1QWYA

Latent lytm at 1.3 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
270
structure length
234
Chain Sequence
VSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSSGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Latent LytM at 1.3A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Hydrolase
molecule keywords peptidoglycan hydrolase
total genus 66
structure length 234
sequence length 270
ec nomenclature ec 3.4.24.75: Lysostaphin.
pdb deposition date 2003-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.290 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qwyA01
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 1qwyA02
3TUFB 3IT7A 1GLBF 4QP5A 1GLCF 1GLEF 3NYYA 1AX3A 4LXCA 5KVPA 2GPRA 1GGRA 3OURB 1F3ZA 4RNZA 2B13A 2GU1A 4BH5A 3IT5A 1O2FA 2F3GA 2HSIA 2B0PA 2MP0B 5B0HA 1GLDF 1GPRA 3CSQA 3UZ0B 3SLUA 4ZYBA 4RNYA 4QPBA 1F3GA 1GLAF 2B44A 1QWYA 4JBWM
chains in the Genus database with same CATH superfamily
1SYDA 4EVOA 3H09A 3MAQA 3GP7A 2WAQG 4QGUA 1CM9A 1HQRD 1A0IA 1C4QA 1STAA 3HOXG 2NZOA 4NKLA 1J9OA 1QB5D 2PZWA 3E9IA 4BS9A 3T1YQ 1EOTA 3RN5A 5EKLA 1AH9A 4Y7NH 4IOAA 4TKOB 4IUUA 3TREA 3PF5A 4ZUJA 3PUZA 2OQ0A 1PV4A 4OEMB 5CR3A 4FF3A 2O2LD 4YWKA 2KHSA 3UDFA 1IBML 3PSIA 2PW7A 2ZTEA 1ASZA 1UEBA 3BYYB 1EWIA 1STHA 3GQBA 3KLSX 3TP8A 5DAUA 2A5HA 1STYA 3F2UA 4HCEA 3GTQB 4JV5Q 2Q8RE 1O7LA 2A6ED 3ULPA 4RH6A 2UUCL 1PH3A 1UE7A 4K6DA 2K14A 4I7ZC 3C3LA 3BYTB 4IQZA 3T1YL 5KGUA 4A3FB 2LY7A 4KD4A 1L2FA 4DAMA 1RDPD 1YHBA 4JI6L 2IJ0A 4EQNA 4DAYA 4M8AA 2K01A 3H3VC 4GS3A 5FLMG 5A2QL 4R9WA 3K59A 2R6GA 4U673 3K80C 1VF7A 4X3TA 4O0AA 2E5LQ 3RUZA 2E2JH 1E0BA 1UE1A 1HZBA 2PMZB 1JICA 4DXGA 1SYFA 3M4PA 1VQGA 5E3FA 1L1OB 5I2YA 1STBA 4O1NA 3DWAA 4JI2Q 4DV4Q 4WFN3 1C8CA 5JEAJ 3NQIA 3PO2B 4K8IA 2UXDL 3KBXA 5J39A 1TS5A 3KFUA 1KABA 1K83B 2CH4A 2L12A 3KDFB 2VUMH 1LV9A 4FNFA 4B3SL 4GZYC 4DUYL 2QEXA 3P1HA 3T56B 4IFDG 3CC2A 2VXWA 4XT1B 5CBAE 5HY6A 4OWWB 4UPAA 4LF4Q 1FJGQ 5C0XH 3HOXB 2B2UC 3W1GA 1Q46A 1J6QA 3QOLA 1EQRA 1I94L 2JA5G 2E75C 1Q1BA 4LF8L 2UUBQ 3W5OA 2JQOA 5KNBA 1SAPA 2F0HA 3CAMA 3U50C 1CTMA 2HHHL 1EYCA 5EPLA 2EYFA 2A1AA 3WDNA 1CZWA 2AUKA 1HFGA 3ERQA 4R4IA 2JYOA 4OGQC 2GVBA 4BA2I 4N9PA 2EYLA 2QILA 3VYUA 2F0NA 1RL2A 3MXGA 3TQYA 3HOUG 3S16H 1ILPA 4H02A 4OX9L 4OO1H 1EYGA 1TQOA 4IURA 3HS0C 3LWEA 2ZXRA 4DGZA 2BDNA 3EQLC 3E0JA 2JE6I 1T9HA 4K2LA 2JA7H 2AHOB 1Z7TA 3FMCA 1JWUD 3SE0A 4DV3Q 3UDGA 2K50A 2K6AA 4FVMA 3SLUA 1PHJA 1WTXA 3VA7A 1LABA 2I5MX 2EXZA 3IAYA 4DNIA 4ZLTF 2EYJA 3P7JA 1PZKD 3C1EA 3HOZB 1YJNA 4RGMA 1SJED 1G91A 4TRDA 1DOMA 1TXYA 4UDUC 1Q7YC 1GUOA 2E76C 2C9OA 1SNDA 1E24A 3GTOH 4F87A 3SK8A 4YCVA 4DV5Q 2OT2A 2OXPA 3M9BA 3HOZH 2RKSA 3I56A 4OL7A 1W6JA 2C5CA 2XIWA 4UY8C 3CCSA 3HZXA 4BY7B 1N9WA 1TU2B 4FP5D 4CBVA 5IYBG 1OXTA 2EY1A 5CYUA 5I9PA 3S9WA 4YY3Q 4JI8Q 4DK0A 1G2SA 1YI2A 1NJIC 2IX1A 1QJOA 3I55A 5IODA 1RODA 1SDFA 1HZ9A 2X69A 3UE0A 3G4SA 4DU9A 1JORA 3L9AX 1GUGA 2JEAI 1C9OA 2JEBI 4ZRZA 2DJGC 5LL6S 5M5XB 3G6EA 4CDEC 4A3FG 3Q0AA 1N33L 3N6RA 5J1ZA 4BXXH 4UHVA 5C4XG 4JOIA 4YCWA 1VMCA 2HDLA 4GNXC 3OW7A 1WD1A 4JI0L 2EQSA 4A3FH 1JOKA 1QZHA 3I73A 1DGSA 4BA1I 5LMNQ 4DR6L 3R2TA 3JC66 4JI4L 2XGTA 2K75A 4IPHA 3K5MA 3WWVA 4DUZL 5D3DA 5C4JH 1SE4A 4I7AA 2A6HC 1X54A 2LFNA 4J8QA 4B3MQ 4IUPA 1U5KA 5C4XH 2O4XA 1OO9B 2Q8IB 2N55A 5IWAQ 2QW7A 4JI7L 2JP1A 1EFID 2N8NA 1SYCA 1TIID 3NELA 5CV8A 4OX9Q 2B13A 4GN3B 4G7ZC 3EBEA 4LNQA 4K6LA 5ELDA 1A2UA 3K0YA 1IKLA 1DOKA 3U4VA 1SMXA 4LMQD 3HEJA 2OQKA 2E2IH 1HPCA 2PCFB 1LT4D 4NDXA 1PYWD 1PVOA 1CSPA 3KBGA 2CFMA 3R2IA 5LMNW 2F0QA 3JAMi 3NE5B 2BA1A 4L5SA 1R4PB 1G6ZA 4HN7A 2KVMA 4JI5Q 2Q8TA 2N3SA 2EY2A 3D0FA 4PMCA 3E5SA 3KYHC 3KJPA 1PZJD 3FHWA 1F9SA 1QVFA 4LWCA 4XQQA 1KLUD 4B3TL 1JWMD 4L8JA 5BN3A 4WJWA 3OTOL 3S15B 2Z0SA 5FLXE 3VYTA 2F0FA 1VF5C 2YTXA 4GKJL 2KCMA 4B3RQ 5G3LF 2J4XA 3DLLA 2NB0A 1VQDA 1GM5A 1SNCA 2Y0SG 4BBSB 5E7NA 1VQAA 1BF4A 3LX0A 4C2MH 2LXKA 3DWQA 1JCKB 1CHPD 2NZ1D 1LT3D 1V43A 3VYRA 3CMAA 1QNKA 1HZCA 4KN7C 3HKZG 4A3EG 2BH8A 2FHTA 4B3SQ 4LK1C 1VQIA 1HTLD 2JN4A 4LF4L 4LF5Q 1SE8A 1Y69U 3VR5A 4A3GB 5I6YA 1Q82C 4RKBA 2K5HA 2RCNA 3CCUA 4A3KH 2MPMA 2YU9B 1YHAA 3HOZG 4IJHA 2E2HB 4JYAL 1FNVA 3NTIA 4LF8Q 1W6KA 3NBHA 1N34L 4ME3A 2UXDQ 5JJZA 2MO1A 2X6GA 3I2ZA 2K04A 1XMQL 3MFGA 1IBLQ 2F0KA 1X3QA 4RGOS 4LJZC 2MUYA 4M1UB 1H9SA 2MFIA 1QVGA 3RLFA 2IHFA 4K8JA 1WTHA 4FF4A 4XXEA 4RCNA 2QDLA 4JOIC 3STBD 1X9NA 4EQ5A 1N34Q 2NVYH 5GADC 1RKNA 4KI0A 2M00A 3I4LA 3SXHA 2ZM6L 1GUNA 1IZ6A 1AFPA 3PUWA 2B2VC 3KLRA 1Q8KA 1X65A 1ONLA 2QDBA 3RN2A 3MTSA 4BH5A 2RA4A 1PRTF 4A3IB 2FMCA 1QUQA 1UEAB 5BR8Q 2UXCL 1GUTA 3J80L 3FDTA 4DN4M 5CC4A 1EEID 3RLOA 4A3DH 1XNRL 5IYCH 3MC0B 3CD6A 1YNJD 1SEBD 2RDHA 3GTMB 1QVCA 1XMOQ 1XMOL 2R7ZG 5M9OA 2B2YA 1QNUA 2OWOA 2RHSB 1EU4A 4CJ2C 2E2HH 4IUTA 1ICWA 1S5BD 2HT1A 4N8X1 1STEA 3K5OA 1PYBA 1S3OA 4DF7A 3CC4A 4IO9A 3I4NB 2UXCQ 1FNUA 3PGZA 1UNSA 3I4MG 3N52A 1BCPF 3BDCA 2L9HA 2IW3A 3VDYA 3F2BA 2XTIA 1PRTB 1R9TH 5D14A 1PFBA 2B2YC 4NP5A 4C56C 4EQPA 3PUVA 3GTPH 3S1QB 1JE4A 1X3GA 2JA6H 5CV9A 2R7ZH 1PMRA 1KXLA 4DR3Q 2EYOA 1IHZA 3S2HB 2WKCA 5K5PA 4LF9Q 3J81i 2D62A 5GQOA 1KHIA 4YWLA 3CCMA 3IKJA 1DJRD 1B2TA 4HTHA 1GLAF 2JSOA 3G6JB 1BDOA 1U0LA 1PRTD 5IGFA 2CH4W 4J15A 4GNXA 1JOQA 3MFYA 1VQ9A 1M90C 5HURA 1VQFA 1XMQQ 4GOPA 4X6AH 5IGEA 2HD3A 5JAVA 4ZK9B 2F0GA 1Y1VH 5B0HA 2FMMA 3CPFA 3NSWA 4HJ7A 2L1BA 3FKIH 1G2TA 