 1F3ZA 1IBMQ 5I9OA 4FNFA 2HHHQ 5KYLA 5KNDA 3R3OA 4FXGC 2D0PA 4A3KB 4GOPB 1CTMA 3DEPA 2X6GA 4C3JG 3HOWH 4QPBA 3I4MB 3MEHA 4JK1C 2UXCQ 4QUFA 3MZ5A 2GU1A 1D5ZC 1KLUD 5G3LF 1PTOD 4CJ2C 1DYQA 4ZUIA 4P73A 5D14A 4OELB 1A3TA 5IYBG 1QB5D 4DR2Q 4OL7A 1GGRA 1WCMH 4F8MA 2HCIA 2UUBL 3VA7A 2E75C 4L8JA 2CHBD 1WTPA 2Y0SG 3K81C 3UDGA 2SDFA 1YZ6A 1XNRQ 4A3BH 1BCPD 1F2YA 2EYMA 4NPSA 4H44C 2Q8IB 2B2TC 3HOVH 3S2DB 4JBMA 4JV5L 2GA4B 4NP5A 3KYHC 2F0KA 1HR0Q 4NXML 4C3IB 1ENFA 3MXUA 3BDCA 2F0LA 2B2TA 1SNPA 1MSGA 2KJXA 4O2DA 2R93H 1G291 1GUTA 1YJWA 1K9MC 4LFCL 1KIXA 5AJ3L 3VA5A 1EIYB 1SYEA 2E74C 3RLOA 3KLWA 2N78A 4KK7A 3A8KE 3CCMA 5ELOA 4RWSC 1P16A 1OO9B 1SYGA 3OHXC 4N9PA 4DN4M 4A3EH 1VQ5A 1RTOA 3M7GA 3KLRA 4HAEA 2R7ZB 1NR2A 2MGSA 4OGQC 4PMWA 3WWVA 1LT5D 2N55A 2WFWA 1G6PA 2RKSA 4K8IA 4I7AA 3P20A 1YVCA 4CDEC 5HY6A 1EUJA 5BR8Q 3RN2A 1LTRD 3FMCA 1PTOC 1HA5A 2VUMG 2IL8A 3FP9A 2F0VA 1GHKA 3JAMi 4WJWA 4BY7G 1SBBB 1TXYA 3Q23A 1ESRA 4GN3B 4BBSG 1I50B 1EIHA 1TWGB 3G71A 5M3FB 3H6MA 3SDZA 4RNYA 3I7FA 1HZBA 4RGMA 1Y8OB 4RKBA 1HXYD 2B2WC 3NYYA 3E9IA 2K04A 3PCOB 1BCPC 1ICWA 3NSWA 3W2DA 1PLFA 1ONLA 3A74A 4A3LG 1HQMC 1PZJD 1ET9A 2EYHA 2EZVA 2VW9A 2QCPX 2A6EC 1N34Q 1AZPA 2NVXB 4LMQD 2B2WA 2A19A 4KD4A 1WTVA 5LMUL 1IHZA 3DM1A 4MNOA 4RA8A 1QWYA 2BCOA 1PH7A 4HCSA 3KLSX 1BQQT 3DHQA 1IZ6A 5E1FA 5M5WH 1I4RA 1YHAA 5C5LA 3CSQA 1K3RA 2Z0SA 3K0XA 2XSCA 3A54A 1QJOA 5IOCA 5AJ3Q 1XPRA 2KEEA 1M1KC 1CFMA 1WYDA 1N36L 4G7HC 4BXXH 1JR0D 1W6KA 1H95A 1S3OA 2FMCA 4CDCC 1QE6A 1GO3E 1PH9A 4MN3A 1I6HB 3K58A 1HFNA 4IOCA 3PIOA 3K5MA 3D6WA 3GTQB 3CW2C 1H9MA 4RFBA 4DV4L 5C44H 3M9BA 1J8IA 3CPWA 5JPMC 2F0EA 3DM3A 1Q1BA 2A69C 3FPPA 1ZKOA 4O0AA 4P2CB 4HJ9A 2KQ3A 1V1PA 1IYUA 1YEZA 3HOYH 3GTPB 4FF4A 5I2XA 3FKIB 4AQYL 3J7AF 2F0IA 2RCFA 2K33A 3KOJA 1Y1VB 5D65A 4DAYA 4JBWA 1YNJC 4KTAA 2EYOA 4LUZA 4FVMA 4F7XA 1GUGA 1SE8A 2NVYH 3ZJYC 5ISRA 2XVSA 1JICA 5JJKA 2PZTA 5LMUQ 2A73B 2EIFA 4PZ7A 1JB3A 1QZHA 5ELEA 2KCMA 1S5DD 1MJCA 4IPCA 4WJ3M 3U4ZA 3TP6A 1YNND 1V1OA 4KY5A 5E3FA 1AZQA 1S5CD 5EPKA 1RCVD 5IWAL 3I4NB 3T1YL 3BVZA 3H3VI 3CCVA 4EQOA 4JBJA 5LMNW 1U4PA 1FVIA 1XXGA 3RZDH 2SNMA 1N36Q 4K0KL 3EN2A 1KHIA 1DGSA 4ZCKA 2YU9H 1X9NA 2EJMA 2KBNA 3GTGH 3I91A 3RR5A 3AEVA 2JA8B 2E8GA 3BZCA 2AQ2B 1G2TA 2WKCA 1PTOF 1CKNB 2KUMA 1E24A 2Z6KC 4K2LA 4K6LA 1I3QH 2KA7A 1M8AA 3GTKB 2CCZA 1TS3A 3D8GA 3R8BA 4JI5L 3T1HQ 1PZID 4I65A 3NELA 3NTIA 3LGJA 5IGGA 2JK8A 4OEMB 4JI2L 1BCPF 4ODGA 3TDQA 1AP0A 4AQYQ 3BZKA 2VZAA 3J80E 4Q5VA 4PMCA 3EQLC 1PHJA 1WI5A 3CCRA 3CC2A 3GTJH 2E76C 3F2UA 1JOKA 5IYCG 1X6OA 1IBKQ 4JBWM 4IZ8A 1KRSA 1B70B 1SSOA 4TRDA 3TS2A 4POGA 4M1UB 1HNZQ 4DFAA 3TZUA 2F0TA 3UI2A 1IL2A 4C1NI 3M4OH 1VQCA 5FKAC 1X55A 3NBHB 5I2YA 1D8LA 3HOWB 1OXUA 4KD3A 2F3IA 3Q0AA 3M3YH 1BNZA 3H0GH 3L9AX 1M4VA 1N8RC 1RL2A 2L1BA 3T1YQ 5FLMH 2PQAB 1HQRD 1O7ZA 2UXBL 3AMUA 1K0RA 1GLAF 3CRLC 1WCMB 4LAAA 1V9PA 2EE1A 2MUYA 3EJIA 4L6TB 3CMAA 2B8GA 4K0KQ 3RUZA 4KI0A 1I4HA 1HNWL 4CJ0B 1EY6A 4ZYSA 2BH8A 4A3BB 1PH1A 2AUJD 2DJGC 1E22A 2XN9C 4QP5A 2WACA 2ZXPA 3OTOL 3BZDB 2Q2HA 3H91A 3HOXG 3HOVB 2F3WA 4HEDA 1Z7TA 3ERQA 4CHTB 5A2QE 1IBLL 2UXDL 1HUNA 1E2ZA 1H9KA 4LJZC 4DK1A 1VQHA 1QZGA 1D2BA 5DNFA 3QB3A 4IFDJ 1IYJB 4A3MG 2N3SA 1HJPA 4Q0FA 5FLXE 5IP7G 2ICIA 1SLJA 2PO4A 4JI2Q 4XQJA 3F8TA 4O42A 1F9RA 1K3BC 4DAVA 1D1IA 2R93B 2R92G 2BE5C 4ID6A 4FF3A 1BF4A 3CQZH 2K52A 5IIFA 3MA2B 5FJ8H 1A2TA 4A93H 4A3EB 1EYDA 2C5CA 2NBFA 1UE6A 2M2LA 4A3DG 3CCQA 3HOZG 3STBD 1NY4A 5H1SE 4HSVA 4YWKA 5CV5A 4GKKL 4JVZA 3KFUA 3HS0C 1L0WA 4G57A 3TP8A 4I7ZC 1EEID 3DMUA 2F4IA 3LX0A 1Q1EA 1X65A 4G7OC 2DN8A 1PV4A 4AYBE 2UXBQ 2BDNA 2NWGA 4BBRG 3JAMc 5I4DA 2FFKB 2K5HA 2RDFA 4OO1G 2AQ3B 3NK9A 1DXMA 1TWAH 3J80i 1HNWQ 4BY1H 4TQUS 1ZYRD 1ASZA 2HIXA 3OMCA 3FVQA 4Z9CB 3S14H 3IAYA 3BYYB 5A35A 3CMEA 4R4OA 1CI3M 4OWTB 4NB3A 3O13A 1A62A 3T16A 5C3WA 3MXPA 4N9TA 3SK5A 4C3JH 1IBLQ 1JORA 2NN6I 3I4LA 2WINB 2PI2E 3V05A 1NE3A 1VQEA 1PYSB 1DONA 5IYBH 1STHA 3I72A 3S1RH 3G6EA 3H3VC 1VS0A 2F1MA 4A3JG 4ZAIA 4LF8L 5M5WB 3PIPA 2RBMA 4J15A 2D62A 4HJAA 4C56C 1KAWA 4CGYB 1TWFH 5I6YA 1TU2B 1UE1A 4DGZA 1B8AA 2QEXA 4B3RL 1KDBA 1JMCA 1RHPA 2B39A 2YTVA 1NNXA 2PQEA 2X69A 3K80C 3R93A 1MIUA 3MTSA 4XQQA 1GVPA 2WV6D 1U5KA 4GKKQ 2XWJB 1A15A 4LFBL 1NSNS 1OXSC 3HRZC 1VMCA 1HA6A 1PH6A 1NR4A 2JP1A 2F0QA 1EY0A 5C44B 5CORA 2G9HD 1MKHA 3S1MH 4B3SL 3CAMA 3U9OA 3B6YA 1TR5A 1EYGA 4DA2A 2F4VL 1K0SA 4XIGS 4OO1I 3RZOH 1NCVA 4IUPA 1EEFD 1G8ZD 2B2YC 3K6OA 4KLKA 3DLLA 1SYBA 3HOYB 2OTJA 3ERSX 2OWOA 1S5BD 2VY3A 1ZXTA 1SMXA 2VXWA 4J1MA 2IJ0A 4R4IA 3K7AH 3KDFB 1VQAA 1PRTB 2B2YA 4LF7L 2NVYB 4BH5A 1H9RA 4GNXB 2WB1G 2EY6A 3MC0B 4LF6Q 3MAQA 2VUMH 2CVRA 3MFYA 4PG3A 5C4XG 4KKUA 2D0OA 4BY7H 3ND9A 1LTLA 5E4WC 4A3CG 5ELDA 4BBSH 2GN5A 4LF8Q 2MO1A 3QR8A 1H9SB 2SOBA 3J7ZC 5L37A 1JOQA 5J39A 3M4YA 3E0JA 3ER0A 2I46A 3RZDB 2ENBA 5KNCA 4ABNA 3ULJA 4A3LH 4LW1A 1VQOA 2XIWA 2YU9B 1QNKA 3L0OA 3GTGB 4ZYBA 4DV5Q 2KHIA 4PMBA 4JI0L 1CQFA 2EY2A 2H1EA 4DR4L 2WAQG 3C1FA 4J8QA 3CF5A 4LUVA 5F2DA 2QF7A 1SE4A 1WTXA 4IFDG 3C1EA 4KKSA 2E2DC 1MHWC 1J5EL 4EGVA 1I3QB 4B08A 1CUKA 4B3SQ 3Q6SA 4A75A 5HGTA 4QY7A 1FJGL 1OXXK 2F4VQ 2HDLA 4HTHA 2OCEA 2C35B 4FXDA 1K8GA 3F1ZA 3ND8A 4C3HG 4YHHL 2KCCA 2QA4A 2A68D 1SN8A 2Y0SE 3G7LA 3J81E 1VF5C 4LFAL 4AH6A 3K5LA 4KJNA 3GTJB 3DWQA 4E6IA 4A3IG 2DY7A 2CH4W 1SYFA 1W6JA 4U673 1F3GA 1IKLA 1B9MA 4LF7Q 2B63G 1EY9A 1QILA 1RIPA 1UNSA 3CPFA 3OIQA 3M4OB 5K36G 4DV1L 3I3CA 3MXNA 4POFA 1OXVA 4LWCA 4RHRA 3U58A 4DV7L 3M3YB 3BYTB 2EYFA 1IW7D 3H0GB 4HJ5A 4LK1C 1GJXA 2VQFL 1NMFA 4L5QA 4NW2A 3TRZA 2GVBA 1VQ6A 3TREA 3TUFB 4JC0A 1BBUA 5J1ZA 4X65L 4R8IA 4HIDA 1KXLA 3FRPB 2O5JC 1V8QA 3R2TA 2WIIB 1ASYA 3QOJA 4DR4Q 4IFDI 2OQ0A 3PUVA 1EQVA 1NBWA 5CV9A 4KHPL 1AH9A 2JA5G 1X3GA 2WKDA 4GN4B 3KF8A 4YWMA 2IPKD 1PZKD 3W5OA 2ID0A 5KYIA 1RD9D 1AE3A 3Q22A 1PA6A 1FJGQ 1VQBA 2AQ1B 4F88A 3VR3A 2K4KA 3TN2A 4DUYL 2JA7G 1R4PB 1HZAA 5IGEA 5GROA 5IP9G 2NZHA 3PIO3 1N33Q 3H09A 1QVGA 3TQYA 4YHHQ 1LUZA 1GD7A 3U4VA 2F3VA 4X3UA 2ES2A 3NQTA 5GAGC 4FF2A 2K75A 2AWNA 3CQZB 3MXGA 4H13C 2SEBD 4RHSA 2FMMA 4AIMA 4A93B 3KK7A 4PZ8A 2CW0D 2NZOA 1Y8NB 4G4KA 4R4TA 1D5MC 3S16H 5EPLA 4GLXA 1STBA 3NQIA 4Y7NH 5M9OA 1Q7YC 1HR0W 2K14A 1WFQA 4K5WA 2FINB 2KHJA 4B9WA 2K50A 4DV7Q 2UUBQ 2FXQA 3OW7A 1W3SA 4IPHA 5ELBA 3X3MA 5JEAJ 3W3AA 4GKJL 3N6RA 3VYTA 2VQFQ 1WD0A 1JT8A 1BKBA 3MHBA 1PXUA 2F0PA 4QJFA 1BBXC 1GLEF 1MD2D 1VMPA 3Q8DA 4DF7A 4F87A 3SK8A 5KVPA 4QGUA 4UDUC 2AUKA 1HZCA 5CR3A 1WTHA 5CV8A 5DM73 5LMNL 5IYCH 1TWAB 5I9PA 3J81i 5CGKA 4BY1B 4OWWB 3HP3A 4JV5Q 2MO0A 1STAA 2XNAC 3J80c 3S14B 2IT1A 5JOBA 4TKOB 1GOZA 4NXMQ 4GLAC 4KHPQ 3KF6B 2F0MA 1O2FA 1KLGD 2EVBA 3S1QH 1RODA 2E2HH 2AWOA 1S72A 4LXCA 2F0SA 2PNRC 1WTQA 1LV9A 1MGSA 1KL9A 1X3QA 3WDNA 4C3JB 1HHVA 1IL8A 2KHSA 2KOLA 4UPAA 3PV0A 1KRTA 2JEAI 4DUYQ 4LFCQ 1N9WA 2D2CC 2PMZB 1GUNA 1MBYA 2ZJRA 3S1RB 3J7AV 2F03A 3CU7A 1I94L 4XT1B 1TIID 3C2PA 4GZYC 1RKNA 3SK6A 4JI4L 2O4XA 2Y0SB 1SR3A 1O78A 4DR7L 1TWFB 2JEBI 4YCVA 3T51B 2CW0C 1F9PA 4P75A 3KBXA 1A3VA 2AHOB 3MEFA 4GOPC 2JSOA 3SGIA 3S15H 2CWPA 3HOXH 5CBAE 1VQLA 3PO3G 4A3GG 3NWSA 4UAIA 2IHFA 4TSSA 2H4OA 4RGOS 2AKWB 4GKJQ 4N8FA 2F52A 4GOPA 4KHVA 3S1MB 5M3MG 4A3MH 2HUGA 5IP7H 3HFZB 4DR6L 1CA5A 2B8FA 3RZOB 2R92H 1CT1D 2LKVA 1SNOA 3QWNA 5GQOA 5FLXc 2JA7B 2QILA 1HNXL 3F2DA 4IURA 3NEMA 2PI2A 2SNSA 1EQRA 4X3KA 4OIKA 1X3EA 4JI8L 3EVQA 3JC66 5CC4A 2UUCL 3AFQA 3K7AB 1QCBD 4WFN3 4LF5L 4A3DH 3HOZH 1PTOH 2MP1A 2YYZA 4V190 1VQKA 2MFIA 2O2LD 5IT9E 2A1AA 5CYUA 2VUMB 2N88A 5DLQE 2F0HA 3ONAB 4QUCA 5IGDA 2QEJC 4BY7B 1BVSA 2CQOA 4BBSB 4ME5A 4BBRH 4XDXA 1DOKA 1CK1A 1PYWD 3CCJA 4OO1H 1LTBD 2B3GA 4JI4Q 1V1QA 4R1JA 4DV0L 4DR7Q 1R9TH 4DK0A 2JJQA 3BJUA 4B3ML 3D31A 3DEOA 4GLVB 2Q2UA 1D1KA 4TVAB 5C3XA 2FHTA 5COYA 1S4ZA 1E2WA 2M9VA 4DV4Q 2LMCB 3HGBA 4PQXA 2Z1CA 4A3FG 1Q3LA 1TKWB 4KY7A 4IUNA 4LF9L 1K28A 2L5TA 3ZYYX 3L3OC 3PUXA 5E7NA 2Z6KA 2CFMA 5M5XH 4P71A 5JVH3 