5LMUL 4DNRB 4DR1Q 4AQYQ 2V1CC 1F9RA 1YZ6A 2GVAA 4ZKCB 5GAHC 5C44H 2F0TA 2ZXPA 1VQCA 2NZHA 3HOUB 2HIXA 2ZJQA 1VQNA 4TQUS 3TBIB 5C0XJ 4KJOA 2K5WA 3GTOB 2VNUD 4KK7A 2DY7A 3EFXD 2HHHQ 1VQ8A 2R92G 4GKKQ 2ENBA 3OW2A 2OTJA 1IXRA 2R7FA 3CU7A 1CFMA 4IPCA 3KOJA 2Z1CA 2WKDA 3J7A5 4A4IA 4JBMA 2NVQB 1SMYD 1U4LA 5DLQE 2NUCA 4KLKA 4QP5A 1Z6HA 4NB3A 3Q22A 5J22A 3BS1A 2EZVA 1BNZA 1AE3A 1MI2A 5IGDA 3CXCA 3OPOA 2B2VA 4QCLA 4ZCKA 3NK9A 4H7BA 2FINB 5IGGA 1F2ZA 3D6CA 4R4TA 2CQOA 4J6HA 1A62A 2Q2TA 1LO5D 4A93B 1JJGA 2WV6D 4DV7L 1NSNS 2EIFA 1HZAA 3C46A 2RSNA 2FJ2A 3S16B 2E74C 2CCZA 2CVRA 1EWHA 2F3VA 1EFWA 2JK8A 3TSSA 1I50B 1S5DD 1F2MA 3HRZC 2MJ8A 1NMFA 1PYSB 1K8MA 2N88A 3TS2A 2NVQH 3X3NA 2UU9Q 3VA5A 3W3AA 3VR3A 4G4KA 3CCVA 4XYOA 5L37A 5IY0A 1HNXL 3DXJC 4ILWA 1BQQT 2R93H 2VZAA 2ZT9C 1EU3A 4OIJA 3QO2A 1LTSD 1II3A 2EPBA 3GV6A 1EY7A 3PUXA 1HA6A 3DHQA 5TSSA 4HIDA 4RMFA 3PO3B 1H9SB 2WB1E 2XRSD 3GV3A 1UAPA 1Y8PB 1LT5D 1TS4A 3NPPA 3BZCA 3JAML 2F0IA 3PO2G 2A68C 4MNOA 5FOBB 5KIXA 5JVG3 3A8KE 5BN5A 2O5JC 1O7IA 3PO2H 3MEFA 4L5RC 5IYDH 5D65A 5ELBA 3TRZA 2F4VL 1X55A 2F3IA 3C1FA 2B2TC 3L0OA 4JI2L 2A6EC 2F0PA 1CA5A 5ELOA 1O7ZA 3VR4A 4UP7A 1F77A 4G7OC 1PTOF 1YHQA 2L4NA 1X3EA 3J81c 4HJ9A 4R8IA 2J7ZA 4MTNA 1P16A 1VQ5A 1IL8A 3CF5A 3S1NB 1A6XA 4HMIA 3SGIA 4KKTA 4DUYQ 1V8QA 2ALYB 2CKZB 2ZTCA 2LXJA 4X66L 2KENA 2K5QA 3KF6B 3PIOA 1LTID 3NXWA 1KDCA 5FO7B 4A3JG 1HA5A 1SNMA 3KF8B 4DR4L 1EL0A 1AZQA 1L1OA 3QJYA 3H6MA 3EROA 3MXNA 4R1JA 4LW1A 4JI7Q 1NR4A 1B9MA 5IIFA 1G6PA 4DKAC 5HGTA 2RF4A 1SSOA 1PXUA 2D0PA 2OEOA 2J0TD 4O2DA 1KRSA 1PLFA 2ZXOA 1YNXA 2VQEQ 2G9DA 1XJVA 2IL8A 3TP5A 2K28A 1XYIA 2UXBL 3AEVA 3CHBD 3ULJA 1GGRA 3U4ZA 1CQFA 5IT9E 4C3JG 1BO0A 5FJ8G 1EY9A 1TWHB 1YBYA 3EVQA 4MHEA 1F2YA 2QA4A 1RJTA 4KY5A 1PH9A 4L5QA 1ML0D 2WB1B 1SN8A 3V96A 4X62L 1B4OA 3TN2A 4B3TQ 2A8VA 3R3OA 3M3YH 1G291 4XTCS 5IP9H 1Q90A 2RHQB 2MQHA 5FLXc 3A0JA 3HKZB 3V2TA 5IT9c 5BN4A 1YNND 1MKHA 1AN8A 5C4ZA 2HQLA 2EY5A 3S15H 2NN6H 5H1SE 3KUPA 4B9XA 2B39A 3QIAA 1K73C 3S14H 4QJFA 1S40A 5CV7A 1CQVA 4JBJA 5C5MA 2XWJB 2HDMA 4A3MG 1Y14B 3RZOB 4C2MB 3S1MH 1I4QA 3A7LA 3CCRA 5M3MG 1LTRD 5ELFA 5IYCG 3S2DH 2IHEA 4ULLA 3IRBA 4DAPA 4A3MH 1VQJA 1QOHA 2EJFC 2F0JA 4EQOA 2BOSA 3HOYG 4A76A 3HOWG 4IOCA 4L63B 2I46A 3H0GB 5C5LA 1HUMA 1Y1VG 5JOBA 3RZOH 1O80A 2NVYB 2MP0B 2AWOA 2I0QA 1PH4A 3MXUA 4F8MA 1EIGA 1PTOD 3J81E 5DEHA 1HXYD 5NUCA 4X65Q 1CT1D 1BUVT 1YNJC 1VQ4A 1E3PA 1LACA 3HOYH 1GOZA 2LSSA 5I2XA 5DM63 2E2IB 5C3EB 5M3FG 1TS3A 3G48A 5FKAC 2VY3A 4BY7H 1DXMA 2PQEA 4ODGA 4A3LG 3H3VH 4A3KB 1KNAA 1SJHD 1XWEA 2M2LA 2QEJC 2ES2A 1A3TA 5IGCA 1U4RA 4V0BA 1STNA 3FPPA 4U68A 5ELEA 2ICIA 4FF2A 1O78A 4ABNA 4DR2Q 1X32A 1K8OA 1AEXA 2XWBB 4BXXG 1X3FA 1K3BC 2F0DA 4A3JH 1EY6A 4C1NK 4E6IA 1K0SA 3DWPA 4C3HB 1K0RA 2A69C 5IP9G 5G3LD 3JAMc 5JJLA 2DGYA 1B53A 5M3FH 2IX0A 2OF1A 1SNPA 1V1OA 2B8GA 5I4DA 3SHLA 3HOUH 4HR7B 1VQPA 4B08A 5IYBH 3I4NG 4AYBB 4XQJA 3C2PA 1CZGA 4A3DG 2B63B 3MVVA 3D31A 4DFAA 2L11A 4CDDC 4V190 2HCIA 1SXTA 1TT2A 4I65A 3PIP3 3FP9A 3PIPA 5GAEC 3SK4A 5IYDG 4Q5VA 3K6OA 2DNCA 1XX8A 1L0WA 4XT3B 4ZAIA 2WP8J 4ZQ3A 2H4OA 1WVLA 3OOCA 5M5YH 4HJAA 1ASYA 4WRDA 3HOVH 2B44A 1HR0Q 3BVMA 5EAYA 3TUFB 5T1IA 1V1QA 2K32A 1TWFH 2Z6KC 1MGSA 3DM1A 2KUMA 3G7LA 1SMYC 4B3RL 2RBMA 4DV0L 3K81C 3OIQA 3OMGA 1GUWA 1EZ6A 2B29A 5EPKA 3URYA 5JEAH 1TWAB 4HCSA 1GHKA 3H3VI 2KHIA 1YIJA 1UE6A 1JE5A 3OWEB 3D4DA 3BVZA 2IX3A 1WTVA 4RNYA 5JEAG 4YIJA 1IBKL 1A63A 4QUFA 3AU7A 2M9VA 4CGYB 3HFZB 1T5XD 4JI5L 1PDQA 4PMBA 1D1IA 5C44B 4IPGA 3L2PA 4PQXA 5C4HA 5JJIA 1EYDA 1KIXA 1Q86C 1XTCD 5DM73 1DM0B 5E4XA 2D9UA 3E0EA 3ER0A 1IBKQ 1GLDF 1S5FD 4IFDI 4JV5L 1P8LA 2NTTA 2JJQA 2E2DC 3DEOA 1BBWA 5EPJA 2JA5H 1I50H 3TZDA 4C3IG 2F0EA 2MHVA 1IW7C 2EYHA 3P75A 3NWSA 2SNMA 1PTOH 4BBRB 2NWGA 2KBNA 4NXNQ 3CKIB 4JPBW 2D2CC 4X3UA 4K14A 3ZJYC 1KLGD 2MNAA 1PFMA 2RVLA 1JWSD 4HMJA 4PZ8A 4PZ6A 3GTJB 3HOWB 4YHHL 1Q3LA 2F0VA 4KD3A 4LAAA 3M4OB 2E2JB 1LYLA 3AYHB 4KN4C 2PNHA 4POFA 4GKKL 2HQEA 1Y1VB 1WTQA 4DR7Q 1UUPA 1WD0A 5FK9C 2CW0C 4JI3L 1BOSA 1SNQA 2B2UA 4A93G 1RF2D 4K0KQ 2Z6BA 4FXGC 2BE5C 2UXBQ 5IWAL 1ICFB 5LHY1 3AMUA 4A3CH 2ZM6Q 2Y0SE 2K5DA 4NXNL 4HJ8A 3F1ZA 1FNWA 1S4ZA 3D6WA 4OO1I 4A3IH 4C3HH 1I3QH 4PZ7A 3F2DA 4BY1G 4DV6Q 2EXDA 5M3FB 2AMCB 2EYMA 3ULLA 1VQBA 4HSVA 1BCPC 2DJFC 3GTGB 2R7ZB 3K57A 1PZID 4DV7Q 1QE6A 1EY4A 4K5WA 3NYYA 1H95A 1JB3A 4OHJA 2KCCA 1EY0A 3IL8A 5BR8L 3NTHA 1PTOC 1CI3M 1I4XA 1FL0A 4S3SA 1Z47A 3S24A 3I4MB 3K0XA 5IP7G 3I4NH 3NUCA 2B2WC 3DEPA 4C3HG 3EJIA 2RDFA 2VQEL 2SOBA 2F0OA 5AJ3Q 5AJ3L 4JI1Q 3IT7A 1WCMH 2D5DA 1TWGH 2ZJPA 3SEBA 3PIO3 2JA7G 1I4HA 1K28A 4RCOA 4RWSC 2RDGA 1K8AC 3W2DA 3D4RA 4Y7NB 3S2HH 3SK5A 3BZDB 4ZYBA 4YWMA 4PV1C 1HRJA 2EE1A 4DV5L 4KHZA 4DR5Q 1GHJA 2SDFA 1E2VA 4C1NI 1TR5A 2XNAC 1B3AA 2GPRA 2ID0A 4LF9L 4GN4B 1F3ZA 1FVIA 2F0MA 3HOXH 2F4VQ 2F0WA 3RZDB 4JBKA 1PH1A 5C0XI 1NY4A 1T5EA 2IY5B 5C4XB 3ND8A 1Q81C 2JA8B 1K3RA 4XDXA 3TEHB 1WJJA 1VQKA 4NW2A 1HNWQ 3M7NA 1B9NA 3S1NH 1W3SA 3UE1A 2MP1A 1V1PB 2K4KA 3I4MH 2F0SA 2PMZE 4X65L 2KJXA 2B2TA 1I4PA 5C44G 3DUZA 4CDFC 4KKUA 4B9WA 2WB1G 2G9HD 5C3XA 4LUVA 4GNXB 5C6AA 3RLNA 2R92H 4BBSH 5E1FA 5KRUA 5C4JB 3HG9A 1GLCF 1C48A 2HUGA 4KHVA 2KEDA 2C35B 5F2DA 4RNZA 1STGA 4YCUA 1LTAD 4H13C 3U9OA 4X3KA 3A5UA 2UUAL 1FD7D 4JYAQ 1EQTA 2VL6A 3GO5A 4DR6Q 4HSPA 4QY7A 2KCNA 1XNRQ 2DN8A 4A3JB 3OTOQ 4LFCQ 1UE5A 1J5EL 1CKNA 4A3BH 1YJ9A 5M5XH 2A68D 