2JA6G 2PZUA 4A3JH 2LS01 5EKIA 3SEBA 1EYAA 1KQSA 4PZ6A 3I56A 2RQXA 3AU7A 1GLDF 1JWSD 4P72A 1GPRA 2TMPA 4KN4C 3URYA 3WOFA 1DJRD 2NTTA 3M7NA 3TBIB 1K73C 1O7IA 2ZTEA 1F9SA 1VQFA 1C0AA 1YNNC 1FGBD 1W2BA 1PFMA 5DM63 5C4JH 2EYJA 1EWCA 3P1HA 3K5NA 5JEAG 5IWAQ 3PF4A 1LACA 5KNBA 1QNUA 4HMIA 1TS2A 1JC7A 5GAEC 1CA6A 2Z6BA 1YBYA 5C4ZA 3PO2G 3S2HH 4DK6C 3NXWA 3QO2A 3BDLA 3PO3B 1WTWA 3GTLH 5CV4A 3VYSA 2X6LA 3VYUA 1UE5A 3X3NA 1WOCA 1L1OB 4WORA 4DV0Q 4HMJA 4NXNL 4MZ9A 4B3MQ 1SNMA 1KDCA 2KECA 4XYQA 1KAAA 4U68A 3PIP3 4KJOA 2CQAA 2MPMA 2NVTH 3ULPA 1B53A 1XMQL 2HSIA 2R7FA 1A2UA 2K5WA 2NN6G 4JI5Q 4O1NA 4CKCA 3UZ0B 1AX3A 5C3EG 2N8NA 5IE8A 1ENAA 4APVA 4LF9Q 1EZ8A 3VR2A 2V1CC 1LT4D 1YJNA 1VQIA 2L55A 5C4XH 1E3PA 1K8OA 4IJHA 4A3CH 1BR9A 1LT6D 3V96A 1DZ1A 4PNYA 1I4GA 2ALYB 3D4RA 4M8AA 1XYIA 4C2MH 1ML0D 1J6QA 4JI3L 1K83H 4HSPA 4IUUA 5J3BA 5LL6X 3KLSA 1DOLA 2UU9L 1B9NA 2D9UA 3FPUB 2DUDA 2V4DA 4L5SA 5CV7A 1X3PA 4IN3A 3OURB 1BOSA 3L2PA 1RF2D 1TWHH 3SE0A 2DNCA 3K8AA 4RCNA 2Z4HA 3K59A 1AE2A 2LXKA 1CZGA 3JAML 3S16B 4IFDH 1LTAD 1E0BA 2QKIC 4Y52H 4FP5D 4Y7NB 3I70A 2A6HD 1FNUA 1EOVA 1M90C 2EY5A 5HGQA 1KD1C 5EAYA 3HOUG 2D5DA 3EA6A 3RNUA 1UEAB 5CBEE 1GM5A 2R61A 1WTOA 5JPNC 4DR1L 3IFTA 1BXTA 5HURA 2CWAA 3HKZG 4JI6L 2Q8RE 4C3HH 1TWCH 1BUVT 4QL5A 1SRUA 5CV6A 3OTOQ 1SNCA 4R9WA 2CH4A 1KDAA 1AN8A 4C1NK 2G9DA 3OIPA 1Y1WG 1PH2A 3PUZA 5D3IB 4A3IH 1B3QA 2UXDQ 1QVCA 2KCNA 2B63H 3SHLA 3MXNB 3J81c 3FHWA 3D6CA 4ZRZA 2A5HA 3OMGA 5FO9B 2OTLA 4QIWB 5K36H 3S1QB 2E2HB 5C5MA 2I0QA 4X3TA 1MI2A 1EIGA 1Q82C 1TY0A 1R4QB 2IX1A 1SDFA 2EJGC 1JE4A 1F2MA 4AYBG 4GS3A 3NTHA 3RLFA 2E2IH 1JJCB 3UDIA 4R8NA 3OPOA 1SYDA 1RTNA 1TT2A 3S17H 3STBC 3RN5A 4HIOA 3CC7A 2M00A 3OSOA 3P75A 2Q2TA 1VQJA 1F2LA 3ULLA 4A3KG 2OXPA 2K6AA 3NPPA 4RGNA 3KF8B 1IKMA 5M5YH 1EY7A 3I4MG 4EQ5A 2JA5H 1LABA 1TVXA 2H5XA 3MWYW 3HOXB 3S15B 4DAMA 3S9WA 2WB1E 2RF4A 3IKJA 4DR5L 2VL6A 1ILPA 5DAUA 1I6VC 2EDGA 2QDBA 4QF4A 4S3SA 3G48A 4XTCS 2JA7H 1ZYRC 1PH8A 3NBIA 1NAPA 1Q46A 4A3MB 5IP9H 4DR1Q 3NBHA 4IQZA 2ZTDA 2EYLA 3TS0A 1CZWA 4HN7A 4JYAL 5E4XA 5KIXA 1LM0A 4RGTA 3QG1A 3J7YW 3OW2A 2R92B 3NTKA 3U9SA 2IX3A 4FYDA 1YI2A 1ET6A 1G51A 2PQAA 5C0XJ 1JOOA 4DR3L 4WJ4A 1ENCA 2LY7A 3NWTA 4H02A 2C9OA 4EX5A 4GN5A 4FF1A 1IBML 1CQVA 1K8AC 2XTIA 3A7AB 3GP7A 4A3DB 3HOZB 4HIMA 5T1IA 4C3IG 3PQIA 1PTOB 2HDMA 1Y14B 1KTKA 1DOMA 2G5DA 1PH3A 2EQSA 4KV6A 2KCTA 1PVOA 1MJEA 4JG2A 3TP7A 3ICEA 2ZT9C 3A8IE 4B3RQ 4CDFC 1CHQD 3IT5A 4BBRB 1Y8PB 3T13A 2F0GA 2PNHA 1HFGA 5FO7B 4IUQA 1BCPB 1EYCA 3RMHA 2AMCB 3MVVA 2NUCA 2QDLA 3IL8A 1ILQA 1R9TB 2R7ZG 1ZEQX 2RSNA 3HKZB 3BU2A 4X6AH 1II3A 4ZQ3A 5KGUA 4K8JA 4LFBQ 3MFGA 2L0CA 1B3AA 2QW7A 4FXKC 2BA1A 4QB4A 2IHEA 2P5ZX 5KEEA 2PPBC 5I6WA 1LO5D 3AYHB 3CCUA 3SXHA 4BWGB 1SE3A 2PMZE 1FR3A 2OEOA 2BDOA 1CSPA 3VR4A 2F0UA 1TQOA 2NYZD 5M3FG 3H3VH 2A74C 1S5FD 3LWEA 5M5XB 3IRBA 4A3JB 1MSHA 1RJTA 3AQQA 5JJZA 3NE5B 1BDOA 1T9HA 3AB9A 1QOHA 4QQBX 5C6AA 3KJPA 1EFWA 3D0FA 3GTMH 4DR3Q 4N8X1 2OT2A 3G4SA 3CD6A 2IW3A 1SYCA 4QCLA 2R7DA 5C4JB 4DAPA 1LTID 1PRTD 1NJIC 4RNZA 1V1PB 3C3LA 4ZUJA 3PO3H 1VQPA 2F0NA 3D4DA 5ELFA 4DXFA 3GTOH 3RLNA 4A3GH 3GO5A 3N52A 1VF7A 3QIAA 1FNWA 5BR8L 4DAYB 5M3MH 5DEHA 3DUZA 4G7ZC 3S2HB 1JWUD 4DUZL 5JJLA 2L15A 3GTLB 2BH2A 1A63A 2ZXOA 4CKEA 2VS1A 3PMFA 1JCKB 1Q12A 3NP8A 3TEHB 1GKHA 1Y69U 5LL6S 3K5OA 4OONA 4JI0Q 4CJ1B 3GV6A 4ZKCB 3I4OA 4K2KA 1O80A 1DD2A 3AFPA 3SR1A 4JPBW 2HT1A 4OIJA 1J5EQ 1HUMA 3VR5A 2IY5B 1EQQA 2NVTB 2HD3A 3DWAA 1O7LA 1SJED 2QGQA 4DV6L 1HTLD 1G6ZA 1LYLA 2Z9HA 1N34L 1Z47A 2MQHA 2WB1B 4FDBA 1B4OA 2A6ED 5GADC 2ZM6L 5IT9L 5FO8B 4XXEA 3D4WA 5EKLA 2A68C 4DNRB 3T56B 1VQMA 1EQTA 4L5TA 5C4XB 2JN4A 1XTCD 2HIVA 4HCEA 5IT9c 1D7QA 3FKIG 4LFAQ 2I5HA 3OYYA 1TS5A 4BA2I 3L7ZC 1Y1VG 1EWHA 2Z8LA 1U4RA 4C2MB 1C4QA 1NUCA 1K83B 2OF1A 3M4QA 1WJJA 1CSQA 4ILWA 5EQ0A 2LFNA 2J0TD 1YIJA 2B2UC 2B13A 1PFNA 4DV1Q 1PRTC 3A5ZB 1IW7C 3U50C 1TWHB 4GNXC 1RDPD 1PYBA 2RHQB 4A3FH 1QUQA 3GQBA 2WAQB 3HEJA 1Q86C 3TMEA 1QVFA 1HTPA 1ICFB 4NKLA 4EQNA 3I4NG 3KDFA 4ZKBB 2RSOA 1E7ZA 2B2UA 4CKBA 1C9OA 2JA6H 1A6XA 2VNUD 3CP0A 3D3RA 4DUZQ 1LLRD 4GNXA 1PFBA 5IYDG 4X65Q 3J80L 3CCLA 5C0XG 4OX9L 1GXDC 2XWBB 3V2TA 3WOEA 4RCOA 4DNIA 4C3HB 1TWCB 2A69D 4JI7L 3S1NH 1XJVA 1EFID 2JA8G 4OHJA 1H9SA 4YWLA 1E1OA 5BN3A 4A3IB 1FL0A 2RA4A 3VYRA 1KC8C 1STNA 4DV6Q 1XMOL 1WTRA 2B63B 3KUPA 1YNJD 3A55A 5JEAH 2GVAA 2HQEA 1CHPD 4L63B 2L9HA 2ZM6Q 3EROA 2E2JH 1UEBA 2FJ2A 4K5XA 1WD1A 4R4CA 3PUYA 3PO2H 2I5MX 3VR6A 2K5DA 1SEBD 5EGTA 4DK3C 1C7YA 2PW5A 5ELNA 3T53B 3LWUA 2E2IB 4EVOA 3E5SA 1EL0A 1EU4A 3NHHA 1SFOH 3H94A 1SXTA 1QG7A 3S17B 2EJFC 1EOTA 1UUPA 2WP8J 1S40A 5A2QL 1N32L 4X62L 5M5YB 2RDHA 3S24A 3HOWG 2NN6H 1F9QA 2K5NA 2JA5B 1AEXA 5C3EH 1HRJA 2F3GA 2Z4IA 5D3DA 5FLXL 3ITPA 4ZLTF 1B50A 5B0HA 1XNQL 2RHSB 1WCMG 5C0XI 1OTCA 1C48A 2EXDA 5LMNQ 4OX9Q 3H15A 4DPGA 2A8VA 3T1HL 5AFWA 3SLUA 2K28A 1VQ9A 2F0FA 2DJFC 2K1BA 4JI7Q 1IYVA 1UAPA 3QJYA 4A3BG 1PMRA 1JQYD 4A76A 4KHZA 1C8CA 1EZ6A 2J7ZA 1XTDA 4LF4L 5IODA 3HOVG 5EBDA 2NVQH 1JE5A 1XMOQ 1IBKL 1B44D 1HNZL 2K01A 3P7JA 2KVMA 1UE7A 5EBCA 1YHBA 4H0LC 1I94Q 1JJ2A 3HOUH 1VQDA 1EY4A 4ALPA 3T4AC 2R93G 4UHVA 4XYOA 2F0WA 3F2BA 1A0IA 4HJ8A 1SE2A 2JA9A 2JQOA 3CCEA 2Q2IA 4XT3B 3CXCA 4YCUA 4A3EG 3CC4A 5EJWA 3UDFA 1PH4A 1PRTF 1X3FA 2BA0A 3FDTA 5K5PA 3W1GA 1Y1WH 1TS4A 3KJOA 5KRUA 4ULLA 3VDYA 2B2VC 4QIWE 4UP7A 1N32Q 1LTSD 4X62Q 4IOAA 5IY0A 1GLCF 4DU9A 1AW7A 1TY2A 1U0LA 5EPJA 2JXMB 3TZDA 1X32A 3E0EA 4DR6Q 2LXJA 2BOSA 4CDDC 4BA1I 2DGYA 4MTNA 1XNQQ 1AFPA 2B2VA 4JBKA 3J7A5 4KMUC 1HNXQ 1O7YA 4JCVE 1HCZA 1YNXA 5ELCA 2NB0A 1IXRA 2NTSA 4JI8Q 1ESFA 1LTTD 2B44A 2ASBA 2UUCQ 4LF5Q 4JI1L 4LF4Q 3CKIB 3GTMB 2XGTA 3RD4A 2J4XA 2EPBA 4A3KH 1PFSA 2BE5D 5GAHC 3HG9A 3I8ZA 1HZ9A 1KABA 3EFXD 1EY8A 3I4MH 3UE0A 4IO9A 4RG1A 3A5UA 1T5XD 1I4PA 3BVGA 1F2ZA 2Q8TA 4A3GB 4KY6A 3GTOB 1L0YB 3GD7A 1F77A 4MIUA 3KF6A 1CM9A 4XQNA 1PDQA 5M3MB 1Q8KA 1GUOA 3I2ZA 2CKZB 3TSSA 4OWXB 3IT7A 3BVMA 5EKKA 1B2TA 3CRKC 1XWEA 2K5VA 3SK4A 1STYA 3M4PA 1VQGA 4HR7B 4LUOA 4K5VA 3PUWA 4BXXG 2GPRA 5LHY1 1JB7A 5JJIA 3HZXA 3S2DH 1XPOA 1VDZA 1X56A 4K14A 2ATWA 2K7VA 4P74A 5NUCA 4X64L 1LT3D 4C3IH 5IGCA 5C44G 2LSSA 2YTXA 3BG3A 3OOCA 3UDXA 1S5ED 2RDGA 4YCWA 4A4IA 5TSSA 2EYPA 1SAPA 1XPUA 5G3LD 2K05A 2MJ8A 2TSSA 3HOYG 4PV1C 2ZTCA 3HKZE 3PGZA 5FK9C 3BS1A 4JI1Q 4JW0A 4KKTA 2R7ZH 4X3SA 1SNDA 1Z6HA 3CHBD 4MTKA 4DV2L 5C4HA 2K5QA 3I90A 4MHEA 3SVMA 1VQ7A 2E5LL 3DXJC 2IWHA 3NENA 3E9HA 1XX8A 2EY1A 4WRDA 4A3FB 1HH2P 2KEDA 1CKMA 1J9OA 1D5XC 2DY8A 1KNAA 5T1GA 1I50H 1DM0B 1BO0A 1TWGH 5M3FH 2R3ZA 5J22A 1GUWA 3NUCA 1T5EA 1Q8IA 3K57A 4B3TL 2JA6B 4NXNQ 3R2IA 1GHJA 2UUAL 2XRQD 3PSIA 3J81L 3GV3A 1WVLA 5BN5A 4CBVA 5IGFA 1OXTA 5CMDA 4NMZA 4DKAC 2B0PA 1B1ZA 1XMQQ 1VQ4A 3S1NB 1E2VA 1FYCA 1A3UA 1P8LA 2NVXH 4YIJA 1DCZA 3GDEA 4B9XA 3FEWX 4DV3L 1SMYD 2HQLA 4X64Q 4DXGA 1VCIA 1Z9FA 1PH5A 1U4MA 3OWFA 1STEA 4IALA 3W1BA 1VQ8A 3A0JA 4H7BA 1CKNA 2YTYA 2R6GA 1K8MA
chains in the Genus database with same CATH topology
2E2JB 1G91A 2MHVA 2K03A 3PO2B 1SJHD 4RKLA 3QOLA 3KBGA 2L4NA 2PCFB 3BDOA 3K0YA 1G2SA 1SFOB 2A6HC 5IGBA 4IUVA 4NDXA 4V0BA 2EXZA 4FO2A 2F0JA 5JVG3 1GUSA 1H9JA 2VB3X 5C3EB 2I07B 4IUTA 2O5IC 5BN4A 4QMGA 1EU3A 2ICEC 4KN7C 4RH6A 1L0XB 2HCCA 2JYOA 2L11A 1SMYC 2VB2X 4K6DA 1KNEA 4BS9A 2NVQB 2IX0A 3M85A 1Q90A 4J6HA 2DNEA 3A56A 4RAUC 1U4LA 2PZWA 1I4XA 3IFDA 2NZ1D 3HOUB 1D6EC 5C0XH 3DWPA 2L12A 3LNNA 3Q24A 2ZXRA 1FD7D 1V43A 5JAVA 2MP0B 3A7LA 3G6JB 3OWEB 1Y1WB 1EY5A 2RVLA 2K32A 4DNTB 1JWMD 2F0DA 3I73A 1HPCA 4ZK9B 1SNQA 1STGA 1GLBF 3JAME 2XRSD 2JE6I 5FOBB 3E6ZX 1FNVA 2PW7A 2PYKA 3C46A 3A8JE 1I4QA 1LTGD 4AYBB 1U9RA 2F0OA 2EOTA 3TP5A 4EQPA 1F3ZA 5I9OA 4FNFA 5KYLA 5KNDA 3R3OA 4FXGC 4A3KB 1CTMA 3DEPA 2X6GA 4C3JG 4QPBA 3I4MB 3MEHA 4JK1C 4QUFA 3MZ5A 2GU1A 1D5ZC 1KLUD 5G3LF 1PTOD 4CJ2C 1DYQA 4ZUIA 5D14A 1A3TA 1QB5D 4OL7A 1GGRA 4F8MA 2HCIA 3VA7A 2E75C 4L8JA 2CHBD 1WTPA 2SDFA 1BCPD 1F2YA 2EYMA 4H44C 2Q8IB 2B2TC 3S2DB 2GA4B 4NP5A 2F0KA 4C3IB 1ENFA 3MXUA 3BDCA 2F0LA 2B2TA 1SNPA 1MSGA 2KJXA 1G291 1GUTA 3VA5A 1SYEA 2E74C 4KK7A 3A8KE 4RWSC 1SYGA 1OO9B 3OHXC 4N9PA 4DN4M 1RTOA 3M7GA 3KLRA 4HAEA 2R7ZB 1NR2A 2MGSA 4OGQC 4PMWA 1LT5D 2N55A 2RKSA 4K8IA 3P20A 1LTRD 3FMCA 1PTOC 1HA5A 2IL8A 2F0VA 1GHKA 4WJWA 1SBBB 3Q23A 1ESRA 1I50B 1EIHA 1TWGB 5M3FB 3H6MA 3SDZA 4RNYA 4RGMA 1Y8OB 4RKBA 1HXYD 2B2WC 3NYYA 2K04A 1BCPC 1ICWA 3NSWA 3W2DA 1PLFA 1ONLA 1HQMC 1PZJD 1ET9A 2EYHA 2EZVA 2QCPX 2A6EC 1AZPA 2NVXB 4LMQD 2B2WA 4KD4A 1WTVA 1IHZA 3DM1A 4RA8A 1QWYA 2BCOA 4HCSA 3KLSX 1BQQT 3DHQA 5E1FA 1I4RA 5C5LA 3CSQA 2XSCA 3A54A 1QJOA 5IOCA 2KEEA 1CFMA 4G7HC 1JR0D 1W6KA 2FMCA 1QE6A 4MN3A 1I6HB 3K58A 1HFNA 3K5MA 3D6WA 3GTQB 4RFBA 1H9MA 1J8IA 5JPMC 2F0EA 1Q1BA 2A69C 3FPPA 1ZKOA 4P2CB 2KQ3A 1V1PA 1IYUA 3GTPB 4FF4A 5I2XA 3FKIB 3J7AF 2F0IA 2K33A 1Y1VB 5D65A 4DAYA 4JBWA 1YNJC 4KTAA 2EYOA 4FVMA 4F7XA 1GUGA 5ISRA 2XVSA 1JICA 2PZTA 2A73B 1JB3A 5ELEA 1S5DD 3TP6A 1YNND 1V1OA 4KY5A 5E3FA 1AZQA 5EPKA 1RCVD 3I4NB 3BVZA 4EQOA 1U4PA 1XXGA 2SNMA 2EJMA 3I91A 2JA8B 2AQ2B 1G2TA 2WKCA 1PTOF 2KUMA 4K2LA 4K6LA 2KA7A 1M8AA 3GTKB 1TS3A 3D8GA 3R8BA 1PZID 4I65A 3NTIA 5IGGA 1BCPF 4ODGA 3TDQA 1AP0A 3J80E 4Q5VA 4PMCA 3EQLC 2E76C 3F2UA 1JOKA 4JBWM 4IZ8A 4TRDA 1SSOA 4M1UB 4DFAA 3TZUA 2F0TA 3UI2A 4C1NI 5FKAC 5I2YA 3HOWB 1OXUA 4KD3A 3Q0AA 1BNZA 3L9AX 1M4VA 2L1BA 1HQRD 1O7ZA 3AMUA 1GLAF 3CRLC 1WCMB 4LAAA 2EE1A 2MUYA 3EJIA 4L6TB 2B8GA 3RUZA 4KI0A 1I4HA 4CJ0B 1EY6A 4ZYSA 4A3BB 2AUJD 2XN9C 4QP5A 2WACA 2ZXPA 3BZDB 3H91A 3HOVB 2F3WA 4HEDA 1Z7TA 3ERQA 4CHTB 5A2QE 1HUNA 1E2ZA 1H9KA 4LJZC 4DK1A 1D2BA 5DNFA 3QB3A 4IFDJ 4Q0FA 5FLXE 2ICIA 2PO4A 4XQJA 4O42A 1F9RA 4DAVA 1D1IA 2R93B 2BE5C 4ID6A 4FF3A 1BF4A 5IIFA 3MA2B 1A2TA 4A3EB 1EYDA 2C5CA 2NBFA 2M2LA 4HSVA 5CV5A 3HS0C 4G57A 3TP8A 4I7ZC 1EEID 3DMUA 2F4IA 3LX0A 1Q1EA 4G7OC 2DN8A 2BDNA 2NWGA 5I4DA 2FFKB 2RDFA 4OO1G 2AQ3B 3NK9A 1DXMA 4TQUS 1ZYRD 3OMCA 3FVQA 4Z9CB 3IAYA 3BYYB 5A35A 1CI3M 5C3WA 3O13A 3T16A 3MXPA 4N9TA 3SK5A 1JORA 2NN6I 3I4LA 2WINB 3V05A 1DONA 1STHA 3I72A 3H3VC 2F1MA 4ZAIA 5M5WB 2RBMA 2D62A 4C56C 4CGYB 5I6YA 1TU2B 4DGZA 1KDBA 1RHPA 2B39A 2PQEA 2X69A 3R93A 3MTSA 4XQQA 2WV6D 2XWJB 1A15A 1NSNS 1OXSC 3HRZC 1VMCA 1HA6A 1NR4A 2JP1A 2F0QA 1EY0A 5C44B 5CORA 2G9HD 3U9OA 1TR5A 4DA2A 4XIGS 4OO1I 1NCVA 4IUPA 1EEFD 1G8ZD 2B2YC 3K6OA 1SYBA 3HOYB 1S5BD 1ZXTA 2VXWA 4J1MA 2IJ0A 1PRTB 2B2YA 4BH5A 2NVYB 1H9RA 2EY6A 3MC0B 3MAQA 2CVRA 3MFYA 4KKUA 3ND9A 5E4WC 5ELDA 1H9SB 2SOBA 1JOQA 5J39A 3M4YA 3E0JA 3RZDB 2I46A 2ENBA 5KNCA 4ABNA 2YU9B 2XIWA 1QNKA 3GTGB 4ZYBA 4PMBA 1CQFA 2EY2A 2H1EA 3C1FA 4J8QA 5F2DA 2QF7A 1SE4A 1WTXA 4IFDG 3C1EA 4KKSA 2E2DC 4EGVA 1I3QB 4B08A 3Q6SA 5HGTA 1OXXK 2HDLA 4HTHA 4FXDA 3ND8A 4C3HG 2KCCA 2A68D 3G7LA 3J81E 1VF5C 3K5LA 4KJNA 3GTJB 3DWQA 4E6IA 2DY7A 1SYFA 1W6JA 4U673 1F3GA 1IKLA 1B9MA 1EY9A 1QILA 1UNSA 3OIQA 3M4OB 5K36G 3I3CA 3MXNA 1OXVA 4RHRA 3M3YB 3BYTB 2EYFA 1IW7D 3H0GB 4LK1C 1GJXA 4NW2A 3TUFB 5J1ZA 4R8IA 3FRPB 2O5JC 1V8QA 3R2TA 2WIIB 3QOJA 4IFDI 3PUVA 1EQVA 5CV9A 2WKDA 3KF8A 2IPKD 1PZKD 2ID0A 5KYIA 1RD9D 3Q22A 2AQ1B 4F88A 3VR3A 3TN2A 1R4PB 5IGEA 3PIO3 3H09A 2F3VA 4X3UA 3NQTA 4FF2A 2AWNA 3CQZB 3MXGA 4H13C 2SEBD 4RHSA 2FMMA 4A93B 3KK7A 2CW0D 1Y8NB 4G4KA 1D5MC 5EPLA 1STBA 3NQIA 5M9OA 4K5WA 2FINB 4B9WA 3OW7A 5ELBA 3X3MA 5JEAJ 3W3AA 3N6RA 3VYTA 1WD0A 3MHBA 1PXUA 2F0PA 1BBXC 1GLEF 1MD2D 1VMPA 4DF7A 4F87A 5KVPA 3SK8A 4UDUC 2AUKA 5CR3A 5CV8A 5DM73 1TWAB 5I9PA 5CGKA 4BY1B 3HP3A 1STAA 2XNAC 3S14B 2IT1A 5JOBA 4TKOB 1GOZA 2F0MA 1O2FA 1KLGD 2EVBA 1RODA 2AWOA 4LXCA 2F0SA 2PNRC 1WTQA 1LV9A 1MGSA 1X3QA 3WDNA 4C3JB 1HHVA 1IL8A 2KHSA 2KOLA 3PV0A 2JEAI 2D2CC 2PMZB 1GUNA 1MBYA 3S1RB 3J7AV 2F03A 3CU7A 4XT1B 1TIID 3C2PA 4GZYC 1RKNA 3SK6A 2O4XA 2Y0SB 1O78A 1TWFB 2JEBI 3T51B 2CW0C 1F9PA 3KBXA 1A3VA 2JSOA 5CBAE 3NWSA 4UAIA 4TSSA 2H4OA 4RGOS 4KHVA 3S1MB 2HUGA 1CA5A 2B8FA 3RZOB 1CT1D 2LKVA 1SNOA 3QWNA 2JA7B 2QILA 4IURA 2SNSA 4X3KA 4OIKA 3EVQA 5CC4A 3K7AB 1QCBD 4WFN3 1PTOH 2MP1A 2YYZA 4V190 2O2LD 5IT9E 5CYUA 2VUMB 2N88A 2F0HA 3ONAB 4QUCA 5IGDA 2QEJC 4BY7B 4BBSB 4ME5A 4XDXA 1DOKA 1CK1A 1PYWD 4OO1H 1LTBD 4DK0A 3D31A 3DEOA 1D1KA 5C3XA 2FHTA 5COYA 1S4ZA 1E2WA 2M9VA 2LMCB 3HGBA 4PQXA 2Z1CA 1Q3LA 1TKWB 4KY7A 4IUNA 2L5TA 3ZYYX 3L3OC 3PUXA 5JVH3 2PZUA 2LS01 5EKIA 3SEBA 1EYAA 2RQXA 3AU7A 1GLDF 1JWSD 1GPRA 2TMPA 4KN4C 3URYA 3WOFA 1DJRD 2NTTA 3M7NA 3TBIB 1F9SA 1YNNC 1FGBD 1PFMA 5DM63 2EYJA 1EWCA 3P1HA 3K5NA 5JEAG 1LACA 5KNBA 1QNUA 4HMIA 1TS2A 1JC7A 1CA6A 5C4ZA 3NXWA 3QO2A 3BDLA 3PO3B 1WTWA 5CV4A 3VYSA 2X6LA 3VYUA 3X3NA 4WORA 4HMJA 1SNMA 1KDCA 2KECA 4XYQA 1KAAA 4U68A 3PIP3 4KJOA 2CQAA 2MPMA 1B53A 2HSIA 1A2UA 2K5WA 2NN6G 4O1NA 4CKCA 3UZ0B 1AX3A 1ENAA 1EZ8A 3VR2A 1LT4D 2L55A 1K8OA 1BR9A 1LT6D 3V96A 1DZ1A 4PNYA 1I4GA 3D4RA 4M8AA 1XYIA 1ML0D 4HSPA 4IUUA 5LL6X 3KLSA 1DOLA 1B9NA 2D9UA 3FPUB 2V4DA 5CV7A 1X3PA 4IN3A 3OURB 1BOSA 1RF2D 3SE0A 2DNCA 4RCNA 3K59A 2Z4HA 1CZGA 3JAML 3S16B 4IFDH 1LTAD 1E0BA 2QKIC 4FP5D 4Y7NB 3I70A 2A6HD 1FNUA 2EY5A 2D5DA 3EA6A 1UEAB 5CBEE 2R61A 1WTOA 5JPNC 3IFTA 1BXTA 5HURA 2Q8RE 1BUVT 5CV6A 1SNCA 4R9WA 1KDAA 1AN8A 4C1NK 2G9DA 3OIPA 3PUZA 5D3IB 2KCNA 3SHLA 3D6CA 4ZRZA 2A5HA 3OMGA 5FO9B 4QIWB 5K36H 3S1QB 2E2HB 5C5MA 4X3TA 1MI2A 1EIGA 1TY0A 1R4QB 2IX1A 1SDFA 2EJGC 1JE4A 1F2MA 3NTHA 3RLFA 4R8NA 3OPOA 1SYDA 1RTNA 1TT2A 2M00A 3OSOA 3P75A 1F2LA 2OXPA 2K6AA 3NPPA 4RGNA 1IKMA 1EY7A 3S15B 1LABA 1TVXA 3MWYW 3HOXB 3S9WA 3IKJA 1ILPA 5DAUA 1I6VC 2EDGA 2QDBA 4QF4A 4S3SA 4XTCS 1ZYRC 3NBIA 1NAPA 4A3MB 3NBHA 4IQZA 2EYLA 1CZWA 4HN7A 5E4XA 5KIXA 4RGTA 3J7YW 3QG1A 2R92B 3NTKA 3U9SA 2IX3A 4FYDA 1ET6A 5C0XJ 1JOOA 1ENCA 2LY7A 3NWTA 2C9OA 4FF1A 1CQVA 3A7AB 3GP7A 4A3DB 3HOZB 5T1IA 4C3IG 1PTOB 2HDMA 1KTKA 1DOMA 4KV6A 3TP7A 2ZT9C 3A8IE 1CHQD 3IT5A 4BBRB 1Y8PB 3T13A 2F0GA 1HFGA 5FO7B 4IUQA 1BCPB 1EYCA 3RMHA 3MVVA 2NUCA 3IL8A 1ILQA 1R9TB 1ZEQX 2RSNA 3HKZB 1II3A 4ZQ3A 5KGUA 4K8JA 3MFGA 2L0CA 1B3AA 4FXKC 2BA1A 4QB4A 5KEEA 2PPBC 5I6WA 1LO5D 3SXHA 4BWGB 1SE3A 1FR3A 2OEOA 2BDOA 3VR4A 2F0UA 1TQOA 2NYZD 2A74C 1S5FD 3LWEA 5M5XB 4A3JB 1MSHA 1RJTA 5JJZA 3NE5B 1BDOA 3AB9A 1QOHA 5C6AA 2OT2A 2IW3A 1SYCA 4QCLA 5C4JB 4DAPA 1LTID 1PRTD 4RNZA 1V1PB 3C3LA 4ZUJA 2F0NA 3D4DA 5ELFA 4DXFA 3GO5A 3N52A 1VF7A 3QIAA 1FNWA 5DEHA 3DUZA 4G7ZC 3S2HB 1JWUD 3GTLB 2ZXOA 4CKEA 3PMFA 1JCKB 1Q12A 3NP8A 1Y69U 5LL6S 3K5OA 4CJ1B 3GV6A 4ZKCB 4K2KA 1O80A 1DD2A 3SR1A 4OIJA 1HUMA 3VR5A 2NVTB 3DWAA 1O7LA 1SJED 1HTLD 1G6ZA 1Z47A 2WB1B 1B4OA 2A6ED 5IT9L 5FO8B 4XXEA 3D4WA 5EKLA 2A68C 4DNRB 3T56B 1EQTA 5C4XB 1XTCD 4HCEA 1TS5A 4BA2I 3L7ZC 1EWHA 2Z8LA 1U4RA 4C2MB 1C4QA 1NUCA 1K83B 2OF1A 4ILWA 5EQ0A 2LFNA 2J0TD 2B2UC 2B13A 1PFNA 1PRTC 1IW7C 1TWHB 1RDPD 3GQBA 2WAQB 3HEJA 3TMEA 1HTPA 4EQNA 4NKLA 4ZKBB 2RSOA 2B2UA 4CKBA 1A6XA 2VNUD 3D3RA 1LLRD 1PFBA 3J80L 5C0XG 1GXDC 2XWBB 3V2TA 3WOEA 4RCOA 4C3HB 1TWCB 2A69D 1EFID 4OHJA 1H9SA 5BN3A 4A3IB 2RA4A 3VYRA 1STNA 1WTRA 2B63B 3KUPA 1YNJD 3A55A 5JEAH 2HQEA 1CHPD 4L63B 2L9HA 3EROA 2FJ2A 4K5XA 1WD1A 3PUYA 3VR6A 2K5DA 1SEBD 5EGTA 2PW5A 3T53B 3LWUA 2E2IB 4EVOA 3E5SA 1EL0A 1EU4A 3NHHA 3H94A 1SXTA 1QG7A 3S17B 2EJFC 1EOTA 1UUPA 2WP8J 5A2QL 5M5YB 2RDHA 2NN6H 1F9QA 2JA5B 1AEXA 1HRJA 2F3GA 2Z4IA 5D3DA 5FLXL 3ITPA 4ZLTF 1B50A 5B0HA 5C0XI 1C48A 5AFWA 3SLUA 2K28A 2F0FA 2K1BA 1IYVA 1UAPA 3QJYA 1PMRA 1JQYD 4KHZA 1C8CA 1EZ6A 2J7ZA 5IODA 5EBDA 1B44D 2K01A 3P7JA 2KVMA 5EBCA 4H0LC 1EY4A 3T4AC 4XYOA 2F0WA 1SE2A 4XT3B 5EJWA 1PRTF 2BA0A 3FDTA 5K5PA 1TS4A 5KRUA 4ULLA 2B2VC 1LTSD 1GLCF 4DU9A 1AW7A 1TY2A 5EPJA 2JXMB 3TZDA 1X32A 2BOSA 4BA1I 1AFPA 2B2VA 4KMUC 1O7YA 1HCZA 5ELCA 2NB0A 2NTSA 1ESFA 1LTTD 2B44A 3CKIB 3GTMB 3RD4A 2J4XA 2EPBA 2BE5D 3I8ZA 3HG9A 1KABA 3EFXD 1EY8A 1T5XD 1I4PA 3BVGA 1F2ZA 2Q8TA 4A3GB 4KY6A 3GTOB 1L0YB 3GD7A 1F77A 4MIUA 4XQNA 1CM9A 1PDQA 5M3MB 1GUOA 3TSSA 3IT7A 3BVMA 5EKKA 1B2TA 3CRKC 1XWEA 3SK4A 1STYA 4HR7B 4K5VA 3PUWA 2GPRA 5LHY1 3HZXA 1VDZA 4K14A 2K7VA 5NUCA 1LT3D 5IGCA 3BG3A 3OOCA 1S5ED 2RDGA 5TSSA 2EYPA 1SAPA 5G3LD 2K05A 2MJ8A 2TSSA 4PV1C 5FK9C 3BS1A 4KKTA 4X3SA 1SNDA 1Z6HA 3CHBD 5C4HA 2K5QA 3I90A 4MHEA 3SVMA 3DXJC 2IWHA 1XX8A 2EY1A 4WRDA 4A3FB 2KEDA 1J9OA 1D5XC 2DY8A 1KNAA 5T1GA 1DM0B 1BO0A 2R3ZA 5J22A 1GUWA 3NUCA 1T5EA 1Q8IA 3K57A 2JA6B 3R2IA 1GHJA 2XRQD 3J81L 3GV3A 1WVLA 5BN5A 4CBVA 5IGFA 1OXTA 5CMDA 4NMZA 2B0PA 1B1ZA 3S1NB 1E2VA 1FYCA 1A3UA 4YIJA 1DCZA 4B9XA 3FEWX 1SMYD 4DXGA 1VCIA 1U4MA 3OWFA 1STEA 4IALA 4H7BA 1S5CD 2R6GA 1K8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IT5 A;  2B0P A;  2GPR A;  2HSI A;  2B13 A;  1F3Z A;  4ZYB A;  1GGR A;  3SLU A;  3UZ0 B;  4RNY A;  1AX3 A;  4RNZ A;  1GLB F;  1QWY A;  1GLA F;  2B44 A;  1GLC F;  3NYY A;  3OUR B;  4QP5 A;  1O2F A;  2F3G A;  3IT7 A;  4LXC A;  4QPB A;  1GLE F;  3CSQ A;  1F3G A;  5KVP A;  4BH5 A;  2GU1 A;  1GLD F;  5B0H A;  4JBW M;  2MP0 B;  1GPR A;  3TUF B; 