5ISRA 5KYIA 1ILQA 2BH2A 1MHWC 3VR6A 4K5VA 3KLSA 1HJPA 2V4DA 4X62Q 1H9KA 4QF4A 1SYBA 3CCLA 1ZYRC 2Y0SB 1XNQL 3D3RA 1QZGA 2NVXH 3M7GA 4KY6A 5CV6A 2IWHA 1EIHA 3H94A 4ZUIA 3ICEA 1HQMC 4LFAQ 3PQIA 3I4OA 4QUCA 4GKJQ 3PO3H 4AH6A 4X64L 1S72A 2A73B 4AYBE 4KHPL 2PW5A 4C3JB 2ICEC 2R93G 4RGTA 2PPBC 1DOLA 1GPRA 1SFOB 1HCZA 4F7XA 2NBFA 1DCZA 1LTTD 4LF7L 1Q8IA 2L55A 5FO9B 3BVGA 1GVPA 2TMPA 4C3IH 4JI8L 1XPUA 3NEMA 3BJUA 4QIWB 4MN3A 4QIWE 4F88A 1U9RA 5COYA 2CHBD 4C3JH 2HIVA 1HHVA 2BCOA 1WYDA 3PV0A 2LMCB 3QG1A 3QOJA 3G71A 3GTLH 1RD9D 3OMCA 4IFDJ 1DYQA 1E22A 4EGVA 1YVCA 4LUZA 5IP7H 4K0KL 3UZ0B 1DONA 3HOWH 2JA7B 2JXMB 4RHSA 1MD2D 2CQAA 1D6EC 1B1ZA 3RD4A 4JBWM 3CC7A 5FLXL 4FXDA 4NMZA 4R4OA 4AYBG 3QWNA 3PUYA 2I07B 2L0CA 2R61A 4GOPC 5KYLA 3CW2C 3T1HL 5T1GA 4JK1C 4LF5L 3GD7A 2QF7A 3H0GG 3NBIA 3UI2A 4A93H 1JOOA 2H5XA 2MO0A 5EBCA 1FYCA 3HGBA 5KEEA 1D5XC 1PTOB 4BBRH 1B44D 1Z9FA 1WOCA 4LXCA 2K1BA 1X6OA 3FKIG 2CW0D 3H91A 3I8ZA 4QB4A 3A8JE 1U4MA 4RKLA 1PH5A 1NNXA 1NCVA 1SFOH 2AWNA 3R8BA 3F8TA 1IW7D 1TWAH 1FJGL 1MIUA 2MGSA 1L0YB 2ATWA 2PZTA 2I5HA 3GTPB 4DK1A 5LL6X 5FJ8H 4A3KG 2YTYA 5AFWA 1MJCA 2E8GA 2RCFA 2ZTDA 3EA6A 1BXTA 1JMCA 2JA6G 2FFKB 5LMNL 1BVSA 5ELCA 3M4OH 1B70B 3CRLC 4A3EH 3FPUB 2QGQA 3J7YW 2Z8LA 1YNNC 2XN9C 1N8RC 3ERSX 1CUKA 3IFTA 2KHJA 2PI2E 1RTOA 3GTQH 1NTGA 1D5ZC 1EQQA 3HOYB 3CMEA 1L0XB 3NWTA 5DNFA 3HOVB 5K36G 1A15A 2YTVA 5CV4A 1N36L 1J8IA 4LF7Q 2K5NA 2Z6KA 4P73A 1BCPD 1QILA 4C3IB 3KK7A 4DAYB 4A3DB 2YU9H 4PMWA 2UU9L 1WTOA 2SEBD 2Q2UA 4R4CA 1GKHA 5C3WA 1B50A 4DV0Q 3WOFA 4BY7G 4ZKBB 4IUNA 1VQ7A 1I4GA 3CCJA 4LF6Q 4KY7A 3GTLB 1W2BA 1ESRA 4UP8A 1Q12A 2VUMB 3EIVA 3IFDA 1EQVA 4DK6C 1FR3A 1LM0A 3MZ5A 1KNEA 1HNZL 4IPDA 2X6LA 3S2DB 2F03A 2WINB 1BBUA 5CV5A 4A3BG 3RMHA 4JI0Q 1KAAA 3FKIB 2KECA 3OIPA 4UP9A 3S14B 2Z4HA 4K5XA 5JPNC 1NE3A 1TWGB 4IUVA 5KNCA 3BDLA 4DXFA 1XPOA 3I7FA 3MHBA 4LFBL 2LKVA 4KMUC 1IBLL 3CCQA 4DV1L 1XPRA 3EN2A 1RCVD 3KF8A 2EJMA 1Y1WH 4R8NA 4APVA 3OSOA 4H44C 2R92B 3MXNB 1WTWA 4DAVA 5ELNA 3I3CA 3I91A 1OXSC 3MWYW 4KJNA 1IYVA 5M5YB 1CKNB 3OHXC 3UDXA 3J80E 3J7AV 2VB2X 4LFBQ 2VW9A 3STBC 4HIOA 4IALA 2RSOA 3J7ZC 1EY5A 2Z4IA 4LFCL 3CQZB 4DR2L 3BZKA 4PNYA 4FO2A 2WAQB 4OWXB 2OCEA 1AE2A 1LTBD 1GLBF 2Q2IA 1V9PA 4IFDH 3K5LA 5KVPA 2IT1A 1EIYB 1FGBD 1L1OC 1G8ZD 2YYZA 5EKKA 3KLWA 3D4WA 3M4QA 2LS01 1ET9A 5K36H 2WIIB 1GO3E 4PG3A 4JI4Q 1S5CD 3OWFA 1NUCA 4CJ1B 1I94Q 2HCCA 1YITA 1JQYD 1QWYA 1SE2A 1WI5A 1KC8C 2B8FA 1R9TB 1DZ1A 4XQNA 4XYQA 2NVXB 3T53B 3OURB 1TWFB 3GTJH 4G7HC 1BCPB 2I5LX 1CA6A 4TVAB 4WJ3M 3A8IE 4BY1B 1QCBD 5EGTA 2BA0A 1PFNA 4A3GH 5IGBA 1VQEA 4RHRA 3K8AA 5M3MH 4FYDA 1LLRD 1F3GA 3ONAB 5JJKA 3QB3A 1A3UA 4HAEA 3Q8DA 2F3WA 3S1RB 4DPGA 2JA8H 1E2WA 4LFAL 4LF6L 1VQHA 1OXXK 1PH8A 3X3MA 3AQQA 3U9SA 3E6ZX 4IZ8A 1CKMA 4DK3C 4CJ0B 4KHPQ 2P5ZX 2GA4B 3J81j 2EOTA 1N32L 1KL9A 1YJWA 3GTKB 1I3QB 4JI6Q 2HSIA 3B6YA 1Y1WG 1HNZQ 1IBMQ 2K52A 3SR1A 5CMDA 4K2KA 1Y8OB 2KA7A 4A3GG 1D1KA 4H0LC 3SDZA 2AQ2B 1JJCB 4DR5L 3VR2A 4OO1G 2E5LL 1EY8A 1HR0W 1BKBA 5M5WB 3S17B 3K58A 2F0UA 2AKWB 5FLMH 4A3MB 1ZKOA 2KCTA 4RA8A 1XXGA 2EVBA 4G57A 5M3MB 4JI3Q 3HOVG 4JBWA 1LT6D 1D5MC 2QCPX 5KNDA 3HKSA 4RFBA 3BG3A 3O13A 1I4RA 4OXPA 5A35A 4UAIA 4O42A 2JA9A 3RNUA 1VQ6A 3A5ZB 4R4QA 2F0LA 4OWTB 1ZXTA 1PH2A 4JG2A 1KRTA 1Y8NB 1CK1A 4P71A 4OIKA 4L6TB 1MBYA 2JA5B 1A8VA 2ASBA 3J80c 2VUMG 3M3YB 3UDIA 4DV1Q 4DR7L 3Q24A 1B8AA 2WACA 1D7QA 1EZ8A 4GLXA 3M4YA 4ID6A 4QQBX 4WORA 3K7AB 3SVMA 3TP7A 3K7UC 5C0XG 2H1EA 4QPBA 1B7YB 3ND9A 4CKCA 1EWCA 1F9QA 3JAME 3T16A 4DV6L 1KDAA 2IPKD 4ME5A 4X3SA 3NBHB 4A3LH 1A2TA 2L5TA 4CKBA 3AFQA 5GAGC 1GXDC 3BU2A 2VB3X 4B3ML 1UWVA 3LNNA 3T1HQ 4RGNA 1EOVA 4DUZQ 2K03A 2OTLA 4CHTB 4MZ9A 2VS1A 4P75A 3CSQA 2R93B 1I6HH 4BY1H 5EJWA 1WFQA 3OYYA 1K8GA 4HIKA 2Z9HA 1WCMB 1I6VC 2K5VA 2BDOA 1WTRA 4NPSA 3S1RH 1TWCB 5CORA 1MJEA 3I70A 2B3GA 1JR0D 1MSGA 1SRUA 3K5NA 2N49A 3NQTA 4IUQA 1VQMA 5IOCA 2Q2HA 1A3VA 1FGUA 1H9JA 3RR5A 5CBEE 1M4VA 1O7YA 2B63G 4HIMA 4BWGB 1VQOA 2TSSA 2A6HD 3NTKA 1EYAA 2PZUA 3A74A 2EDGA 1VQLA 3PF4A 1QUQB 3H15A 2PQAB 2F4IA 1AP0A 1ESFA 5HGQA 3KJOA 2NN6G 2O5IC 5JPMC 3GTGH 2NVTH 1OXVA 4ALPA 1NAPA 1NBWA 2AQ3B 3A54A 1F9PA 1M8AA 1AW7A 3FVQA 2JA8G 4QMGA 3RZDH 2PO4A 1N36Q 4FF1A 1H9MA 3MXPA 5IE8A 1TY2A 4NXMQ 4Y52H 3TS0A 3TDQA 1N32Q 1ENFA 2NVTB 1GLEF 1VDZA 2AUJD 2UUCQ 1AZPA 1ET6A 3L7ZC 2VQFQ 2GN5A 4P74A 1XTDA 2K7VA 1LTLA 5A2QE 4MIUA 4NXML 3NP8A 1HFNA 1NR2A 1TVXA 2QKIC 1MSHA 3A7AB 2FXQA 1D8LA 4P2CB 1GD7A 1I6HB 4DV4L 1S5ED 1SLJA 1VS0A 2CWAA 4RG1A 1LUZA 2A19A 1D2BA 5IT9L 2EJGC 5E4WC 2SNSA 5CGKA 1YEZA 2F1MA 4KKSA 3WOEA 4YY3L 1HNWL 3IT5A 5EQ0A 1K9MC 2F3GA 3DM3A 4X66Q 1B3QA 5C3EH 1R4QB 4YHHQ 2NN6I 3GTMH 2KQ3A 4KTAA 3S17H 4BBRG 2L15A 4FDBA 4FXKC 4GLAC 1HUNA 4AIMA 4POGA 1IYJB 3R93A 4IN3A 2UUAQ 2B63H 1H9RA 1C0AA 2PYKA 2XSCA 2UUBL 2R3ZA 5GROA 1PFSA 3J80i 3MEHA 3SK6A 1ZEQX 3T4AC 1KD1C 1O2FA 1ENCA 3S1MB 1PRTC 1PA6A 1OTCA 2XVSA 2DY8A 2K05A 5FO8B 1PH6A 1NMGA 1LTGD 4OONA 2EYPA 1J5EQ 3LGJA 4X64Q 5JVH3 2EY6A 3KDFA 1HNXQ 4GN5A 3S1QH 4A3CG 3M85A 1IYUA 3GDEA 2WFWA 3BDOA 1AX3A 3Q6SA 1HTPA 1E1OA 1HH2P 1CHQD 2DNEA 2PI2A 3L3OC 3E9HA 3CPWA 1BBXC 1XNQQ 1OXUA 3QR8A 4HJ5A 3E3XA 1JJ2A 3J7AF 2G5DA 3HKZE 2B0PA 1JT8A 3HP3A 4A3BB 1TWCH 4CKEA 1X56A 2B2WA 4A3EB 4Q0FA 3VYSA 1VCIA 3I90A 1E2ZA 2DUDA 3PO3G 2JA6B 1SBBB 3D8GA 3U58A 3T51B 1SNOA 3MA2B 4JC0A 4MTKA 2PNRC 3AFPA 3I72A 5I6WA 5M5WH 4DV3L 4CDCC 1EEFD 