#chains in the Genus database with same CATH topology
 1NMG A;  2E2J B;  1G91 A;  2MHV A;  4LF6 L;  2K03 A;  4JI3 Q;  3PO2 B;  1JJG A;  1SJH D;  4RKL A;  3QOL A;  4YY3 L;  2UU9 Q;  3KBG A;  1E1T A;  1L2F A;  2L4N A;  2PCF B;  3BDO A;  3K0Y A;  1X54 A;  1G2S A;  2MNA A;  1SFO B;  4DV2 Q;  2A6H C;  5IGB A;  4IUV A;  4NDX A;  1I6H H;  4V0B A;  2EXZ A;  2KEN A;  2E5L Q;  4FO2 A;  2F0J A;  5JVG 3;  1VQN A;  2ZJQ A;  1GUS A;  4DV5 L;  3GTQ H;  4X66 L;  3E3X A;  1A8V A;  1H9J A;  3UE1 A;  2VB3 X;  3F2C A;  5C3E B;  3H0G G;  1YJ9 A;  2I07 B;  4JI6 Q;  4OXP A;  4IUT A;  2ZJP A;  2O5I C;  5FLM G;  5BN4 A;  4QMG A;  4B3T Q;  3EBE A;  1EU3 A;  2ICE C;  4UP8 A;  3GTP H;  2UUA Q;  3FKI H;  1L1O C;  4ME3 A;  1YIT A;  2VQE L;  1B7Y B;  1Y1V H;  3K7U C;  4KN7 C;  4RH6 A;  1SRO A;  1L0X B;  2HHH L;  2HCC A;  2JYO A;  2L11 A;  1QUQ B;  1SMY C;  2VB2 X;  2YV5 A;  4K6D A;  4DV3 Q;  3J81 j;  1KNE A;  2WAQ E;  4BS9 A;  1L1O A;  2NVQ B;  4HJ7 A;  1CKO A;  2IX0 A;  2N49 A;  2I5L X;  3M85 A;  1Q90 A;  4J6H A;  1BBW A;  1UWV A;  2UXC L;  2DNE A;  3A56 A;  3I4N H;  4RAU C;  1U4L A;  2PZW A;  4UP9 A;  1I4X A;  3IFD A;  2NZ1 D;  4DR2 L;  3HOU B;  4UY8 C;  4IPD A;  4IPG A;  4YY3 Q;  1D6E C;  5IYD H;  5C0X H;  3DWP A;  4LNQ A;  4RMF A;  4L5R C;  2L12 A;  4HIK A;  1XNR L;  2B29 A;  5FJ8 G;  3LNN A;  3Q24 A;  4A93 G;  1Q81 C;  2JA8 H;  2ZXR A;  1FD7 D;  1V43 A;  5JAV A;  3I55 A;  2MP0 B;  3A7L A;  3G6J B;  3OWE B;  1Y1W B;  1EY5 A;  2RVL A;  2K32 A;  4DNT B;  4DR5 Q;  1JWM D;  2F0D A;  4R4Q A;  3HKS A;  4X66 Q;  3I73 A;  4JOI C;  2RCN A;  2OQK A;  3CCS A;  1HPC A;  3GTK H;  3EIV A;  4ZK9 B;  1NTG A;  1SNQ A;  1STG A;  4IJL A;  1GLB F;  3JAM E;  2XRS D;  1HR0 L;  2JE6 I;  5FOB B;  3E6Z X;  1YHQ A;  1FNV A;  4JYA Q;  2PW7 A;  2PYK A;  3C46 A;  1FGU A;  3A8J E;  4JOI A;  1I4Q A;  1LTG D;  4AYB B;  2VQE Q;  1EWI A;  1U9R A;  2F0O A;  1EIF A;  1I5F A;  3PF5 A;  2EOT A;  3TP5 A;  4EQP A;  1N33 L;  4BY1 G;  1F3Z A;  1IBM Q;  5I9O A;  4FNF A;  2HHH Q;  5KYL A;  5KND A;  3R3O A;  4FXG C;  2D0P A;  4A3K B;  4GOP B;  1CTM A;  3DEP A;  2X6G A;  4C3J G;  3HOW H;  4QPB A;  3I4M B;  3MEH A;  4JK1 C;  2UXC Q;  4QUF A;  3MZ5 A;  2GU1 A;  1D5Z C;  1KLU D;  5G3L F;  1PTO D;  4CJ2 C;  1DYQ A;  4ZUI A;  4P73 A;  5D14 A;  4OEL B;  1A3T A;  5IYB G;  1QB5 D;  4DR2 Q;  4OL7 A;  1GGR A;  1WCM H;  4F8M A;  2HCI A;  2UUB L;  3VA7 A;  2E75 C;  4L8J A;  2CHB D;  1WTP A;  2Y0S G;  3K81 C;  3UDG A;  2SDF A;  1YZ6 A;  1XNR Q;  4A3B H;  1BCP D;  1F2Y A;  2EYM A;  4NPS A;  4H44 C;  2Q8I B;  2B2T C;  3HOV H;  3S2D B;  4JBM A;  4JV5 L;  2GA4 B;  4NP5 A;  3KYH C;  2F0K A;  1HR0 Q;  4NXM L;  4C3I B;  1ENF A;  3MXU A;  3BDC A;  2F0L A;  2B2T A;  1SNP A;  1MSG A;  2KJX A;  4O2D A;  2R93 H;  1G29 1;  1GUT A;  1YJW A;  1K9M C;  4LFC L;  1KIX A;  5AJ3 L;  3VA5 A;  1EIY B;  1SYE A;  2E74 C;  3RLO A;  3KLW A;  2N78 A;  4KK7 A;  3A8K E;  3CCM A;  5ELO A;  4RWS C;  1P16 A;  1OO9 B;  1SYG A;  3OHX C;  4N9P A;  4DN4 M;  4A3E H;  1VQ5 A;  1RTO A;  3M7G A;  3KLR A;  4HAE A;  2R7Z B;  1NR2 A;  2MGS A;  4OGQ C;  4PMW A;  3WWV A;  1LT5 D;  2N55 A;  2WFW A;  1G6P A;  2RKS A;  4K8I A;  4I7A A;  3P20 A;  1YVC A;  4CDE C;  5HY6 A;  1EUJ A;  5BR8 Q;  3RN2 A;  1LTR D;  3FMC A;  1PTO C;  1HA5 A;  2VUM G;  2IL8 A;  3FP9 A;  2F0V A;  1GHK A;  3JAM i;  4WJW A;  4BY7 G;  1SBB B;  1TXY A;  3Q23 A;  1ESR A;  4GN3 B;  4BBS G;  1I50 B;  1EIH A;  1TWG B;  3G71 A;  5M3F B;  3H6M A;  3SDZ A;  4RNY A;  3I7F A;  1HZB A;  4RGM A;  1Y8O B;  4RKB A;  1HXY D;  2B2W C;  3NYY A;  3E9I A;  2K04 A;  3PCO B;  1BCP C;  1ICW A;  3NSW A;  3W2D A;  1PLF A;  1ONL A;  3A74 A;  4A3L G;  1HQM C;  1PZJ D;  1ET9 A;  2EYH A;  2EZV A;  2VW9 A;  2QCP X;  2A6E C;  1N34 Q;  1AZP A;  2NVX B;  4LMQ D;  2B2W A;  2A19 A;  4KD4 A;  1WTV A;  5LMU L;  1IHZ A;  3DM1 A;  4MNO A;  4RA8 A;  1QWY A;  2BCO A;  1PH7 A;  4HCS A;  3KLS X;  1BQQ T;  3DHQ A;  1IZ6 A;  5E1F A;  5M5W H;  1I4R A;  1YHA A;  5C5L A;  3CSQ A;  1K3R A;  2Z0S A;  3K0X A;  2XSC A;  3A54 A;  1QJO A;  5IOC A;  5AJ3 Q;  1XPR A;  2KEE A;  1M1K C;  1CFM A;  1WYD A;  1N36 L;  4G7H C;  4BXX H;  1JR0 D;  1W6K A;  1H95 A;  1S3O A;  2FMC A;  4CDC C;  1QE6 A;  1GO3 E;  1PH9 A;  4MN3 A;  1I6H B;  3K58 A;  1HFN A;  4IOC A;  3PIO A;  3K5M A;  3D6W A;  3GTQ B;  3CW2 C;  1H9M A;  4RFB A;  4DV4 L;  5C44 H;  3M9B A;  1J8I A;  3CPW A;  5JPM C;  2F0E A;  3DM3 A;  1Q1B A;  2A69 C;  3FPP A;  1ZKO A;  4O0A A;  4P2C B;  4HJ9 A;  2KQ3 A;  1V1P A;  1IYU A;  1YEZ A;  3HOY H;  3GTP B;  4FF4 A;  5I2X A;  3FKI B;  4AQY L;  3J7A F;  2F0I A;  2RCF A;  2K33 A;  3KOJ A;  1Y1V B;  5D65 A;  4DAY A;  4JBW A;  1YNJ C;  4KTA A;  2EYO A;  4LUZ A;  4FVM A;  4F7X A;  1GUG A;  1SE8 A;  2NVY H;  3ZJY C;  5ISR A;  2XVS A;  1JIC A;  5JJK A;  2PZT A;  5LMU Q;  2A73 B;  2EIF A;  4PZ7 A;  1JB3 A;  1QZH A;  5ELE A;  2KCM A;  1S5D D;  1MJC A;  4IPC A;  4WJ3 M;  3U4Z A;  3TP6 A;  1YNN D;  1V1O A;  4KY5 A;  5E3F A;  1AZQ A;  1S5C D;  5EPK A;  1RCV D;  5IWA L;  3I4N B;  3T1Y L;  3BVZ A;  3H3V I;  3CCV A;  4EQO A;  4JBJ A;  5LMN W;  1U4P A;  1FVI A;  1XXG A;  3RZD H;  2SNM A;  1N36 Q;  4K0K L;  3EN2 A;  1KHI A;  1DGS A;  4ZCK A;  2YU9 H;  1X9N A;  2EJM A;  2KBN A;  3GTG H;  3I91 A;  3RR5 A;  3AEV A;  2JA8 B;  2E8G A;  3BZC A;  2AQ2 B;  1G2T A;  2WKC A;  1PTO F;  1CKN B;  2KUM A;  1E24 A;  2Z6K C;  4K2L A;  4K6L A;  1I3Q H;  2KA7 A;  1M8A A;  3GTK B;  2CCZ A;  1TS3 A;  3D8G A;  3R8B A;  4JI5 L;  3T1H Q;  1PZI D;  4I65 A;  3NEL A;  3NTI A;  3LGJ A;  5IGG A;  2JK8 A;  4OEM B;  4JI2 L;  1BCP F;  4ODG A;  3TDQ A;  1AP0 A;  4AQY Q;  3BZK A;  2VZA A;  3J80 E;  4Q5V A;  4PMC A;  3EQL C;  1PHJ A;  1WI5 A;  3CCR A;  3CC2 A;  3GTJ H;  2E76 C;  3F2U A;  1JOK A;  5IYC G;  1X6O A;  1IBK Q;  4JBW M;  4IZ8 A;  1KRS A;  1B70 B;  1SSO A;  4TRD A;  3TS2 A;  4POG A;  4M1U B;  1HNZ Q;  4DFA A;  3TZU A;  2F0T A;  3UI2 A;  1IL2 A;  4C1N I;  3M4O H;  1VQC A;  5FKA C;  1X55 A;  3NBH B;  5I2Y A;  1D8L A;  3HOW B;  1OXU A;  4KD3 A;  2F3I A;  3Q0A A;  3M3Y H;  1BNZ A;  3H0G H;  3L9A X;  1M4V A;  1N8R C;  1RL2 A;  2L1B A;  3T1Y Q;  5FLM H;  2PQA B;  1HQR D;  1O7Z A;  2UXB L;  3AMU A;  1K0R A;  1GLA F;  3CRL C;  1WCM B;  4LAA A;  1V9P A;  2EE1 A;  2MUY A;  3EJI A;  4L6T B;  3CMA A;  2B8G A;  4K0K Q;  3RUZ A;  4KI0 A;  1I4H A;  1HNW L;  4CJ0 B;  1EY6 A;  4ZYS A;  2BH8 A;  4A3B B;  1PH1 A;  2AUJ D;  2DJG C;  1E22 A;  2XN9 C;  4QP5 A;  2WAC A;  2ZXP A;  3OTO L;  3BZD B;  2Q2H A;  3H91 A;  3HOX G;  3HOV B;  2F3W A;  4HED A;  1Z7T A;  3ERQ A;  4CHT B;  5A2Q E;  1IBL L;  2UXD L;  1HUN A;  1E2Z A;  1H9K A;  4LJZ C;  4DK1 A;  1VQH A;  1QZG A;  1D2B A;  5DNF A;  3QB3 A;  4IFD J;  1IYJ B;  4A3M G;  2N3S A;  1HJP A;  4Q0F A;  5FLX E;  5IP7 G;  2ICI