1ZYRD 5J3BA 3J81L 1RHPA 1SYGA 2NYZD 2BE5D 1E1TA 1GUSA 1HR0L 3ITPA 1CSQA 3DMUA 5D3IB 4A75A 1WCMG 1SROA 2CWPA 4GOPB 4Z9CB 5EBDA 2N78A 1PH7A 4J1MA 1KDBA 4LUOA 4JI1L 3TMEA 4JW0A 4OELB 4DNTB 1V1PA 1IKMA 4L5TA 1KAWA 4DV2Q 3Q23A 1E7ZA 4DV2L 1KQSA 1F2LA 4N8FA 3P20A 2A74C 4DR4Q 2KEEA 4RAUC 4EX5A 4JCVE 1SR3A 3PMFA 4KV6A 4GLVB 1TWHH 3A55A 1GJXA 2VQFL 2R7DA 4DA2A 4IJLA 1U4PA 1VMPA 4N9TA 1BR9A 1K83H 2XRQD 1M1KC 4DR3L 3AB9A 2KOLA 4BBSG 1G51A 3CRKC 1SE3A 3CQZH 1CKOA 2K33A 5LMUQ 4DR1L 4AQYL 3LWUA 3NENA 4A3IG 3CP0A 2WAQE 1QG7A 1TY0A 3TZUA 1C7YA 1JC7A 1RTNA 4TSSA 1RIPA 4ZYSA 3A56A 3H0GH 3FRPB 1N33Q 3CCEA 5C3EG 1I5FA 1TS2A 1Q1EA 1X3PA 2ZJRA 1IL2A 4JVZA 5EKIA 3V05A 1EIFA 1EUJA 2A69D 3W1BA 4HEDA 2AQ1B 1SYEA 2PQAA 4P72A 4QL5A 5I9OA 1DD2A 1TKWB 2GU1A 2NTSA 3K7AH 2F52A 3KF6A 1KTKA 3NHHA 3TP6A 3ZYYX 2D0OA 3GTKH 4XIGS 1ENAA 2YV5A 3T13A 4WJ4A 1WTPA 1Y1WB 3PCOB 2RQXA 1JB7A 3F2CA 3FEWX
chains in the Genus database with same CATH topology
1SYDA 4EVOA 3H09A 3MAQA 3GP7A 1CM9A 1HQRD 1C4QA 1STAA 4NKLA 1J9OA 1QB5D 2PZWA 4BS9A 1EOTA 5EKLA 4TKOB 4IUUA 4ZUJA 3PUZA 4FF3A 5CR3A 2O2LD 2KHSA 2PW7A 3BYYB 1STHA 3GQBA 3KLSX 3TP8A 5DAUA 2A5HA 1STYA 3F2UA 4HCEA 3GTQB 2Q8RE 1O7LA 2A6ED 4RH6A 4K6DA 4I7ZC 3C3LA 3BYTB 4IQZA 5KGUA 4A3FB 2LY7A 4KD4A 1RDPD 2IJ0A 4EQNA 4DAYA 4M8AA 2K01A 3H3VC 5A2QL 4R9WA 3K59A 2R6GA 4U673 1VF7A 4X3TA 3RUZA 1E0BA 2PMZB 1JICA 4DXGA 1SYFA 5E3FA 5I2YA 1STBA 4O1NA 3DWAA 4WFN3 1C8CA 5JEAJ 3NQIA 3PO2B 4K8IA 3KBXA 5J39A 1TS5A 1KABA 1K83B 2L12A 1LV9A 4FNFA 4GZYC 3P1HA 3T56B 4IFDG 2VXWA 4XT1B 5CBAE 5C0XH 3HOXB 2B2UC 3QOLA 2E75C 1Q1BA 5KNBA 1SAPA 2F0HA 1CTMA 1EYCA 5EPLA 2EYFA 3WDNA 1CZWA 2AUKA 1HFGA 3ERQA 2JYOA 4OGQC 4BA2I 4N9PA 2EYLA 2QILA 3VYUA 2F0NA 3MXGA 1ILPA 4OO1H 1TQOA 4IURA 3HS0C 3LWEA 2ZXRA 4DGZA 2BDNA 3EQLC 3E0JA 2JE6I 4K2LA 1Z7TA 3FMCA 1JWUD 3SE0A 2K6AA 4FVMA 3SLUA 1WTXA 3VA7A 1LABA 2EXZA 3IAYA 4ZLTF 2EYJA 3P7JA 1PZKD 3C1EA 3HOZB 4RGMA 1SJED 1G91A 4TRDA 1DOMA 4UDUC 1GUOA 2E76C 2C9OA 1SNDA 4F87A 3SK8A 2OT2A 2OXPA 2RKSA 4OL7A 1W6JA 2C5CA 2XIWA 3HZXA 4BY7B 1TU2B 4FP5D 4CBVA 1OXTA 2EY1A 5CYUA 5I9PA 3S9WA 4DK0A 1G2SA 2IX1A 1QJOA 5IODA 1RODA 1SDFA 2X69A 4DU9A 1JORA 3L9AX 1GUGA 2JEAI 2JEBI 4ZRZA 5LL6S 5M5XB 3Q0AA 3N6RA 5J1ZA 1VMCA 2HDLA 1WD1A 3OW7A 1JOKA 3I73A 4BA1I 3R2TA 3K5MA 5D3DA 1SE4A 2A6HC 2LFNA 4J8QA 4IUPA 2O4XA 1OO9B 2Q8IB 2N55A 2JP1A 1EFID 1SYCA 1TIID 5CV8A 2B13A 4G7ZC 4K6LA 5ELDA 1A2UA 3K0YA 1IKLA 1DOKA 4LMQD 3HEJA 1HPCA 2PCFB 1LT4D 4NDXA 1PYWD 3KBGA 3R2IA 2F0QA 3NE5B 2BA1A 1G6ZA 1R4PB 4HN7A 2KVMA 2Q8TA 2EY2A 4PMCA 3E5SA 1PZJD 1F9SA 4XQQA 1KLUD 1JWMD 4L8JA 5BN3A 4WJWA 3S15B 5FLXE 3VYTA 2F0FA 1VF5C 5G3LF 2J4XA 2NB0A 1SNCA 4BBSB 1BF4A 3LX0A 3DWQA 1JCKB 1CHPD 2NZ1D 1LT3D 1V43A 3VYRA 1QNKA 4KN7C 2FHTA 4LK1C 1HTLD 1Y69U 3VR5A 4A3GB 5I6YA 4RKBA 2MPMA 2YU9B 2E2HB 1FNVA 3NTIA 1W6KA 3NBHA 5JJZA 2X6GA 2K04A 3MFGA 2F0KA 1X3QA 4RGOS 4LJZC 2MUYA 4M1UB 1H9SA 3RLFA 4K8JA 4FF4A 4XXEA 4RCNA 1RKNA 4KI0A 2M00A 3I4LA 3SXHA 1GUNA 1AFPA 3PUWA 2B2VC 3KLRA 1ONLA 2QDBA 3MTSA 4BH5A 2RA4A 1PRTF 4A3IB 2FMCA 1UEAB 1GUTA 3J80L 3FDTA 4DN4M 5CC4A 1EEID 3MC0B 1YNJD 1SEBD 2RDHA 3GTMB 5M9OA 2B2YA 1QNUA 4CJ2C 1EU4A 4IUTA 1ICWA 1S5BD 1STEA 3K5OA 4DF7A 3I4NB 1FNUA 1UNSA 3N52A 1BCPF 3BDCA 2L9HA 2IW3A 1PRTB 5D14A 1PFBA 2B2YC 4NP5A 4C56C 4EQPA 3PUVA 3S1QB 1JE4A 5CV9A 1PMRA 2EYOA 1IHZA 3S2HB 2WKCA 5K5PA 2D62A 3IKJA 1DJRD 1B2TA 4HTHA 1GLAF 2JSOA 3G6JB 1BDOA 1PRTD 5IGFA 1JOQA 3MFYA 5HURA 5IGEA 5JAVA 4ZK9B 2F0GA 5B0HA 2FMMA 3NSWA 2L1BA 1G2TA 4DNRB 1F9RA 4ZKCB 2F0TA 2ZXPA 3HOUB 4TQUS 3TBIB 5C0XJ 4KJOA 2K5WA 3GTOB 2VNUD 4KK7A 2DY7A 3EFXD 2ENBA 3CU7A 1CFMA 2Z1CA 2WKDA 2NVQB 1SMYD 1U4LA 2NUCA 4QP5A 1Z6HA 3Q22A 5J22A 3BS1A 2EZVA 1BNZA 1MI2A 5IGDA 3OPOA 2B2VA 4QCLA 3NK9A 4H7BA 2FINB 5IGGA 1F2ZA 3D6CA 4J6HA 1LO5D 4A93B 2WV6D 1NSNS 3C46A 2RSNA 2FJ2A 3S16B 2E74C 2CVRA 1EWHA 2F3VA 3TSSA 1I50B 1S5DD 1F2MA 3HRZC 2MJ8A 1K8MA 2N88A 3X3NA 3VA5A 3W3AA 3VR3A 4G4KA 4XYOA 3DXJC 4ILWA 1BQQT 2ZT9C 1EU3A 4OIJA 3QO2A 1LTSD 1II3A 2EPBA 3GV6A 1EY7A 3PUXA 1HA6A 3DHQA 5TSSA 3PO3B 1H9SB 2XRSD 3GV3A 1UAPA 1Y8PB 1LT5D 1TS4A 3NPPA 3JAML 2F0IA 2A68C 5FOBB 5KIXA 5JVG3 3A8KE 5BN5A 2O5JC 5D65A 5ELBA 3C1FA 2B2TC 2A6EC 2F0PA 1CA5A 1O7ZA 3VR4A 1F77A 4G7OC 1PTOF 2L4NA 4R8IA 2J7ZA 1IL8A 3S1NB 1A6XA 4HMIA 4KKTA 1V8QA 2K5QA 1LTID 3NXWA 1KDCA 5FO7B 1HA5A 1SNMA 1EL0A 1AZQA 3QJYA 3H6MA 3EROA 3MXNA 1NR4A 1B9MA 5IIFA 5HGTA 1SSOA 1PXUA 2OEOA 2J0TD 1PLFA 2ZXOA 2G9DA 2IL8A 3TP5A 2K28A 1XYIA 3CHBD 1GGRA 1CQFA 5IT9E 4C3JG 1BO0A 1EY9A 1TWHB 3EVQA 4MHEA 1F2YA 1RJTA 4KY5A 1ML0D 2WB1B 3V96A 1B4OA 3TN2A 3R3OA 1G291 4XTCS 1Q90A 3HKZB 3V2TA 5BN4A 1YNND 1AN8A 5C4ZA 2EY5A 2NN6H 3KUPA 4B9XA 2B39A 3QIAA 5CV7A 1CQVA 5C5MA 2XWJB 2HDMA 3RZOB 4C2MB 1I4QA 3A7LA 1LTRD 5ELFA 4ULLA 4DAPA 1QOHA 2EJFC 2F0JA 4EQOA 2BOSA 4L63B 2I46A 3H0GB 5C5LA 1HUMA 5JOBA 1O80A 2NVYB 2MP0B 2AWOA 3MXUA 4F8MA 1EIGA 1PTOD 3J81E 5DEHA 1HXYD 5NUCA 1CT1D 1BUVT 1YNJC 1LACA 1GOZA 5I2XA 5DM63 2E2IB 5C3EB 1TS3A 5FKAC 1DXMA 2PQEA 4ODGA 4A3KB 1KNAA 1SJHD 1XWEA 2M2LA 2QEJC 1A3TA 5IGCA 1U4RA 4V0BA 1STNA 3FPPA 4U68A 5ELEA 2ICIA 4FF2A 1O78A 4ABNA 1X32A 1K8OA 1AEXA 2XWBB 2F0DA 1EY6A 4C1NK 4E6IA 3DWPA 4C3HB 2A69C 5G3LD 1B53A 2IX0A 2OF1A 1SNPA 1V1OA 2B8GA 5I4DA 3SHLA 4HR7B 4B08A 4AYBB 4XQJA 3C2PA 1CZGA 2B63B 3MVVA 3D31A 4DFAA 2L11A 4V190 2HCIA 1SXTA 1TT2A 4I65A 3PIP3 3SK4A 4Q5VA 3K6OA 2DNCA 1XX8A 4XT3B 4ZAIA 2WP8J 4ZQ3A 2H4OA 1WVLA 3OOCA 4WRDA 2B44A 3BVMA 3TUFB 5T1IA 2K32A 1MGSA 3DM1A 2KUMA 3G7LA 1SMYC 2RBMA 3OIQA 3OMGA 1GUWA 1EZ6A 5EPKA 5JEAH 3URYA 1GHKA 1TWAB 4HCSA 3OWEB 3D4DA 3BVZA 2IX3A 1WTVA 4RNYA 5JEAG 4YIJA 4QUFA 3AU7A 2M9VA 4CGYB 1T5XD 1PDQA 4PMBA 1D1IA 5C44B 4PQXA 5C4HA 1EYDA 1XTCD 5DM73 1DM0B 5E4XA 2D9UA 1GLDF 1S5FD 4IFDI 2NTTA 2E2DC 3DEOA 5EPJA 3TZDA 4C3IG 2F0EA 2MHVA 1IW7C 2EYHA 3P75A 3NWSA 2SNMA 1PTOH 4BBRB 2NWGA 3CKIB 4X3UA 2D2CC 4K14A 1KLGD 1PFMA 2RVLA 1JWSD 4HMJA 3GTJB 3HOWB 1Q3LA 2F0VA 4KD3A 4LAAA 3M4OB 2E2JB 4KN4C 2HQEA 1Y1VB 1WTQA 1UUPA 1WD0A 5FK9C 2CW0C 1BOSA 1SNQA 2B2UA 1RF2D 4FXGC 2BE5C 5LHY1 3AMUA 2K5DA 1FNWA 1S4ZA 3D6WA 4OO1I 5M3FB 2EYMA 4HSVA 1BCPC 3GTGB 2R7ZB 3K57A 1PZID 1QE6A 1EY4A 4K5WA 3NYYA 1JB3A 4OHJA 2KCCA 1EY0A 3IL8A 3NTHA 1PTOC 1CI3M 1I4XA 4S3SA 1Z47A 3I4MB 3NUCA 2B2WC 3DEPA 4C3HG 3EJIA 2RDFA 2SOBA 2F0OA 3IT7A 2D5DA 3SEBA 3PIO3 1I4HA 4RCOA 4RWSC 2RDGA 3W2DA 3D4RA 4Y7NB 3SK5A 3BZDB 4ZYBA 4PV1C 1HRJA 2EE1A 4KHZA 1GHJA 2SDFA 1E2VA 4C1NI 1TR5A 2XNAC 1B3AA 2GPRA 2ID0A 1F3ZA 2F0MA 2F0WA 3RZDB 5C0XI 1T5EA 5C4XB 3ND8A 2JA8B 4XDXA 4NW2A 3M7NA 1B9NA 2MP1A 1V1PB 2F0SA 2KJXA 2B2TA 1I4PA 3DUZA 4KKUA 4B9WA 2G9HD 5C3XA 5C6AA 5E1FA 5KRUA 5C4JB 3HG9A 1GLCF 1C48A 2HUGA 4KHVA 2KEDA 5F2DA 4RNZA 1STGA 1LTAD 4H13C 3U9OA 4X3KA 1FD7D 1EQTA 3GO5A 4HSPA 2KCNA 2DN8A 4A3JB 2A68D 5ISRA 5KYIA 1ILQA 3VR6A 4K5VA 3KLSA 2V4DA 1H9KA 4QF4A 1SYBA 1ZYRC 2Y0SB 3D3RA 3M7GA 4KY6A 5CV6A 2IWHA 1EIHA 3H94A 4ZUIA 1HQMC 4QUCA 2A73B 2PW5A 4C3JB 2ICEC 4RGTA 2PPBC 1DOLA 1GPRA 1SFOB 1HCZA 4F7XA 2NBFA 1DCZA 1LTTD 1Q8IA 2L55A 5FO9B 3BVGA 2TMPA 4QIWB 4MN3A 4F88A 1U9RA 5COYA 2CHBD 1HHVA 2BCOA 3PV0A 2LMCB 3QG1A 3QOJA 1RD9D 3OMCA 4IFDJ 1DYQA 4EGVA 3UZ0B 1DONA 2JA7B 2JXMB 4RHSA 1MD2D 2CQAA 1D6EC 1B1ZA 3RD4A 4JBWM 5FLXL 4FXDA 4NMZA 3QWNA 3PUYA 2I07B 2L0CA 2R61A 5KYLA 5T1GA 4JK1C 3GD7A 2QF7A 3NBIA 3UI2A 1JOOA 5EBCA 1FYCA 3HGBA 5KEEA 1D5XC 1PTOB 1B44D 4LXCA 2K1BA 2CW0D 3H91A 3I8ZA 4QB4A 3A8JE 1U4MA 4RKLA 1NCVA 2AWNA 3R8BA 1IW7D 2MGSA 1L0YB 2PZTA 3GTPB 4DK1A 5LL6X 5AFWA 3EA6A 1BXTA 2FFKB 5ELCA 3CRLC 3FPUB 3J7YW 2Z8LA 1YNNC 2XN9C 3IFTA 1RTOA 1D5ZC 3HOYB 1L0XB 3NWTA 5DNFA 3HOVB 5K36G 1A15A 5CV4A 1J8IA 1BCPD 1QILA 4C3IB 3KK7A 4A3DB 4PMWA 1WTOA 2SEBD 5C3WA 1B50A 3WOFA 4ZKBB 4IUNA 1I4GA 4KY7A 3GTLB 1ESRA 1Q12A 2VUMB 3IFDA 1EQVA 1FR3A 3MZ5A 1KNEA 2X6LA 3S2DB 2F03A 2WINB 5CV5A 3RMHA 1KAAA 3FKIB 2KECA 3OIPA 3S14B 2Z4HA 4K5XA 5JPNC 1TWGB 4IUVA 5KNCA 3BDLA 4DXFA 3MHBA 2LKVA 4KMUC 1RCVD 3KF8A 2EJMA 4R8NA 3OSOA 4H44C 2R92B 1WTWA 4DAVA 3I3CA 3I91A 1OXSC 3MWYW 4KJNA 1IYVA 5M5YB 3J7AV 3OHXC 3J80E 2VB2X 4IALA 2RSOA 1EY5A 2Z4IA 3CQZB 4PNYA 4FO2A 2WAQB 1GLBF 1LTBD 4IFDH 3K5LA 5KVPA 2IT1A 1FGBD 1G8ZD 2YYZA 5EKKA 3D4WA 2LS01 1ET9A 5K36H 2WIIB 1S5CD 3OWFA 1NUCA 4CJ1B 2HCCA 1JQYD 1QWYA 1SE2A 1R9TB 2B8FA 1DZ1A 4XQNA 4XYQA 2NVXB 3T53B 3OURB 1TWFB 4G7HC 1BCPB 1CA6A 3A8IE 4BY1B 1QCBD 5EGTA 2BA0A 1PFNA 5IGBA 4RHRA 4FYDA 1LLRD 1F3GA 3ONAB 3QB3A 1A3UA 4HAEA 2F3WA 3S1RB 1E2WA 1OXXK 3X3MA 3U9SA 3E6ZX 4IZ8A 4CJ0B 2GA4B 2EOTA 3GTKB 1I3QB 2HSIA 3SR1A 5CMDA 4K2KA 1Y8OB 2KA7A 1D1KA 4H0LC 3SDZA 2AQ2B 3VR2A 4OO1G 1EY8A 5M5WB 3S17B 3K58A 2F0UA 4A3MB 1ZKOA 4RA8A 1XXGA 2EVBA 4G57A 5M3MB 4JBWA 1LT6D 1D5MC 2QCPX 5KNDA 4RFBA 3BG3A 3O13A 1I4RA 5A35A 4UAIA 4O42A 2F0LA 1ZXTA 1Y8NB 1CK1A 4OIKA 1MBYA 4L6TB 2JA5B 3M3YB 3Q24A 2WACA 1EZ8A 3M4YA 4ID6A 4WORA 3K7AB 3SVMA 3TP7A 5C0XG 4QPBA 2H1EA 3ND9A 4CKCA 1EWCA 1F9QA 3JAME 3T16A 1KDAA 2IPKD 4ME5A 4X3SA 1A2TA 2L5TA 4CKBA 1GXDC 2VB3X 3LNNA 4RGNA 2K03A 4CHTB 3CSQA 2R93B 5EJWA 1WCMB 1I6VC 2BDOA 1WTRA 1TWCB 5CORA 3I70A 1JR0D 1MSGA 3K5NA 3NQTA 4IUQA 5IOCA 1A3VA 1H9JA 5CBEE 1M4VA 1O7YA 4BWGB 2TSSA 2A6HD 3NTKA 1EYAA 2PZUA 2EDGA 2F4IA 1AP0A 1ESFA 2NN6G 2O5IC 5JPMC 1OXVA 1NAPA 2AQ3B 3A54A 1F9PA 1M8AA 1AW7A 3FVQA 4QMGA 2PO4A 4FF1A 1H9MA 3MXPA 1TY2A 3TDQA 1ENFA 2NVTB 1GLEF 1VDZA 2AUJD 1AZPA 1ET6A 3L7ZC 2K7VA 5A2QE 4MIUA 3NP8A 1HFNA 1NR2A 1TVXA 2QKIC 1MSHA 3A7AB 4P2CB 1I6HB 1S5ED 1D2BA 5IT9L 2EJGC 5E4WC 2SNSA 5CGKA 2F1MA 4KKSA 3WOEA 3IT5A 5EQ0A 2F3GA 1R4QB 2NN6I 2KQ3A 4KTAA 4FXKC 1HUNA 3R93A 4IN3A 1H9RA 2PYKA 2XSCA 2R3ZA 3SK6A 3MEHA 1ZEQX 3T4AC 1O2FA 1ENCA 3S1MB 1PRTC 2XVSA 2DY8A 2K05A 5FO8B 1LTGD 2EYPA 5JVH3 2EY6A 3M85A 1IYUA 3BDOA 1AX3A 3Q6SA 1HTPA 1CHQD 2DNEA 3L3OC 1BBXC 1OXUA 3J7AF 2B0PA 3HP3A 4A3BB 4CKEA 2B2WA 4A3EB 4Q0FA 3VYSA 1VCIA 3I90A 1E2ZA 2JA6B 1SBBB 3D8GA 3T51B 1SNOA 3MA2B 2PNRC 3I72A 5I6WA 1EEFD 1ZYRD 3J81L 1RHPA 1SYGA 2NYZD 2BE5D 1GUSA 3ITPA 3DMUA 5D3IB 4Z9CB 5EBDA 4J1MA 1KDBA 3TMEA 4DNTB 1V1PA 1IKMA 3Q23A 1F2LA 3P20A 2A74C 2KEEA 4RAUC 3PMFA 4KV6A 3A55A 1GJXA 4DA2A 1U4PA 1VMPA 4N9TA 1BR9A 2XRQD 3AB9A 2KOLA 3CRKC 1SE3A 2K33A 3LWUA 1QG7A 1TY0A 3TZUA 1JC7A 1RTNA 4TSSA 4ZYSA 3A56A 3FRPB 1TS2A 1Q1EA 1X3PA 5EKIA 3V05A 2A69D 4HEDA 2AQ1B 1SYEA 5I9OA 1DD2A 1TKWB 2GU1A 2NTSA 1KTKA 3NHHA 3TP6A 3ZYYX 4XIGS 1ENAA 3T13A 1WTPA 1Y1WB 2RQXA 3FEWX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUF B;  3IT7 A;  1GLB F;  4QP5 A;  1GLC F;  1GLE F;  3NYY A;  1AX3 A;  4LXC A;  5KVP A;  2GPR A;  1GGR A;  3OUR B;  1F3Z A;  4RNZ A;  2B13 A;  2GU1 A;  4BH5 A;  3IT5 A;  1O2F A;  2F3G A;  2HSI A;  2B0P A;  2MP0 B;  5B0H A;  1GLD F;  1GPR A;  3CSQ A;  3UZ0 B;  3SLU A;  4ZYB A;  4RNY A;  4QPB A;  1F3G A;  1GLA F;  2B44 A;  1QWY A;  4JBW M; 