A;  1SLJ A;  2PO4 A;  4JI2 Q;  4XQJ A;  3F8T A;  4O42 A;  1F9R A;  1K3B C;  4DAV A;  1D1I A;  2R93 B;  2R92 G;  2BE5 C;  4ID6 A;  4FF3 A;  1BF4 A;  3CQZ H;  2K52 A;  5IIF A;  3MA2 B;  5FJ8 H;  1A2T A;  4A93 H;  4A3E B;  1EYD A;  2C5C A;  2NBF A;  1UE6 A;  2M2L A;  4A3D G;  3CCQ A;  3HOZ G;  3STB D;  1NY4 A;  5H1S E;  4HSV A;  4YWK A;  5CV5 A;  4GKK L;  4JVZ A;  3KFU A;  3HS0 C;  1L0W A;  4G57 A;  3TP8 A;  4I7Z C;  1EEI D;  3DMU A;  2F4I A;  3LX0 A;  1Q1E A;  1X65 A;  4G7O C;  2DN8 A;  1PV4 A;  4AYB E;  2UXB Q;  2BDN A;  2NWG A;  4BBR G;  3JAM c;  5I4D A;  2FFK B;  2K5H A;  2RDF A;  4OO1 G;  2AQ3 B;  3NK9 A;  1DXM A;  1TWA H;  3J80 i;  1HNW Q;  4BY1 H;  4TQU S;  1ZYR D;  1ASZ A;  2HIX A;  3OMC A;  3FVQ A;  4Z9C B;  3S14 H;  3IAY A;  3BYY B;  5A35 A;  3CME A;  4R4O A;  1CI3 M;  4OWT B;  4NB3 A;  3O13 A;  1A62 A;  3T16 A;  5C3W A;  3MXP A;  4N9T A;  3SK5 A;  4C3J H;  1IBL Q;  1JOR A;  2NN6 I;  3I4L A;  2WIN B;  2PI2 E;  3V05 A;  1NE3 A;  1VQE A;  1PYS B;  1DON A;  5IYB H;  1STH A;  3I72 A;  3S1R H;  3G6E A;  3H3V C;  1VS0 A;  2F1M A;  4A3J G;  4ZAI A;  4LF8 L;  5M5W B;  3PIP A;  2RBM A;  4J15 A;  2D62 A;  4HJA A;  4C56 C;  1KAW A;  4CGY B;  1TWF H;  5I6Y A;  1TU2 B;  1UE1 A;  4DGZ A;  1B8A A;  2QEX A;  4B3R L;  1KDB A;  1JMC A;  1RHP A;  2B39 A;  2YTV A;  1NNX A;  2PQE A;  2X69 A;  3K80 C;  3R93 A;  1MIU A;  3MTS A;  4XQQ A;  1GVP A;  2WV6 D;  1U5K A;  4GKK Q;  2XWJ B;  1A15 A;  4LFB L;  1NSN S;  1OXS C;  3HRZ C;  1VMC A;  1HA6 A;  1PH6 A;  1NR4 A;  2JP1 A;  2F0Q A;  1EY0 A;  5C44 B;  5COR A;  2G9H D;  1MKH A;  3S1M H;  4B3S L;  3CAM A;  3U9O A;  3B6Y A;  1TR5 A;  1EYG A;  4DA2 A;  2F4V L;  1K0S A;  4XIG S;  4OO1 I;  3RZO H;  1NCV A;  4IUP A;  1EEF D;  1G8Z D;  2B2Y C;  3K6O A;  4KLK A;  3DLL A;  1SYB A;  3HOY B;  2OTJ A;  3ERS X;  2OWO A;  1S5B D;  2VY3 A;  1ZXT A;  1SMX A;  2VXW A;  4J1M A;  2IJ0 A;  4R4I A;  3K7A H;  3KDF B;  1VQA A;  1PRT B;  2B2Y A;  4LF7 L;  2NVY B;  4BH5 A;  1H9R A;  4GNX B;  2WB1 G;  2EY6 A;  3MC0 B;  4LF6 Q;  3MAQ A;  2VUM H;  2CVR A;  3MFY A;  4PG3 A;  5C4X G;  4KKU A;  2D0O A;  4BY7 H;  3ND9 A;  1LTL A;  5E4W C;  4A3C G;  5ELD A;  4BBS H;  2GN5 A;  4LF8 Q;  2MO1 A;  3QR8 A;  1H9S B;  2SOB A;  3J7Z C;  5L37 A;  1JOQ A;  5J39 A;  3M4Y A;  3E0J A;  3ER0 A;  2I46 A;  3RZD B;  2ENB A;  5KNC A;  4ABN A;  3ULJ A;  4A3L H;  4LW1 A;  1VQO A;  2XIW A;  2YU9 B;  1QNK A;  3L0O A;  3GTG B;  4ZYB A;  4DV5 Q;  2KHI A;  4PMB A;  4JI0 L;  1CQF A;  2EY2 A;  2H1E A;  4DR4 L;  2WAQ G;  3C1F A;  4J8Q A;  3CF5 A;  4LUV A;  5F2D A;  2QF7 A;  1SE4 A;  1WTX A;  4IFD G;  3C1E A;  4KKS A;  2E2D C;  1MHW C;  1J5E L;  4EGV A;  1I3Q B;  4B08 A;  1CUK A;  4B3S Q;  3Q6S A;  4A75 A;  5HGT A;  4QY7 A;  1FJG L;  1OXX K;  2F4V Q;  2HDL A;  4HTH A;  2OCE A;  2C35 B;  4FXD A;  1K8G A;  3F1Z A;  3ND8 A;  4C3H G;  4YHH L;  2KCC A;  2QA4 A;  2A68 D;  1SN8 A;  2Y0S E;  3G7L A;  3J81 E;  1VF5 C;  4LFA L;  4AH6 A;  3K5L A;  4KJN A;  3GTJ B;  3DWQ A;  4E6I A;  4A3I G;  2DY7 A;  2CH4 W;  1SYF A;  1W6J A;  4U67 3;  1F3G A;  1IKL A;  1B9M A;  4LF7 Q;  2B63 G;  1EY9 A;  1QIL A;  1RIP A;  1UNS A;  3CPF A;  3OIQ A;  3M4O B;  5K36 G;  4DV1 L;  3I3C A;  3MXN A;  4POF A;  1OXV A;  4LWC A;  4RHR A;  3U58 A;  4DV7 L;  3M3Y B;  3BYT B;  2EYF A;  1IW7 D;  3H0G B;  4HJ5 A;  4LK1 C;  1GJX A;  2VQF L;  1NMF A;  4L5Q A;  4NW2 A;  3TRZ A;  2GVB A;  1VQ6 A;  3TRE A;  3TUF B;  4JC0 A;  1BBU A;  5J1Z A;  4X65 L;  4R8I A;  4HID A;  1KXL A;  3FRP B;  2O5J C;  1V8Q A;  3R2T A;  2WII B;  1ASY A;  3QOJ A;  4DR4 Q;  4IFD I;  2OQ0 A;  3PUV A;  1EQV A;  1NBW A;  5CV9 A;  4KHP L;  1AH9 A;  2JA5 G;  1X3G A;  2WKD A;  4GN4 B;  3KF8 A;  4YWM A;  2IPK D;  1PZK D;  3W5O A;  2ID0 A;  5KYI A;  1RD9 D;  1AE3 A;  3Q22 A;  1PA6 A;  1FJG Q;  1VQB A;  2AQ1 B;  4F88 A;  3VR3 A;  2K4K A;  3TN2 A;  4DUY L;  2JA7 G;  1R4P B;  1HZA A;  5IGE A;  5GRO A;  5IP9 G;  2NZH A;  3PIO 3;  1N33 Q;  3H09 A;  1QVG A;  3TQY A;  4YHH Q;  1LUZ A;  1GD7 A;  3U4V A;  2F3V A;  4X3U A;  2ES2 A;  3NQT A;  5GAG C;  4FF2 A;  2K75 A;  2AWN A;  3CQZ B;  3MXG A;  4H13 C;  2SEB D;  4RHS A;  2FMM A;  4AIM A;  4A93 B;  3KK7 A;  4PZ8 A;  2CW0 D;  2NZO A;  1Y8N B;  4G4K A;  4R4T A;  1D5M C;  3S16 H;  5EPL A;  4GLX A;  1STB A;  3NQI A;  4Y7N H;  5M9O A;  1Q7Y C;  1HR0 W;  2K14 A;  1WFQ A;  4K5W A;  2FIN B;  2KHJ A;  4B9W A;  2K50 A;  4DV7 Q;  2UUB Q;  2FXQ A;  3OW7 A;  1W3S A;  4IPH A;  5ELB A;  3X3M A;  5JEA J;  3W3A A;  4GKJ L;  3N6R A;  3VYT A;  2VQF Q;  1WD0 A;  1JT8 A;  1BKB A;  3MHB A;  1PXU A;  2F0P A;  4QJF A;  1BBX C;  1GLE F;  1MD2 D;  1VMP A;  3Q8D A;  4DF7 A;  4F87 A;  3SK8 A;  5KVP A;  4QGU A;  4UDU C;  2AUK A;  1HZC A;  5CR3 A;  1WTH A;  5CV8 A;  5DM7 3;  5LMN L;  5IYC H;  1TWA B;  5I9P A;  3J81 i;  5CGK A;  4BY1 B;  4OWW B;  3HP3 A;  4JV5 Q;  2MO0 A;  1STA A;  2XNA C;  3J80 c;  3S14 B;  2IT1 A;  5JOB A;  4TKO B;  1GOZ A;  4NXM Q;  4GLA C;  4KHP Q;  3KF6 B;  2F0M A;  1O2F A;  1KLG D;  2EVB A;  3S1Q H;  1ROD A;  2E2H H;  2AWO A;  1S72 A;  4LXC A;  2F0S A;  2PNR C;  1WTQ A;  1LV9 A;  1MGS A;  1KL9 A;  1X3Q A;  3WDN A;  4C3J B;  1HHV A;  1IL8 A;  2KHS A;  2KOL A;  4UPA A;  3PV0 A;  1KRT A;  2JEA I;  4DUY Q;  4LFC Q;  1N9W A;  2D2C C;  2PMZ B;  1GUN A;  1MBY A;  2ZJR A;  3S1R B;  3J7A V;  2F03 A;  3CU7 A;  1I94 L;  4XT1 B;  1TII D;  3C2P A;  4GZY C;  1RKN A;  3SK6 A;  4JI4 L;  2O4X A;  2Y0S B;  1SR3 A;  1O78 A;  4DR7 L;  1TWF B;  2JEB I;  4YCV A;  3T51 B;  2CW0 C;  1F9P A;  4P75 A;  3KBX A;  1A3V A;  2AHO B;  3MEF A;  4GOP C;  2JSO A;  3SGI A;  3S15 H;  2CWP A;  3HOX H;  5CBA E;  1VQL A;  3PO3 G;  4A3G G;  3NWS A;  4UAI A;  2IHF A;  4TSS A;  2H4O A;  4RGO S;  2AKW B;  4GKJ Q;  4N8F A;  2F52 A;  4GOP A;  4KHV A;  3S1M B;  5M3M G;  4A3M H;  2HUG A;  5IP7 H;  3HFZ B;  4DR6 L;  1CA5 A;  2B8F A;  3RZO B;  2R92 H;  1CT1 D;  2LKV A;  1SNO A;  3QWN A;  5GQO A;  5FLX c;  2JA7 B;  2QIL A;  1HNX L;  3F2D A;  4IUR A;  3NEM A;  2PI2 A;  2SNS A;  1EQR A;  4X3K A;  4OIK A;  1X3E A;  4JI8 L;  3EVQ A;  3JC6 6;  5CC4 A;  2UUC L;  3AFQ A;  3K7A B;  1QCB D;  4WFN 3;  4LF5 L;  4A3D H;  3HOZ H;  1PTO H;  2MP1 A;  2YYZ A;  4V19 0;  1VQK A;  2MFI A;  2O2L D;  5IT9 E;  2A1A A;  5CYU A;  2VUM B;  2N88 A;  5DLQ E;  2F0H A;  3ONA B;  4QUC A;  5IGD A;  2QEJ C;  4BY7 B;  1BVS A;  2CQO A;  4BBS B;  4ME5 A;  4BBR H;  4XDX A;  1DOK A;  1CK1 A;  1PYW D;  3CCJ A;  4OO1 H;  1LTB D;  2B3G A;  4JI4 Q;  1V1Q A;  4R1J A;  4DV0 L;  4DR7 Q;  1R9T H;  4DK0 A;  2JJQ A;  3BJU A;  4B3M L;  3D31 A;  3DEO A;  4GLV B;  2Q2U A;  1D1K A;  4TVA B;  5C3X A;  2FHT A;  5COY A;  1S4Z A;  1E2W A;  2M9V A;  4DV4 Q;  2LMC B;  3HGB A;  4PQX A;  2Z1C A;  4A3F G;  1Q3L A;  1TKW B;  4KY7 A;  4IUN A;  4LF9 L;  1K28 A;  2L5T A;  3ZYY X;  3L3O C;  3PUX A;  5E7N A;  2Z6K A;  2CFM A;  5M5X H;  4P71 A;  5JVH 3;  2JA6 G;  2PZU A;  4A3J H;  2LS0 1;  5EKI A;  3SEB A;  1EYA A;  1KQS A;  4PZ6 A;  3I56 A;  2RQX A;  3AU7 A;  1GLD F;  1JWS D;  4P72 A;  1GPR A;  2TMP A;  4KN4 C;  3URY A;  3WOF A;  1DJR D;  2NTT A;  3M7N A;  3TBI B;  1K73 C;  1O7I A;  2ZTE A;  1F9S A;  1VQF A;  1C0A A;  1YNN C;  1FGB D;  1W2B A;  1PFM A;  5DM6 3;  5C4J H;  2EYJ A;  1EWC A;  3P1H A;  3K5N A;  5JEA G;  5IWA Q;  3PF4 A;  1LAC A;  5KNB A;  1QNU A;  4HMI A;  1TS2 A;  1JC7 A;  5GAE C;  1CA6 A;  2Z6B A;  1YBY A;  5C4Z A;  3PO2 G;  3S2H H;  4DK6 C;  3NXW A;  3QO2 A;  3BDL A;  3PO3 B;  1WTW A;  3GTL H;  5CV4 A;  3VYS A;  2X6L A;  3VYU A;  1UE5 A;  3X3N A;  1WOC A;  1L1O B;  4WOR A;  4DV0 Q;  4HMJ A;  4NXN L;  4MZ9 A;  4B3M Q;  1SNM A;  1KDC A;  2KEC A;  4XYQ A;  1KAA A;  4U68 A;  3PIP 3;  4KJO A;  2CQA A;  2MPM A;  2NVT H;  3ULP A;  1B53 A;  1XMQ L;  2HSI A;  2R7F A;  1A2U A;  2K5W A;  2NN6 G;  4JI5 Q;  4O1N