#chains in the Genus database with same CATH topology
 1SYD A;  4EVO A;  3H09 A;  3MAQ A;  3GP7 A;  2WAQ G;  4QGU A;  1CM9 A;  1HQR D;  1A0I A;  1C4Q A;  1STA A;  3HOX G;  2NZO A;  4NKL A;  1J9O A;  1QB5 D;  2PZW A;  3E9I A;  4BS9 A;  3T1Y Q;  1EOT A;  3RN5 A;  5EKL A;  1AH9 A;  4Y7N H;  4IOA A;  4TKO B;  4IUU A;  3TRE A;  3PF5 A;  4ZUJ A;  3PUZ A;  2OQ0 A;  1PV4 A;  4OEM B;  5CR3 A;  4FF3 A;  2O2L D;  4YWK A;  2KHS A;  3UDF A;  1IBM L;  3PSI A;  2PW7 A;  2ZTE A;  1ASZ A;  1UEB A;  3BYY B;  1EWI A;  1STH A;  3GQB A;  3KLS X;  3TP8 A;  5DAU A;  2A5H A;  1STY A;  3F2U A;  4HCE A;  3GTQ B;  4JV5 Q;  2Q8R E;  1O7L A;  2A6E D;  3ULP A;  4RH6 A;  2UUC L;  1PH3 A;  1UE7 A;  4K6D A;  2K14 A;  4I7Z C;  3C3L A;  3BYT B;  4IQZ A;  3T1Y L;  5KGU A;  4A3F B;  2LY7 A;  4KD4 A;  1L2F A;  4DAM A;  1RDP D;  1YHB A;  4JI6 L;  2IJ0 A;  4EQN A;  4DAY A;  4M8A A;  2K01 A;  3H3V C;  4GS3 A;  5FLM G;  5A2Q L;  4R9W A;  3K59 A;  2R6G A;  4U67 3;  3K80 C;  1VF7 A;  4X3T A;  4O0A A;  2E5L Q;  3RUZ A;  2E2J H;  1E0B A;  1UE1 A;  1HZB A;  2PMZ B;  1JIC A;  4DXG A;  1SYF A;  3M4P A;  1VQG A;  5E3F A;  1L1O B;  5I2Y A;  1STB A;  4O1N A;  3DWA A;  4JI2 Q;  4DV4 Q;  4WFN 3;  1C8C A;  5JEA J;  3NQI A;  3PO2 B;  4K8I A;  2UXD L;  3KBX A;  5J39 A;  1TS5 A;  3KFU A;  1KAB A;  1K83 B;  2CH4 A;  2L12 A;  3KDF B;  2VUM H;  1LV9 A;  4FNF A;  4B3S L;  4GZY C;  4DUY L;  2QEX A;  3P1H A;  3T56 B;  4IFD G;  3CC2 A;  2VXW A;  4XT1 B;  5CBA E;  5HY6 A;  4OWW B;  4UPA A;  4LF4 Q;  1FJG Q;  5C0X H;  3HOX B;  2B2U C;  3W1G A;  1Q46 A;  1J6Q A;  3QOL A;  1EQR A;  1I94 L;  2JA5 G;  2E75 C;  1Q1B A;  4LF8 L;  2UUB Q;  3W5O A;  2JQO A;  5KNB A;  1SAP A;  2F0H A;  3CAM A;  3U50 C;  1CTM A;  2HHH L;  1EYC A;  5EPL A;  2EYF A;  2A1A A;  3WDN A;  1CZW A;  2AUK A;  1HFG A;  3ERQ A;  4R4I A;  2JYO A;  4OGQ C;  2GVB A;  4BA2 I;  4N9P A;  2EYL A;  2QIL A;  3VYU A;  2F0N A;  1RL2 A;  3MXG A;  3TQY A;  3HOU G;  3S16 H;  1ILP A;  4H02 A;  4OX9 L;  4OO1 H;  1EYG A;  1TQO A;  4IUR A;  3HS0 C;  3LWE A;  2ZXR A;  4DGZ A;  2BDN A;  3EQL C;  3E0J A;  2JE6 I;  1T9H A;  4K2L A;  2JA7 H;  2AHO B;  1Z7T A;  3FMC A;  1JWU D;  3SE0 A;  4DV3 Q;  3UDG A;  2K50 A;  2K6A A;  4FVM A;  3SLU A;  1PHJ A;  1WTX A;  3VA7 A;  1LAB A;  2I5M X;  2EXZ A;  3IAY A;  4DNI A;  4ZLT F;  2EYJ A;  3P7J A;  1PZK D;  3C1E A;  3HOZ B;  1YJN A;  4RGM A;  1SJE D;  1G91 A;  4TRD A;  1DOM A;  1TXY A;  4UDU C;  1Q7Y C;  1GUO A;  2E76 C;  2C9O A;  1SND A;  1E24 A;  3GTO H;  4F87 A;  3SK8 A;  4YCV A;  4DV5 Q;  2OT2 A;  2OXP A;  3M9B A;  3HOZ H;  2RKS A;  3I56 A;  4OL7 A;  1W6J A;  2C5C A;  2XIW A;  4UY8 C;  3CCS A;  3HZX A;  4BY7 B;  1N9W A;  1TU2 B;  4FP5 D;  4CBV A;  5IYB G;  1OXT A;  2EY1 A;  5CYU A;  5I9P A;  3S9W A;  4YY3 Q;  4JI8 Q;  4DK0 A;  1G2S A;  1YI2 A;  1NJI C;  2IX1 A;  1QJO A;  3I55 A;  5IOD A;  1ROD A;  1SDF A;  1HZ9 A;  2X69 A;  3UE0 A;  3G4S A;  4DU9 A;  1JOR A;  3L9A X;  1GUG A;  2JEA I;  1C9O A;  2JEB I;  4ZRZ A;  2DJG C;  5LL6 S;  5M5X B;  3G6E A;  4CDE C;  4A3F G;  3Q0A A;  1N33 L;  3N6R A;  5J1Z A;  4BXX H;  4UHV A;  5C4X G;  4JOI A;  4YCW A;  1VMC A;  2HDL A;  4GNX C;  3OW7 A;  1WD1 A;  4JI0 L;  2EQS A;  4A3F H;  1JOK A;  1QZH A;  3I73 A;  1DGS A;  4BA1 I;  5LMN Q;  4DR6 L;  3R2T A;  3JC6 6;  4JI4 L;  2XGT A;  2K75 A;  4IPH A;  3K5M A;  3WWV A;  4DUZ L;  5D3D A;  5C4J H;  1SE4 A;  4I7A A;  2A6H C;  1X54 A;  2LFN A;  4J8Q A;  4B3M Q;  4IUP A;  1U5K A;  5C4X H;  2O4X A;  1OO9 B;  2Q8I B;  2N55 A;  5IWA Q;  2QW7 A;  4JI7 L;  2JP1 A;  1EFI D;  2N8N A;  1SYC A;  1TII D;  3NEL A;  5CV8 A;  4OX9 Q;  2B13 A;  4GN3 B;  4G7Z C;  3EBE A;  4LNQ A;  4K6L A;  5ELD A;  1A2U A;  3K0Y A;  1IKL A;  1DOK A;  3U4V A;  1SMX A;  4LMQ D;  3HEJ A;  2OQK A;  2E2I H;  1HPC A;  2PCF B;  1LT4 D;  4NDX A;  1PYW D;  1PVO A;  1CSP A;  3KBG A;  2CFM A;  3R2I A;  5LMN W;  2F0Q A;  3JAM i;  3NE5 B;  2BA1 A;  4L5S A;  1R4P B;  1G6Z A;  4HN7 A;  2KVM A;  4JI5 Q;  2Q8T A;  2N3S A;  2EY2 A;  3D0F A;  4PMC A;  3E5S A;  3KYH C;  3KJP A;  1PZJ D;  3FHW A;  1F9S A;  1QVF A;  4LWC A;  4XQQ A;  1KLU D;  4B3T L;  1JWM D;  4L8J A;  5BN3 A;  4WJW A;  3OTO L;  3S15 B;  2Z0S A;  5FLX E;  3VYT A;  2F0F A;  1VF5 C;  2YTX A;  4GKJ L;  2KCM A;  4B3R Q;  5G3L F;  2J4X A;  3DLL A;  2NB0 A;  1VQD A;  1GM5 A;  1SNC A;  2Y0S G;  4BBS B;  5E7N A;  1VQA A;  1BF4 A;  3LX0 A;  4C2M H;  2LXK A;  3DWQ A;  1JCK B;  1CHP D;  2NZ1 D;  1LT3 D;  1V43 A;  3VYR A;  3CMA A;  1QNK A;  1HZC A;  4KN7 C;  3HKZ G;  4A3E G;  2BH8 A;  2FHT A;  4B3S Q;  4LK1 C;  1VQI A;  1HTL D;  2JN4 A;  4LF4 L;  4LF5 Q;  1SE8 A;  1Y69 U;  3VR5 A;  4A3G B;  5I6Y A;  1Q82 C;  4RKB A;  2K5H A;  2RCN A;  3CCU A;  4A3K H;  2MPM A;  2YU9 B;  1YHA A;  3HOZ G;  4IJH A;  2E2H B;  4JYA L;  1FNV A;  3NTI A;  4LF8 Q;  1W6K A;  3NBH A;  1N34 L;  4ME3 A;  2UXD Q;  5JJZ A;  2MO1 A;  2X6G A;  3I2Z A;  2K04 A;  1XMQ L;  3MFG A;  1IBL Q;  2F0K A;  1X3Q A;  4RGO S;  4LJZ C;  2MUY A;  4M1U B;  1H9S A;  2MFI A;  1QVG A;  3RLF A;  2IHF A;  4K8J A;  1WTH A;  4FF4 A;  4XXE A;  4RCN A;  2QDL A;  4JOI C;  3STB D;  1X9N A;  4EQ5 A;  1N34 Q;  2NVY H;  5GAD C;  1RKN A;  4KI0 A;  2M00 A;  3I4L A;  3SXH A;  2ZM6 L;  1GUN A;  1IZ6 A;  1AFP A;  3PUW A;  2B2V C;  3KLR A;  1Q8K A;  1X65 A;  1ONL A;  