A;  4CKC A;  3UZ0 B;  1AX3 A;  5C3E G;  2N8N A;  5IE8 A;  1ENA A;  4APV A;  4LF9 Q;  1EZ8 A;  3VR2 A;  2V1C C;  1LT4 D;  1YJN A;  1VQI A;  2L55 A;  5C4X H;  1E3P A;  1K8O A;  4IJH A;  4A3C H;  1BR9 A;  1LT6 D;  3V96 A;  1DZ1 A;  4PNY A;  1I4G A;  2ALY B;  3D4R A;  4M8A A;  1XYI A;  4C2M H;  1ML0 D;  1J6Q A;  4JI3 L;  1K83 H;  4HSP A;  4IUU A;  5J3B A;  5LL6 X;  3KLS A;  1DOL A;  2UU9 L;  1B9N A;  2D9U A;  3FPU B;  2DUD A;  2V4D A;  4L5S A;  5CV7 A;  1X3P A;  4IN3 A;  3OUR B;  1BOS A;  3L2P A;  1RF2 D;  1TWH H;  3SE0 A;  2DNC A;  3K8A A;  4RCN A;  2Z4H A;  3K59 A;  1AE2 A;  2LXK A;  1CZG A;  3JAM L;  3S16 B;  4IFD H;  1LTA D;  1E0B A;  2QKI C;  4Y52 H;  4FP5 D;  4Y7N B;  3I70 A;  2A6H D;  1FNU A;  1EOV A;  1M90 C;  2EY5 A;  5HGQ A;  1KD1 C;  5EAY A;  3HOU G;  2D5D A;  3EA6 A;  3RNU A;  1UEA B;  5CBE E;  1GM5 A;  2R61 A;  1WTO A;  5JPN C;  4DR1 L;  3IFT A;  1BXT A;  5HUR A;  2CWA A;  3HKZ G;  4JI6 L;  2Q8R E;  4C3H H;  1TWC H;  1BUV T;  4QL5 A;  1SRU A;  5CV6 A;  3OTO Q;  1SNC A;  4R9W A;  2CH4 A;  1KDA A;  1AN8 A;  4C1N K;  2G9D A;  3OIP A;  1Y1W G;  1PH2 A;  3PUZ A;  5D3I B;  4A3I H;  1B3Q A;  2UXD Q;  1QVC A;  2KCN A;  2B63 H;  3SHL A;  3MXN B;  3J81 c;  3FHW A;  3D6C A;  4ZRZ A;  2A5H A;  3OMG A;  5FO9 B;  2OTL A;  4QIW B;  5K36 H;  3S1Q B;  2E2H B;  5C5M A;  2I0Q A;  4X3T A;  1MI2 A;  1EIG A;  1Q82 C;  1TY0 A;  1R4Q B;  2IX1 A;  1SDF A;  2EJG C;  1JE4 A;  1F2M A;  4AYB G;  4GS3 A;  3NTH A;  3RLF A;  2E2I H;  1JJC B;  3UDI A;  4R8N A;  3OPO A;  1SYD A;  1RTN A;  1TT2 A;  3S17 H;  3STB C;  3RN5 A;  4HIO A;  3CC7 A;  2M00 A;  3OSO A;  3P75 A;  2Q2T A;  1VQJ A;  1F2L A;  3ULL A;  4A3K G;  2OXP A;  2K6A A;  3NPP A;  4RGN A;  3KF8 B;  1IKM A;  5M5Y H;  1EY7 A;  3I4M G;  4EQ5 A;  2JA5 H;  1LAB A;  1TVX A;  2H5X A;  3MWY W;  3HOX B;  3S15 B;  4DAM A;  3S9W A;  2WB1 E;  2RF4 A;  3IKJ A;  4DR5 L;  2VL6 A;  1ILP A;  5DAU A;  1I6V C;  2EDG A;  2QDB A;  4QF4 A;  4S3S A;  3G48 A;  4XTC S;  2JA7 H;  1ZYR C;  1PH8 A;  3NBI A;  1NAP A;  1Q46 A;  4A3M B;  5IP9 H;  4DR1 Q;  3NBH A;  4IQZ A;  2ZTD A;  2EYL A;  3TS0 A;  1CZW A;  4HN7 A;  4JYA L;  5E4X A;  5KIX A;  1LM0 A;  4RGT A;  3QG1 A;  3J7Y W;  3OW2 A;  2R92 B;  3NTK A;  3U9S A;  2IX3 A;  4FYD A;  1YI2 A;  1ET6 A;  1G51 A;  2PQA A;  5C0X J;  1JOO A;  4DR3 L;  4WJ4 A;  1ENC A;  2LY7 A;  3NWT A;  4H02 A;  2C9O A;  4EX5 A;  4GN5 A;  4FF1 A;  1IBM L;  1CQV A;  1K8A C;  2XTI A;  3A7A B;  3GP7 A;  4A3D B;  3HOZ B;  4HIM A;  5T1I A;  4C3I G;  3PQI A;  1PTO B;  2HDM A;  1Y14 B;  1KTK A;  1DOM A;  2G5D A;  1PH3 A;  2EQS A;  4KV6 A;  2KCT A;  1PVO A;  1MJE A;  4JG2 A;  3TP7 A;  3ICE A;  2ZT9 C;  3A8I E;  4B3R Q;  4CDF C;  1CHQ D;  3IT5 A;  4BBR B;  1Y8P B;  3T13 A;  2F0G A;  2PNH A;  1HFG A;  5FO7 B;  4IUQ A;  1BCP B;  1EYC A;  3RMH A;  2AMC B;  3MVV A;  2NUC A;  2QDL A;  3IL8 A;  1ILQ A;  1R9T B;  2R7Z G;  1ZEQ X;  2RSN A;  3HKZ B;  3BU2 A;  4X6A H;  1II3 A;  4ZQ3 A;  5KGU A;  4K8J A;  4LFB Q;  3MFG A;  2L0C A;  1B3A A;  2QW7 A;  4FXK C;  2BA1 A;  4QB4 A;  2IHE A;  2P5Z X;  5KEE A;  2PPB C;  5I6W A;  1LO5 D;  3AYH B;  3CCU A;  3SXH A;  4BWG B;  1SE3 A;  2PMZ E;  1FR3 A;  2OEO A;  2BDO A;  1CSP A;  3VR4 A;  2F0U A;  1TQO A;  2NYZ D;  5M3F G;  3H3V H;  2A74 C;  1S5F D;  3LWE A;  5M5X B;  3IRB A;  4A3J B;  1MSH A;  1RJT A;  3AQQ A;  5JJZ A;  3NE5 B;  1BDO A;  1T9H A;  3AB9 A;  1QOH A;  4QQB X;  5C6A A;  3KJP A;  1EFW A;  3D0F A;  3GTM H;  4DR3 Q;  4N8X 1;  2OT2 A;  3G4S A;  3CD6 A;  2IW3 A;  1SYC A;  4QCL A;  2R7D A;  5C4J B;  4DAP A;  1LTI D;  1PRT D;  1NJI C;  4RNZ A;  1V1P B;  3C3L A;  4ZUJ A;  3PO3 H;  1VQP A;  2F0N A;  3D4D A;  5ELF A;  4DXF A;  3GTO H;  3RLN A;  4A3G H;  3GO5 A;  3N52 A;  1VF7 A;  3QIA A;  1FNW A;  5BR8 L;  4DAY B;  5M3M H;  5DEH A;  3DUZ A;  4G7Z C;  3S2H B;  1JWU D;  4DUZ L;  5JJL A;  2L15 A;  3GTL B;  2BH2 A;  1A63 A;  2ZXO A;  4CKE A;  2VS1 A;  3PMF A;  1JCK B;  1Q12 A;  3NP8 A;  3TEH B;  1GKH A;  1Y69 U;  5LL6 S;  3K5O A;  4OON A;  4JI0 Q;  4CJ1 B;  3GV6 A;  4ZKC B;  3I4O A;  4K2K A;  1O80 A;  1DD2 A;  3AFP A;  3SR1 A;  4JPB W;  2HT1 A;  4OIJ A;  1J5E Q;  1HUM A;  3VR5 A;  2IY5 B;  1EQQ A;  2NVT B;  2HD3 A;  3DWA A;  1O7L A;  1SJE D;  2QGQ A;  4DV6 L;  1HTL D;  1G6Z A;  1LYL A;  2Z9H A;  1N34 L;  1Z47 A;  2MQH A;  2WB1 B;  4FDB A;  1B4O A;  2A6E D;  5GAD C;  2ZM6 L;  5IT9 L;  5FO8 B;  4XXE A;  3D4W A;  5EKL A;  2A68 C;  4DNR B;  3T56 B;  1VQM A;  1EQT A;  4L5T A;  5C4X B;  2JN4 A;  1XTC D;  2HIV A;  4HCE A;  5IT9 c;  1D7Q A;  3FKI G;  4LFA Q;  2I5H A;  3OYY A;  1TS5 A;  4BA2 I;  3L7Z C;  1Y1V G;  1EWH A;  2Z8L A;  1U4R A;  4C2M B;  1C4Q A;  1NUC A;  1K83 B;  2OF1 A;  3M4Q A;  1WJJ A;  1CSQ A;  4ILW A;  5EQ0 A;  2LFN A;  2J0T D;  1YIJ A;  2B2U C;  2B13 A;  1PFN A;  4DV1 Q;  1PRT C;  3A5Z B;  1IW7 C;  3U50 C;  1TWH B;  4GNX C;  1RDP D;  1PYB A;  2RHQ B;  4A3F H;  1QUQ A;  3GQB A;  2WAQ B;  3HEJ A;  1Q86 C;  3TME A;  1QVF A;  1HTP A;  1ICF B;  4NKL A;  4EQN A;  3I4N G;  3KDF A;  4ZKB B;  2RSO A;  1E7Z A;  2B2U A;  4CKB A;  1C9O A;  2JA6 H;  1A6X A;  2VNU D;  3CP0 A;  3D3R A;  4DUZ Q;  1LLR D;  4GNX A;  1PFB A;  5IYD G;  4X65 Q;  3J80 L;  3CCL A;  5C0X G;  4OX9 L;  1GXD C;  2XWB B;  3V2T A;  3WOE A;  4RCO A;  4DNI A;  4C3H B;  1TWC B;  2A69 D;  4JI7 L;  3S1N H;  1XJV A;  1EFI D;  2JA8 G;  4OHJ A;  1H9S A;  4YWL A;  1E1O A;  5BN3 A;  4A3I B;  1FL0 A;  2RA4 A;  3VYR A;  1KC8 C;  1STN A;  4DV6 Q;  1XMO L;  1WTR A;  2B63 B;  3KUP A;  1YNJ D;  3A55 A;  5JEA H;  2GVA A;  2HQE A;  1CHP D;  4L63 B;  2L9H A;  2ZM6 Q;  3ERO A;  2E2J H;  1UEB A;  2FJ2 A;  4K5X A;  1WD1 A;  4R4C A;  3PUY A;  3PO2 H;  2I5M X;  3VR6 A;  2K5D A;  1SEB D;  5EGT A;  4DK3 C;  1C7Y A;  2PW5 A;  5ELN A;  3T53 B;  3LWU A;  2E2I B;  4EVO A;  3E5S A;  1EL0 A;  1EU4 A;  3NHH A;  1SFO H;  3H94 A;  1SXT A;  1QG7 A;  3S17 B;  2EJF C;  1EOT A;  1UUP A;  2WP8 J;  1S40 A;  5A2Q L;  1N32 L;  4X62 L;  5M5Y B;  2RDH A;  3S24 A;  3HOW G;  2NN6 H;  1F9Q A;  2K5N A;  2JA5 B;  1AEX A;  5C3E H;  1HRJ A;  2F3G A;  2Z4I A;  5D3D A;  5FLX L;  3ITP A;  4ZLT F;  1B50 A;  5B0H A;  1XNQ L;  2RHS B;  1WCM G;  5C0X I;  1OTC A;  1C48 A;  2EXD A;  5LMN Q;  4OX9 Q;  3H15 A;  4DPG A;  2A8V A;  3T1H L;  5AFW A;  3SLU A;  2K28 A;  1VQ9 A;  2F0F A;  2DJF C;  2K1B A;  4JI7 Q;  1IYV A;  1UAP A;  3QJY A;  4A3B G;  1PMR A;  1JQY D;  4A76 A;  4KHZ A;  1C8C A;  1EZ6 A;  2J7Z A;  1XTD A;  4LF4 L;  5IOD A;  3HOV G;  5EBD A;  2NVQ H;  1JE5 A;  1XMO Q;  1IBK L;  1B44 D;  1HNZ L;  2K01 A;  3P7J A;  2KVM A;  1UE7 A;  5EBC A;  1YHB A;  4H0L C;  1I94 Q;  1JJ2 A;  3HOU H;  1VQD A;  1EY4 A;  4ALP A;  3T4A C;  2R93 G;  4UHV A;  4XYO A;  2F0W A;  3F2B A;  1A0I A;  4HJ8 A;  1SE2 A;  2JA9 A;  2JQO A;  3CCE A;  2Q2I A;  4XT3 B;  3CXC A;  4YCU A;  4A3E G;  3CC4 A;  5EJW A;  3UDF A;  1PH4 A;  1PRT F;  1X3F A;  2BA0 A;  3FDT A;  5K5P A;  3W1G A;  1Y1W H;  1TS4 A;  3KJO A;  5KRU A;  4ULL A;  3VDY A;  2B2V C;  4QIW E;  4UP7 A;  1N32 Q;  1LTS D;  4X62 Q;  4IOA A;  5IY0 A;  1GLC F;  4DU9 A;  1AW7 A;  1TY2 A;  1U0L A;  5EPJ A;  2JXM B;  3TZD A;  1X32 A;  3E0E A;  4DR6 Q;  2LXJ A;  2BOS A;  4CDD C;  4BA1 I;  2DGY A;  4MTN A;  1XNQ Q;  1AFP A;  2B2V A;  4JBK A;  3J7A 5;  4KMU C;  1HNX Q;  1O7Y A;  4JCV E;  1HCZ A;  1YNX A;  5ELC A;  2NB0 A;  1IXR A;  2NTS A;  4JI8 Q;  1ESF A;  1LTT D;  2B44 A;  2ASB A;  2UUC Q;  4LF5 Q;  4JI1 L;  4LF4 Q;  3CKI B;  3GTM B;  2XGT A;  3RD4 A;  2J4X A;  2EPB A;  4A3K H;  1PFS A;  2BE5 D;  5GAH C;  3HG9 A;  3I8Z A;  1HZ9 A;  1KAB A;  3EFX D;  1EY8 A;  3I4M H;  3UE0 A;  4IO9 A;  4RG1 A;  3A5U A;  1T5X D;  1I4P A;  3BVG A;  1F2Z A;  2Q8T A;  4A3G B;  4KY6 A;  3GTO B;  1L0Y B;  3GD7 A;  1F77 A;  4MIU A;  3KF6 A;  1CM9 A;  4XQN A;  1PDQ A;  5M3M