2QDB A;  3RN2 A;  3MTS A;  4BH5 A;  2RA4 A;  1PRT F;  4A3I B;  2FMC A;  1QUQ A;  1UEA B;  5BR8 Q;  2UXC L;  1GUT A;  3J80 L;  3FDT A;  4DN4 M;  5CC4 A;  1EEI D;  3RLO A;  4A3D H;  1XNR L;  5IYC H;  3MC0 B;  3CD6 A;  1YNJ D;  1SEB D;  2RDH A;  3GTM B;  1QVC A;  1XMO Q;  1XMO L;  2R7Z G;  5M9O A;  2B2Y A;  1QNU A;  2OWO A;  2RHS B;  1EU4 A;  4CJ2 C;  2E2H H;  4IUT A;  1ICW A;  1S5B D;  2HT1 A;  4N8X 1;  1STE A;  3K5O A;  1PYB A;  1S3O A;  4DF7 A;  3CC4 A;  4IO9 A;  3I4N B;  2UXC Q;  1FNU A;  3PGZ A;  1UNS A;  3I4M G;  3N52 A;  1BCP F;  3BDC A;  2L9H A;  2IW3 A;  3VDY A;  3F2B A;  2XTI A;  1PRT B;  1R9T H;  5D14 A;  1PFB A;  2B2Y C;  4NP5 A;  4C56 C;  4EQP A;  3PUV A;  3GTP H;  3S1Q B;  1JE4 A;  1X3G A;  2JA6 H;  5CV9 A;  2R7Z H;  1PMR A;  1KXL A;  4DR3 Q;  2EYO A;  1IHZ A;  3S2H B;  2WKC A;  5K5P A;  4LF9 Q;  3J81 i;  2D62 A;  5GQO A;  1KHI A;  4YWL A;  3CCM A;  3IKJ A;  1DJR D;  1B2T A;  4HTH A;  1GLA F;  2JSO A;  3G6J B;  1BDO A;  1U0L A;  1PRT D;  5IGF A;  2CH4 W;  4J15 A;  4GNX A;  1JOQ A;  3MFY A;  1VQ9 A;  1M90 C;  5HUR A;  1VQF A;  1XMQ Q;  4GOP A;  4X6A H;  5IGE A;  2HD3 A;  5JAV A;  4ZK9 B;  2F0G A;  1Y1V H;  5B0H A;  2FMM A;  3CPF A;  3NSW A;  4HJ7 A;  2L1B A;  3FKI H;  1G2T A;  5LMU L;  4DNR B;  4DR1 Q;  4AQY Q;  2V1C C;  1F9R A;  1YZ6 A;  2GVA A;  4ZKC B;  5GAH C;  5C44 H;  2F0T A;  2ZXP A;  1VQC A;  2NZH A;  3HOU B;  2HIX A;  2ZJQ A;  1VQN A;  4TQU S;  3TBI B;  5C0X J;  4KJO A;  2K5W A;  3GTO B;  2VNU D;  4KK7 A;  2DY7 A;  3EFX D;  2HHH Q;  1VQ8 A;  2R92 G;  4GKK Q;  2ENB A;  3OW2 A;  2OTJ A;  1IXR A;  2R7F A;  3CU7 A;  1CFM A;  4IPC A;  3KOJ A;  2Z1C A;  2WKD A;  3J7A 5;  4A4I A;  4JBM A;  2NVQ B;  1SMY D;  1U4L A;  5DLQ E;  2NUC A;  4KLK A;  4QP5 A;  1Z6H A;  4NB3 A;  3Q22 A;  5J22 A;  3BS1 A;  2EZV A;  1BNZ A;  1AE3 A;  1MI2 A;  5IGD A;  3CXC A;  3OPO A;  2B2V A;  4QCL A;  4ZCK A;  3NK9 A;  4H7B A;  2FIN B;  5IGG A;  1F2Z A;  3D6C A;  4R4T A;  2CQO A;  4J6H A;  1A62 A;  2Q2T A;  1LO5 D;  4A93 B;  1JJG A;  2WV6 D;  4DV7 L;  1NSN S;  2EIF A;  1HZA A;  3C46 A;  2RSN A;  2FJ2 A;  3S16 B;  2E74 C;  2CCZ A;  2CVR A;  1EWH A;  2F3V A;  1EFW A;  2JK8 A;  3TSS A;  1I50 B;  1S5D D;  1F2M A;  3HRZ C;  2MJ8 A;  1NMF A;  1PYS B;  1K8M A;  2N88 A;  3TS2 A;  2NVQ H;  3X3N A;  2UU9 Q;  3VA5 A;  3W3A A;  3VR3 A;  4G4K A;  3CCV A;  4XYO A;  5L37 A;  5IY0 A;  1HNX L;  3DXJ C;  4ILW A;  1BQQ T;  2R93 H;  2VZA A;  2ZT9 C;  1EU3 A;  4OIJ A;  3QO2 A;  1LTS D;  1II3 A;  2EPB A;  3GV6 A;  1EY7 A;  3PUX A;  1HA6 A;  3DHQ A;  5TSS A;  4HID A;  4RMF A;  3PO3 B;  1H9S B;  2WB1 E;  2XRS D;  3GV3 A;  1UAP A;  1Y8P B;  1LT5 D;  1TS4 A;  3NPP A;  3BZC A;  3JAM L;  2F0I A;  3PO2 G;  2A68 C;  4MNO A;  5FOB B;  5KIX A;  5JVG 3;  3A8K E;  5BN5 A;  2O5J C;  1O7I A;  3PO2 H;  3MEF A;  4L5R C;  5IYD H;  5D65 A;  5ELB A;  3TRZ A;  2F4V L;  1X55 A;  2F3I A;  3C1F A;  2B2T C;  3L0O A;  4JI2 L;  2A6E C;  2F0P A;  1CA5 A;  5ELO A;  1O7Z A;  3VR4 A;  4UP7 A;  1F77 A;  4G7O C;  1PTO F;  1YHQ A;  2L4N A;  1X3E A;  3J81 c;  4HJ9 A;  4R8I A;  2J7Z A;  4MTN A;  1P16 A;  1VQ5 A;  1IL8 A;  3CF5 A;  3S1N B;  1A6X A;  4HMI A;  3SGI A;  4KKT A;  4DUY Q;  1V8Q A;  2ALY B;  2CKZ B;  2ZTC A;  2LXJ A;  4X66 L;  2KEN A;  2K5Q A;  3KF6 B;  3PIO A;  1LTI D;  3NXW A;  1KDC A;  5FO7 B;  4A3J G;  1HA5 A;  1SNM A;  3KF8 B;  4DR4 L;  1EL0 A;  1AZQ A;  1L1O A;  3QJY A;  3H6M A;  3ERO A;  3MXN A;  4R1J A;  4LW1 A;  4JI7 Q;  1NR4 A;  1B9M A;  5IIF A;  1G6P A;  4DKA C;  5HGT A;  2RF4 A;  1SSO A;  1PXU A;  2D0P A;  2OEO A;  2J0T D;  4O2D A;  1KRS A;  1PLF A;  2ZXO A;  1YNX A;  2VQE Q;  2G9D A;  1XJV A;  2IL8 A;  3TP5 A;  2K28 A;  1XYI A;  2UXB L;  3AEV A;  3CHB D;  3ULJ A;  1GGR A;  3U4Z A;  1CQF A;  5IT9 E;  4C3J G;  1BO0 A;  5FJ8 G;  1EY9 A;  1TWH B;  1YBY A;  3EVQ A;  4MHE A;  1F2Y A;  2QA4 A;  1RJT A;  4KY5 A;  1PH9 A;  4L5Q A;  1ML0 D;  2WB1 B;  1SN8 A;  3V96 A;  4X62 L;  1B4O A;  3TN2 A;  4B3T Q;  2A8V A;  3R3O A;  3M3Y H;  1G29 1;  4XTC S;  5IP9 H;  1Q90 A;  2RHQ B;  2MQH A;  5FLX c;  3A0J A;  3HKZ B;  3V2T A;  5IT9 c;  5BN4 A;  1YNN D;  1MKH A;  1AN8 A;  5C4Z A;  2HQL A;  2EY5 A;  3S15 H;  2NN6 H;  5H1S E;  3KUP A;  4B9X A;  2B39 A;  3QIA A;  1K73 C;  3S14 H;  4QJF A;  1S40 A;  5CV7 A;  1CQV A;  4JBJ A;  5C5M A;  2XWJ B;  2HDM A;  4A3M G;  1Y14 B;  3RZO B;  4C2M B;  3S1M H;  1I4Q A;  3A7L A;  3CCR A;  5M3M G;  1LTR D;  5ELF A;  5IYC G;  3S2D H;  2IHE A;  4ULL A;  3IRB A;  4DAP A;  4A3M H;  1VQJ A;  1QOH A;  2EJF C;  2F0J A;  4EQO A;  2BOS A;  3HOY G;  4A76 A;  3HOW G;  4IOC A;  4L63 B;  2I46 A;  3H0G B;  5C5L A;  1HUM A;  1Y1V G;  5JOB A;  3RZO H;  1O80 A;  2NVY B;  2MP0 B;  2AWO A;  2I0Q A;  1PH4 A;  3MXU A;  4F8M A;  1EIG A;  1PTO D;  3J81 E;  5DEH A;  1HXY D;  5NUC A;  4X65 Q;  1CT1 D;  1BUV T;  1YNJ C;  1VQ4 A;  1E3P A;  1LAC A;  3HOY H;  1GOZ A;  2LSS A;  5I2X A;  5DM6 3;  2E2I B;  5C3E B;  5M3F G;  1TS3 A;  3G48 A;  5FKA C;  2VY3 A;  4BY7 H;  1DXM A;  2PQE A;  4ODG A;  4A3L G;  3H3V H;  4A3K B;  1KNA A;  1SJH D;  1XWE A;  2M2L A;  2QEJ C;  2ES2 A;  1A3T A;  5IGC A;  1U4R A;  4V0B A;  1STN A;  3FPP A;  4U68 A;  5ELE A;  2ICI A;  4FF2 A;  1O78 A;  4ABN A;  4DR2 Q;  1X32 A;  1K8O A;  1AEX A;  2XWB B;  4BXX G;  1X3F A;  1K3B C;  2F0D A;  4A3J H;  1EY6 A;  