B;  1Q8K A;  1GUO A;  3I2Z A;  2CKZ B;  3TSS A;  4OWX B;  3IT7 A;  3BVM A;  5EKK A;  1B2T A;  3CRK C;  1XWE A;  2K5V A;  3SK4 A;  1STY A;  3M4P A;  1VQG A;  4HR7 B;  4LUO A;  4K5V A;  3PUW A;  4BXX G;  2GPR A;  5LHY 1;  1JB7 A;  5JJI A;  3HZX A;  3S2D H;  1XPO A;  1VDZ A;  1X56 A;  4K14 A;  2ATW A;  2K7V A;  4P74 A;  5NUC A;  4X64 L;  1LT3 D;  4C3I H;  5IGC A;  5C44 G;  2LSS A;  2YTX A;  3BG3 A;  3OOC A;  3UDX A;  1S5E D;  2RDG A;  4YCW A;  4A4I A;  5TSS A;  2EYP A;  1SAP A;  1XPU A;  5G3L D;  2K05 A;  2MJ8 A;  2TSS A;  3HOY G;  4PV1 C;  2ZTC A;  3HKZ E;  3PGZ A;  5FK9 C;  3BS1 A;  4JI1 Q;  4JW0 A;  4KKT A;  2R7Z H;  4X3S A;  1SND A;  1Z6H A;  3CHB D;  4MTK A;  4DV2 L;  5C4H A;  2K5Q A;  3I90 A;  4MHE A;  3SVM A;  1VQ7 A;  2E5L L;  3DXJ C;  2IWH A;  3NEN A;  3E9H A;  1XX8 A;  2EY1 A;  4WRD A;  4A3F B;  1HH2 P;  2KED A;  1CKM A;  1J9O A;  1D5X C;  2DY8 A;  1KNA A;  5T1G A;  1I50 H;  1DM0 B;  1BO0 A;  1TWG H;  5M3F H;  2R3Z A;  5J22 A;  1GUW A;  3NUC A;  1T5E A;  1Q8I A;  3K57 A;  4B3T L;  2JA6 B;  4NXN Q;  3R2I A;  1GHJ A;  2UUA L;  2XRQ D;  3PSI A;  3J81 L;  3GV3 A;  1WVL A;  5BN5 A;  4CBV A;  5IGF A;  1OXT A;  5CMD A;  4NMZ A;  4DKA C;  2B0P A;  1B1Z A;  1XMQ Q;  1VQ4 A;  3S1N B;  1E2V A;  1FYC A;  1A3U A;  1P8L A;  2NVX H;  4YIJ A;  1DCZ A;  3GDE A;  4B9X A;  3FEW X;  4DV3 L;  1SMY D;  2HQL A;  4X64 Q;  4DXG A;  1VCI A;  1Z9F A;  1PH5 A;  1U4M A;  3OWF A;  1STE A;  4IAL A;  3W1B A;  1VQ8 A;  3A0J A;  4H7B A;  1CKN A;  2YTY A;  2R6G A;  1K8M A; 
#chains in the Genus database with same CATH homology
 2E2J B;  1G91 A;  2MHV A;  2K03 A;  3PO2 B;  1SJH D;  4RKL A;  3QOL A;  3KBG A;  2L4N A;  2PCF B;  3BDO A;  3K0Y A;  1G2S A;  1SFO B;  2A6H C;  5IGB A;  4IUV A;  4NDX A;  4V0B A;  2EXZ A;  4FO2 A;  2F0J A;  5JVG 3;  1GUS A;  1H9J A;  2VB3 X;  5C3E B;  2I07 B;  4IUT A;  2O5I C;  5BN4 A;  4QMG A;  1EU3 A;  2ICE C;  4KN7 C;  4RH6 A;  1L0X B;  2HCC A;  2JYO A;  2L11 A;  1SMY C;  2VB2 X;  4K6D A;  1KNE A;  4BS9 A;  2NVQ B;  2IX0 A;  3M85 A;  1Q90 A;  4J6H A;  2DNE A;  3A56 A;  4RAU C;  1U4L A;  2PZW A;  1I4X A;  3IFD A;  2NZ1 D;  3HOU B;  1D6E C;  5C0X H;  3DWP A;  2L12 A;  3LNN A;  3Q24 A;  2ZXR A;  1FD7 D;  1V43 A;  5JAV A;  2MP0 B;  3A7L A;  3G6J B;  3OWE B;  1Y1W B;  1EY5 A;  2RVL A;  2K32 A;  4DNT B;  1JWM D;  2F0D A;  3I73 A;  1HPC A;  4ZK9 B;  1SNQ A;  1STG A;  1GLB F;  3JAM E;  2XRS D;  2JE6 I;  5FOB B;  3E6Z X;  1FNV A;  2PW7 A;  2PYK A;  3C46 A;  3A8J E;  1I4Q A;  1LTG D;  4AYB B;  1U9R A;  2F0O A;  2EOT A;  3TP5 A;  4EQP A;  1F3Z A;  5I9O A;  4FNF A;  5KYL A;  5KND A;  3R3O A;  4FXG C;  4A3K B;  1CTM A;  3DEP A;  2X6G A;  4C3J G;  4QPB A;  3I4M B;  3MEH A;  4JK1 C;  4QUF A;  3MZ5 A;  2GU1 A;  1D5Z C;  1KLU D;  5G3L F;  1PTO D;  4CJ2 C;  1DYQ A;  4ZUI A;  5D14 A;  1A3T A;  1QB5 D;  4OL7 A;  1GGR A;  4F8M A;  2HCI A;  3VA7 A;  2E75 C;  4L8J A;  2CHB D;  1WTP A;  2SDF A;  1BCP D;  1F2Y A;  2EYM A;  4H44 C;  2Q8I B;  2B2T C;  3S2D B;  2GA4 B;  4NP5 A;  2F0K A;  4C3I B;  1ENF A;  3MXU A;  3BDC A;  2F0L A;  2B2T A;  1SNP A;  1MSG A;  2KJX A;  1G29 1;  1GUT A;  3VA5 A;  1SYE A;  2E74 C;  4KK7 A;  3A8K E;  4RWS C;  1SYG A;  1OO9 B;  3OHX C;  4N9P A;  4DN4 M;  1RTO A;  3M7G A;  3KLR A;  4HAE A;  2R7Z B;  1NR2 A;  2MGS A;  4OGQ C;  4PMW A;  1LT5 D;  2N55 A;  2RKS A;  4K8I A;  3P20 A;  1LTR D;  3FMC A;  1PTO C;  1HA5 A;  2IL8 A;  2F0V A;  1GHK A;  4WJW A;  1SBB B;  3Q23 A;  1ESR A;  1I50 B;  1EIH A;  1TWG B;  5M3F B;  3H6M A;  3SDZ A;  4RNY A;  4RGM A;  1Y8O B;  4RKB A;  1HXY D;  2B2W C;  3NYY A;  2K04 A;  1BCP C;  1ICW A;  3NSW A;  3W2D A;  1PLF A;  1ONL A;  1HQM C;  1PZJ D;  1ET9 A;  2EYH A;  2EZV A;  2QCP X;  2A6E C;  1AZP A;  2NVX B;  4LMQ D;  2B2W A;  4KD4 A;  1WTV A;  1IHZ A;  3DM1 A;  4RA8 A;  1QWY A;  2BCO A;  4HCS A;  3KLS X;  1BQQ T;  3DHQ A;  5E1F A;  1I4R A;  5C5L A;  3CSQ A;  2XSC A;  3A54 A;  1QJO A;  5IOC A;  2KEE A;  1CFM A;  4G7H C;  1JR0 D;  1W6K A;  2FMC A;  1QE6 A;  4MN3 A;  1I6H B;  3K58 A;  1HFN A;  3K5M A;  3D6W A;  3GTQ B;  4RFB A;  1H9M A;  1J8I A;  5JPM C;  2F0E A;  1Q1B A;  2A69 C;  3FPP A;  1ZKO A;  4P2C B;  2KQ3 A;  1V1P A;  1IYU A;  3GTP B;  4FF4 A;  5I2X A;  3FKI B;  3J7A F;  2F0I A;  2K33 A;  1Y1V B;  5D65 A;  4DAY A;  4JBW A;  1YNJ C;  4KTA A;  2EYO A;  4FVM A;  4F7X A;  1GUG A;  5ISR A;  2XVS A;  1JIC A;  2PZT A;  2A73 B;  1JB3 A;  5ELE A;  1S5D D;  3TP6 A;  1YNN D;  1V1O A;  4KY5 A;  5E3F A;  1AZQ A;  5EPK A;  1RCV D;  3I4N B;  3BVZ A;  4EQO A;  1U4P A;  1XXG A;  2SNM A;  2EJM A;  3I91 A;  2JA8 B;  2AQ2 B;  1G2T A;  2WKC A;  1PTO F;  2KUM A;  4K2L A;  4K6L A;  2KA7 A;  1M8A A;  3GTK B;  1TS3 A;  3D8G A;  3R8B A;  1PZI D;  4I65 A;  3NTI A;  5IGG A;  1BCP F;  4ODG A;  3TDQ A;  1AP0 A;  3J80 E;  4Q5V A;  4PMC A;  3EQL C;  2E76 C;  3F2U A;  1JOK A;  4JBW M;  4IZ8 A;  4TRD A;  1SSO A;  4M1U B;  4DFA A;  3TZU A;  2F0T A;  3UI2 A;  4C1N I;  5FKA C;  5I2Y A;  3HOW B;  1OXU A;  4KD3 A;  3Q0A A;  1BNZ A;  3L9A X;  1M4V A;  2L1B A;  1HQR D;  1O7Z A;  3AMU A;  1GLA F;  3CRL C;  1WCM B;  4LAA A;  2EE1 A;  2MUY A;  3EJI A;  4L6T B;  2B8G A;  3RUZ A;  4KI0 A;  1I4H A;  4CJ0 B;  1EY6 A;  4ZYS A;  4A3B B;  2AUJ D;  2XN9 C;  4QP5 A;  2WAC A;  2ZXP A;  3BZD B;  3H91 A;  3HOV B;  2F3W A;  4HED A;  1Z7T A;  3ERQ A;  4CHT B;  5A2Q E;  1HUN A;  1E2Z A;  1H9K A;  4LJZ C;  4DK1 A;  1D2B A;  5DNF A;  3QB3 A;  4IFD J;  4Q0F A;  5FLX E;  2ICI A;  2PO4 A;  4XQJ A;  4O42 A;  1F9R A;  4DAV A;  1D1I A;  2R93 B;  2BE5 C;  4ID6 A;  4FF3 A;  1BF4 A;  5IIF A;  3MA2 B;  1A2T A;  4A3E B;  1EYD A;  2C5C A;  2NBF A;  2M2L A;  4HSV A;  5CV5 A;  3HS0 C;  4G57 A;  3TP8 A;  4I7Z C;  1EEI D;  3DMU A;  2F4I A;  3LX0 A;  1Q1E A;  4G7O C;  2DN8 A;  2BDN A;  2NWG A;  5I4D A;  2FFK B;  2RDF A;  4OO1 G;  2AQ3 B;  3NK9 A;  1DXM A;  4TQU S;  1ZYR D;  3OMC A;  3FVQ A;  4Z9C B;  3IAY A;  3BYY B;  5A35 A;  1CI3 M;  5C3W A;  3O13 A;  3T16 A;  3MXP A;  4N9T A;  3SK5 A;  1JOR A;  2NN6 I;  3I4L A;  2WIN B;  3V05 A;  1DON A;  1STH A;  3I72 A;  3H3V C;  2F1M A;  4ZAI A;  5M5W B;  2RBM A;  2D62 A;  4C56 C;  4CGY B;  5I6Y A;  1TU2 B;  4DGZ A;  1KDB A;  1RHP A;  2B39 A;  2PQE A;  2X69 A;  3R93 A;  3MTS A;  4XQQ A;  2WV6 D;  2XWJ B;  1A15 A;  1NSN S;  1OXS C;  3HRZ C;  1VMC A;  1HA6 A;  1NR4 A;  2JP1 A;  2F0Q A;  1EY0 A;  5C44 B;  5COR A;  2G9H D;  3U9O A;  1TR5 A;  4DA2 A;  4XIG S;  4OO1 I;  1NCV A;  4IUP A;  1EEF D;  1G8Z D;  2B2Y C;  3K6O A;  1SYB A;  3HOY B;  1S5B D;  1ZXT A;  2VXW A;  4J1M A;  2IJ0 A;  1PRT B;  2B2Y A;  4BH5 A;  2NVY B;  1H9R A;  2EY6 A;  3MC0 B;  3MAQ A;  2CVR A;  3MFY A;  4KKU A;  3ND9 A;  5E4W C;  5ELD A;  1H9S B;  2SOB A;  1JOQ A;  5J39 A;  3M4Y A;  3E0J A;  3RZD B;  2I46 A;  2ENB A;  5KNC A;  4ABN A;  2YU9 B;  2XIW A;  1QNK A;  3GTG B;  4ZYB A;  4PMB A;  1CQF A;  2EY2 A;  2H1E A;  3C1F A;  4J8Q A;  5F2D A;  2QF7 A;  1SE4 A;  1WTX A;  4IFD G;  3C1E A;  4KKS A;  2E2D C;  4EGV A;  1I3Q B;  4B08 A;  3Q6S A;  5HGT A;  1OXX K;  2HDL A;  4HTH A;  4FXD A;  3ND8 A;  4C3H G;  2KCC A;  2A68 D;  3G7L A;  3J81 E;  1VF5 C;  3K5L A;  4KJN A;  3GTJ B;  3DWQ A;  4E6I A;  2DY7 A;  1SYF A;  1W6J A;  4U67 3;  1F3G A;  1IKL A;  1B9M A;  1EY9 A;  1QIL A;  1UNS A;  3OIQ A;  3M4O B;  5K36 G;  3I3C A;  3MXN A;  1OXV A;  4RHR A;  3M3Y B;  3BYT B;  2EYF A;  1IW7 D;  3H0G B;  4LK1 C;  1GJX A;  4NW2 A;  3TUF B;  5J1Z A;  4R8I A;  3FRP B;  2O5J C;  1V8Q A;  3R2T A;  2WII B;  3QOJ A;  4IFD I;  3PUV A;  1EQV A;  5CV9 A;  2WKD A;  3KF8 A;  2IPK D;  1PZK D;  2ID0 A;  5KYI A;  1RD9 D;  3Q22 A;  2AQ1 B;  4F88 A;  3VR3 A;  3TN2 A;  1R4P B;  5IGE A;  3PIO 3;  3H09 A;  2F3V A;  4X3U A;  3NQT A;  4FF2 A;  2AWN A;  3CQZ B;  3MXG A;  4H13 C;  2SEB D;  4RHS A;  2FMM A;  4A93 B;  3KK7 A;  2CW0 D;  1Y8N B;  4G4K A;  1D5M C;  5EPL A;  1STB A;  3NQI A;  5M9O A;  4K5W A;  2FIN B;  4B9W A;  3OW7 A;  5ELB A;  3X3M A;  5JEA J;  3W3A A;  3N6R A;  3VYT A;  1WD0 A;  3MHB A;  1PXU A;  2F0P A;  1BBX C;  1GLE F;  1MD2 D;  1VMP A;  4DF7 A;  4F87 A;  5KVP A;  3SK8 A;  4UDU C;  2AUK A;  5CR3 A;  5CV8 A;  5DM7 3;  1TWA B;  5I9P A;  5CGK A;  4BY1 B;  3HP3 A;  1STA A;  2XNA C;  3S14 B;  2IT1 A;  5JOB A;  4TKO B;  1GOZ A;  2F0M A;  1O2F A;  1KLG D;  2EVB A;  1ROD A;  2AWO A;  4LXC A;  2F0S A;  2PNR C;  1WTQ A;  1LV9 A;  1MGS A;  1X3Q A;  3WDN A;  4C3J B;  1HHV A;  1IL8 A;  2KHS A;  2KOL A;  3PV0 A;  2JEA I;  2D2C C;  2PMZ B;  1GUN A;  1MBY A;  3S1R B;  3J7A V;  2F03 A;  3CU7 A;  4XT1 B;  1TII D;  3C2P A;  4GZY C;  1RKN A;  3SK6 A;  2O4X A;  2Y0S B;  1O78 A;  1TWF B;  2JEB I;  3T51 B;  2CW0 C;  1F9P A;  3KBX A;  1A3V A;  2JSO A;  5CBA E;  3NWS A;  4UAI A;  4TSS A;  2H4O A;  4RGO S;  4KHV A;  3S1M B;  2HUG A;  1CA5 A;  2B8F A;  3RZO B;  1CT1 D;  2LKV A;  1SNO A;  3QWN A;  2JA7 B;  2QIL A;  4IUR A;  2SNS A;  4X3K A;  4OIK A;  3EVQ A;  5CC4 A;  3K7A B;  1QCB D;  4WFN 3;  1PTO H;  2MP1 A;  2YYZ A;  4V19 0;  2O2L D;  5IT9 E;  5CYU A;  2VUM B;  2N88 A;  2F0H A;  3ONA B;  4QUC A;  5IGD A;  2QEJ C;  4BY7 B;  4BBS B;  4ME5 A;  4XDX A;  1DOK A;  1CK1 A;  1PYW D;  4OO1 H;  1LTB D;  4DK0 A;  3D31 A;  3DEO A;  1D1K A;  5C3X A;  2FHT A;  5COY A;  1S4Z A;  1E2W A;  2M9V A;  2LMC B;  3HGB A;  4PQX A;  2Z1C A;  1Q3L A;  1TKW B;  4KY7 A;  4IUN A;  2L5T A;  3ZYY X;  3L3O C;  3PUX A;  5JVH 3;  2PZU A;  2LS0 1;  5EKI A;  3SEB A;  1EYA A;  2RQX A;  3AU7 A;  1GLD F;  1JWS D;  1GPR A;  2TMP A;  4KN4 C;  3URY A;  3WOF A;  1DJR D;  2NTT A;  3M7N A;  3TBI B;  1F9S A;  1YNN C;  1FGB D;  1PFM A;  5DM6 3;  2EYJ A;  1EWC A;  3P1H A;  3K5N A;  5JEA G;  1LAC A;  5KNB A;  1QNU A;  4HMI A;  1TS2 A;  1JC7 A;  1CA6 A;  5C4Z A;  3NXW A;  3QO2 A;  3BDL A;  3PO3 B;  1WTW A;  5CV4 A;  3VYS A;  2X6L A;  3VYU A;  3X3N A;  4WOR A;  4HMJ A;  1SNM A;  1KDC A;  2KEC A;  4XYQ A;  1KAA A;  4U68 A;  3PIP 3;  4KJO A;  2CQA A;  2MPM A;  1B53 A;  2HSI A;  1A2U A;  2K5W A;  2NN6 G;  4O1N A;  4CKC A;  3UZ0 B;  1AX3 A;  1ENA A;  1EZ8 A;  3VR2 A;  1LT4 D;  2L55 A;  1K8O A;  1BR9 A;  1LT6 D;  3V96 A;  1DZ1 A;  4PNY A;  1I4G A;  3D4R A;  4M8A A;  1XYI A;  1ML0 D;  4HSP A;  4IUU A;  5LL6 X;  3KLS A;  1DOL A;  1B9N A;  2D9U A;  3FPU B;  2V4D A;  5CV7 A;  1X3P A;  4IN3 A;  3OUR B;  1BOS A;  1RF2 D;  3SE0 A;  2DNC A;  4RCN A;  3K59 A;  2Z4H A;  1CZG A;  3JAM L;  3S16 B;  4IFD H;  1LTA D;  1E0B A;  2QKI C;  4FP5 D;  4Y7N B;  3I70 A;  2A6H D;  1FNU A;  2EY5 A;  2D5D A;  3EA6 A;  1UEA B;  5CBE E;  2R61 A;  1WTO A;  5JPN C;  3IFT A;  1BXT A;  5HUR A;  2Q8R E;  1BUV T;  5CV6 A;  1SNC A;  4R9W A;  1KDA A;  1AN8 A;  4C1N K;  2G9D A;  3OIP A;  3PUZ A;  5D3I B;  2KCN A;  3SHL A;  3D6C A;  4ZRZ A;  2A5H A;  3OMG A;  5FO9 B;  4QIW B;  5K36 H;  3S1Q B;  2E2H B;  5C5M A;  4X3T A;  1MI2 A;  1EIG A;  1TY0 A;  1R4Q B;  2IX1 A;  1SDF A;  2EJG C;  1JE4 A;  1F2M A;  3NTH A;  3RLF A;  4R8N A;  3OPO A;  1SYD A;  1RTN A;  1TT2 A;  2M00 A;  3OSO A;  3P75 A;  1F2L A;  2OXP A;  2K6A A;  3NPP A;  4RGN A;  1IKM A;  1EY7 A;  3S15 B;  1LAB A;  1TVX A;  3MWY W;  3HOX B;  3S9W A;  3IKJ A;  1ILP A;  5DAU A;  1I6V C;  2EDG A;  2QDB A;  4QF4 A;  4S3S A;  4XTC S;  1ZYR C;  3NBI A;  1NAP A;  4A3M B;  3NBH A;  4IQZ A;  2EYL A;  1CZW A;  4HN7 A;  5E4X A;  5KIX A;  4RGT A;  3J7Y W;  3QG1 A;  2R92 B;  3NTK A;  3U9S A;  2IX3 A;  4FYD A;  1ET6 A;  5C0X J;  1JOO A;  1ENC A;  2LY7 A;  3NWT A;  2C9O A;  4FF1 A;  1CQV A;  3A7A B;  3GP7 A;  4A3D B;  3HOZ B;  5T1I A;  4C3I G;  1PTO B;  2HDM A;  1KTK A;  1DOM A;  4KV6 A;  3TP7 A;  2ZT9 C;  3A8I E;  1CHQ D;  3IT5 A;  4BBR B;  1Y8P B;  3T13 A;  2F0G A;  1HFG A;  5FO7 B;  4IUQ A;  1BCP B;  1EYC A;  3RMH A;  3MVV A;  2NUC A;  3IL8 A;  1ILQ A;  1R9T B;  1ZEQ X;  2RSN A;  3HKZ B;  1II3 A;  4ZQ3 A;  5KGU A;  4K8J A;  3MFG A;  2L0C A;  1B3A A;  4FXK C;  2BA1 A;  4QB4 A;  5KEE A;  2PPB C;  5I6W A;  1LO5 D;  3SXH A;  4BWG B;  1SE3 A;  1FR3 A;  2OEO A;  2BDO A;  3VR4 A;  2F0U A;  1TQO A;  2NYZ D;  2A74 C;  1S5F D;  3LWE A;  5M5X B;  4A3J B;  1MSH A;  1RJT A;  5JJZ A;  3NE5 B;  1BDO A;  3AB9 A;  1QOH A;  5C6A A;  2OT2 A;  2IW3 A;  1SYC A;  4QCL A;  5C4J B;  4DAP A;  1LTI D;  1PRT D;  4RNZ A;  1V1P B;  3C3L A;  4ZUJ A;  2F0N A;  3D4D A;  5ELF A;  4DXF A;  3GO5 A;  3N52 A;  1VF7 A;  3QIA A;  1FNW A;  5DEH A;  3DUZ A;  4G7Z C;  3S2H B;  1JWU D;  3GTL B;  2ZXO A;  4CKE A;  3PMF A;  1JCK B;  1Q12 A;  3NP8 A;  1Y69 U;  5LL6 S;  3K5O A;  4CJ1 B;  3GV6 A;  4ZKC B;  4K2K A;  1O80 A;  1DD2 A;  3SR1 A;  4OIJ A;  1HUM A;  3VR5 A;  2NVT B;  3DWA A;  1O7L A;  1SJE D;  1HTL D;  1G6Z A;  1Z47 A;  2WB1 B;  1B4O A;  2A6E D;  5IT9 L;  5FO8 B;  4XXE A;  3D4W A;  5EKL A;  2A68 C;  4DNR B;  3T56 B;  1EQT A;  5C4X B;  1XTC D;  4HCE A;  1TS5 A;  4BA2 I;  3L7Z C;  1EWH A;  2Z8L A;  1U4R A;  4C2M B;  1C4Q A;  1NUC A;  1K83 B;  2OF1 A;  4ILW A;  5EQ0 A;  2LFN A;  2J0T D;  2B2U C;  2B13 A;  1PFN A;  1PRT C;  1IW7 C;  1TWH B;  1RDP D;  3GQB A;  2WAQ B;  3HEJ A;  3TME A;  1HTP A;  4EQN A;  4NKL A;  4ZKB B;  2RSO A;  2B2U A;  4CKB A;  1A6X A;  2VNU D;  3D3R A;  1LLR D;  1PFB A;  3J80 L;  5C0X G;  1GXD C;  2XWB B;  3V2T A;  3WOE A;  4RCO A;  4C3H B;  1TWC B;  2A69 D;  1EFI D;  4OHJ A;  1H9S A;  5BN3 A;  4A3I B;  2RA4 A;  3VYR A;  1STN A;  1WTR A;  2B63 B;  3KUP A;  1YNJ D;  3A55 A;  5JEA H;  2HQE A;  1CHP D;  4L63 B;  2L9H A;  3ERO A;  2FJ2 A;  4K5X A;  1WD1 A;  3PUY A;  3VR6 A;  2K5D A;  1SEB D;  5EGT A;  2PW5 A;  3T53 B;  3LWU A;  2E2I B;  4EVO A;  3E5S A;  1EL0 A;  1EU4 A;  3NHH A;  3H94 A;  1SXT A;  1QG7 A;  3S17 B;  2EJF C;  1EOT A;  1UUP A;  2WP8 J;  5A2Q L;  5M5Y B;  2RDH A;  2NN6 H;  1F9Q A;  2JA5 B;  1AEX A;  1HRJ A;  2F3G A;  2Z4I A;  5D3D A;  5FLX L;  3ITP A;  4ZLT F;  1B50 A;  5B0H A;  5C0X I;  1C48 A;  5AFW A;  3SLU A;  2K28 A;  2F0F A;  2K1B A;  1IYV A;  1UAP A;  3QJY A;  1PMR A;  1JQY D;  4KHZ A;  1C8C A;  1EZ6 A;  2J7Z A;  5IOD A;  5EBD A;  1B44 D;  2K01 A;  3P7J A;  2KVM A;  5EBC A;  4H0L C;  1EY4 A;  3T4A C;  4XYO A;  2F0W A;  1SE2 A;  4XT3 B;  5EJW A;  1PRT F;  2BA0 A;  3FDT A;  5K5P A;  1TS4 A;  5KRU A;  4ULL A;  2B2V C;  1LTS D;  1GLC F;  4DU9 A;  1AW7 A;  1TY2 A;  5EPJ A;  2JXM B;  3TZD A;  1X32 A;  2BOS A;  4BA1 I;  1AFP A;  2B2V A;  4KMU C;  1O7Y A;  1HCZ A;  5ELC A;  2NB0 A;  2NTS A;  1ESF A;  1LTT D;  2B44 A;  3CKI B;  3GTM B;  3RD4 A;  2J4X A;  2EPB A;  2BE5 D;  3I8Z A;  3HG9 A;  1KAB A;  3EFX D;  1EY8 A;  1T5X D;  1I4P A;  3BVG A;  1F2Z A;  2Q8T A;  4A3G B;  4KY6 A;  3GTO B;  1L0Y B;  3GD7 A;  1F77 A;  4MIU A;  4XQN A;  1CM9 A;  1PDQ A;  5M3M B;  1GUO A;  3TSS A;  3IT7 A;  3BVM A;  5EKK A;  1B2T A;  3CRK C;  1XWE A;  3SK4 A;  1STY A;  4HR7 B;  4K5V A;  3PUW A;  2GPR A;  5LHY 1;  3HZX A;  1VDZ A;  4K14 A;  2K7V A;  5NUC A;  1LT3 D;  5IGC A;  3BG3 A;  3OOC A;  1S5E D;  2RDG A;  5TSS A;  2EYP A;  1SAP A;  5G3L D;  2K05 A;  2MJ8 A;  2TSS A;  4PV1 C;  5FK9 C;  3BS1 A;  4KKT A;  4X3S A;  1SND A;  1Z6H A;  3CHB D;  5C4H A;  2K5Q A;  3I90 A;  4MHE A;  3SVM A;  3DXJ C;  2IWH A;  1XX8 A;  2EY1 A;  4WRD A;  4A3F B;  2KED A;  1J9O A;  1D5X C;  2DY8 A;  1KNA A;  5T1G A;  1DM0 B;  1BO0 A;  2R3Z A;  5J22 A;  1GUW A;  3NUC A;  1T5E A;  1Q8I A;  3K57 A;  2JA6 B;  3R2I A;  1GHJ A;  2XRQ D;  3J81 L;  3GV3 A;  1WVL A;  5BN5 A;  4CBV A;  5IGF A;  1OXT A;  5CMD A;  4NMZ A;  2B0P A;  1B1Z A;  3S1N B;  1E2V A;  1FYC A;  1A3U A;  4YIJ A;  1DCZ A;  4B9X A;  3FEW X;  1SMY D;  4DXG A;  1VCI A;  1U4M A;  3OWF A;  1STE A;  4IAL A;  4H7B A;  1S5C D;  2R6G A;  1K8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...