4C1N K;  4E6I A;  1K0S A;  3DWP A;  4C3H B;  1K0R A;  2A69 C;  5IP9 G;  5G3L D;  3JAM c;  5JJL A;  2DGY A;  1B53 A;  5M3F H;  2IX0 A;  2OF1 A;  1SNP A;  1V1O A;  2B8G A;  5I4D A;  3SHL A;  3HOU H;  4HR7 B;  1VQP A;  4B08 A;  5IYB H;  3I4N G;  4AYB B;  4XQJ A;  3C2P A;  1CZG A;  4A3D G;  2B63 B;  3MVV A;  3D31 A;  4DFA A;  2L11 A;  4CDD C;  4V19 0;  2HCI A;  1SXT A;  1TT2 A;  4I65 A;  3PIP 3;  3FP9 A;  3PIP A;  5GAE C;  3SK4 A;  5IYD G;  4Q5V A;  3K6O A;  2DNC A;  1XX8 A;  1L0W A;  4XT3 B;  4ZAI A;  2WP8 J;  4ZQ3 A;  2H4O A;  1WVL A;  3OOC A;  5M5Y H;  4HJA A;  1ASY A;  4WRD A;  3HOV H;  2B44 A;  1HR0 Q;  3BVM A;  5EAY A;  3TUF B;  5T1I A;  1V1Q A;  2K32 A;  1TWF H;  2Z6K C;  1MGS A;  3DM1 A;  2KUM A;  3G7L A;  1SMY C;  4B3R L;  2RBM A;  4DV0 L;  3K81 C;  3OIQ A;  3OMG A;  1GUW A;  1EZ6 A;  2B29 A;  5EPK A;  3URY A;  5JEA H;  1TWA B;  4HCS A;  1GHK A;  3H3V I;  2KHI A;  1YIJ A;  1UE6 A;  1JE5 A;  3OWE B;  3D4D A;  3BVZ A;  2IX3 A;  1WTV A;  4RNY A;  5JEA G;  4YIJ A;  1IBK L;  1A63 A;  4QUF A;  3AU7 A;  2M9V A;  4CGY B;  3HFZ B;  1T5X D;  4JI5 L;  1PDQ A;  4PMB A;  1D1I A;  5C44 B;  4IPG A;  3L2P A;  4PQX A;  5C4H A;  5JJI A;  1EYD A;  1KIX A;  1Q86 C;  1XTC D;  5DM7 3;  1DM0 B;  5E4X A;  2D9U A;  3E0E A;  3ER0 A;  1IBK Q;  1GLD F;  1S5F D;  4IFD I;  4JV5 L;  1P8L A;  2NTT A;  2JJQ A;  2E2D C;  3DEO A;  1BBW A;  5EPJ A;  2JA5 H;  1I50 H;  3TZD A;  4C3I G;  2F0E A;  2MHV A;  1IW7 C;  2EYH A;  3P75 A;  3NWS A;  2SNM A;  1PTO H;  4BBR B;  2NWG A;  2KBN A;  4NXN Q;  3CKI B;  4JPB W;  2D2C C;  4X3U A;  4K14 A;  3ZJY C;  1KLG D;  2MNA A;  1PFM A;  2RVL A;  1JWS D;  4HMJ A;  4PZ8 A;  4PZ6 A;  3GTJ B;  3HOW B;  4YHH L;  1Q3L A;  2F0V A;  4KD3 A;  4LAA A;  3M4O B;  2E2J B;  1LYL A;  3AYH B;  4KN4 C;  2PNH A;  4POF A;  4GKK L;  2HQE A;  1Y1V B;  1WTQ A;  4DR7 Q;  1UUP A;  1WD0 A;  5FK9 C;  2CW0 C;  4JI3 L;  1BOS A;  1SNQ A;  2B2U A;  4A93 G;  1RF2 D;  4K0K Q;  2Z6B A;  4FXG C;  2BE5 C;  2UXB Q;  5IWA L;  1ICF B;  5LHY 1;  3AMU A;  4A3C H;  2ZM6 Q;  2Y0S E;  2K5D A;  4NXN L;  4HJ8 A;  3F1Z A;  1FNW A;  1S4Z A;  3D6W A;  4OO1 I;  4A3I H;  4C3H H;  1I3Q H;  4PZ7 A;  3F2D A;  4BY1 G;  4DV6 Q;  2EXD A;  5M3F B;  2AMC B;  2EYM A;  3ULL A;  1VQB A;  4HSV A;  1BCP C;  2DJF C;  3GTG B;  2R7Z B;  3K57 A;  1PZI D;  4DV7 Q;  1QE6 A;  1EY4 A;  4K5W A;  3NYY A;  1H95 A;  1JB3 A;  4OHJ A;  2KCC A;  1EY0 A;  3IL8 A;  5BR8 L;  3NTH A;  1PTO C;  1CI3 M;  1I4X A;  1FL0 A;  4S3S A;  1Z47 A;  3S24 A;  3I4M B;  3K0X A;  5IP7 G;  3I4N H;  3NUC A;  2B2W C;  3DEP A;  4C3H G;  3EJI A;  2RDF A;  2VQE L;  2SOB A;  2F0O A;  5AJ3 Q;  5AJ3 L;  4JI1 Q;  3IT7 A;  1WCM H;  2D5D A;  1TWG H;  2ZJP A;  3SEB A;  3PIO 3;  2JA7 G;  1I4H A;  1K28 A;  4RCO A;  4RWS C;  2RDG A;  1K8A C;  3W2D A;  3D4R A;  4Y7N B;  3S2H H;  3SK5 A;  3BZD B;  4ZYB A;  4YWM A;  4PV1 C;  1HRJ A;  2EE1 A;  4DV5 L;  4KHZ A;  4DR5 Q;  1GHJ A;  2SDF A;  1E2V A;  4C1N I;  1TR5 A;  2XNA C;  1B3A A;  2GPR A;  2ID0 A;  4LF9 L;  4GN4 B;  1F3Z A;  1FVI A;  2F0M A;  3HOX H;  2F4V Q;  2F0W A;  3RZD B;  4JBK A;  1PH1 A;  5C0X I;  1NY4 A;  1T5E A;  2IY5 B;  5C4X B;  3ND8 A;  1Q81 C;  2JA8 B;  1K3R A;  4XDX A;  3TEH B;  1WJJ A;  1VQK A;  4NW2 A;  1HNW Q;  3M7N A;  1B9N A;  3S1N H;  1W3S A;  3UE1 A;  2MP1 A;  1V1P B;  2K4K A;  3I4M H;  2F0S A;  2PMZ E;  4X65 L;  2KJX A;  2B2T A;  1I4P A;  5C44 G;  3DUZ A;  4CDF C;  4KKU A;  4B9W A;  2WB1 G;  2G9H D;  5C3X A;  4LUV A;  4GNX B;  5C6A A;  3RLN A;  2R92 H;  4BBS H;  5E1F A;  5KRU A;  5C4J B;  3HG9 A;  1GLC F;  1C48 A;  2HUG A;  4KHV A;  2KED A;  2C35 B;  5F2D A;  4RNZ A;  1STG A;  4YCU A;  1LTA D;  4H13 C;  3U9O A;  4X3K A;  3A5U A;  2UUA L;  1FD7 D;  4JYA Q;  1EQT A;  2VL6 A;  3GO5 A;  4DR6 Q;  4HSP A;  4QY7 A;  2KCN A;  1XNR Q;  2DN8 A;  4A3J B;  3OTO Q;  4LFC Q;  1UE5 A;  1J5E L;  1CKN A;  4A3B H;  1YJ9 A;  5M5X H;  2A68 D;  5ISR A;  5KYI A;  1ILQ A;  2BH2 A;  1MHW C;  3VR6 A;  4K5V A;  3KLS A;  1HJP A;  2V4D A;  4X62 Q;  1H9K A;  4QF4 A;  1SYB A;  3CCL A;  1ZYR C;  2Y0S B;  1XNQ L;  3D3R A;  1QZG A;  2NVX H;  3M7G A;  4KY6 A;  5CV6 A;  2IWH A;  1EIH A;  3H94 A;  4ZUI A;  3ICE A;  1HQM C;  4LFA Q;  3PQI A;  3I4O A;  4QUC A;  4GKJ Q;  3PO3 H;  4AH6 A;  4X64 L;  1S72 A;  2A73 B;  4AYB E;  4KHP L;  2PW5 A;  4C3J B;  2ICE C;  2R93 G;  4RGT A;  2PPB C;  1DOL A;  1GPR A;  1SFO B;  1HCZ A;  4F7X A;  2NBF A;  1DCZ A;  1LTT D;  4LF7 L;  1Q8I A;  2L55 A;  5FO9 B;  3BVG A;  1GVP A;  2TMP A;  4C3I H;  4JI8 L;  1XPU A;  3NEM A;  3BJU A;  4QIW B;  4MN3 A;  4QIW E;  4F88 A;  1U9R A;  5COY A;  2CHB D;  4C3J H;  2HIV A;  1HHV A;  2BCO A;  1WYD A;  3PV0 A;  2LMC B;  3QG1 A;  3QOJ A;  3G71 A;  3GTL H;  1RD9 D;  3OMC A;  4IFD J;  1DYQ A;  1E22 A;  4EGV A;  1YVC A;  4LUZ A;  5IP7 H;  4K0K L;  3UZ0 B;  1DON A;  3HOW H;  2JA7 B;  2JXM B;  4RHS A;  1MD2 D;  2CQA A;  1D6E C;  1B1Z A;  3RD4 A;  4JBW M;  3CC7 A;  5FLX L;  4FXD A;  4NMZ A;  4R4O A;  4AYB G;  3QWN A;  3PUY A;  2I07 B;  2L0C A;  2R61 A;  4GOP C;  5KYL A;  3CW2 C;  3T1H L;  5T1G A;  4JK1 C;  4LF5 L;  3GD7 A;  2QF7 A;  3H0G G;  3NBI A;  3UI2 A;  4A93 H;  1JOO A;  2H5X A;  2MO0 A;  5EBC A;  1FYC A;  3HGB A;  5KEE A;  1D5X C;  1PTO B;  4BBR H;  1B44 D;  1Z9F A;  1WOC A;  4LXC A;  2K1B A;  1X6O A;  3FKI G;  2CW0 D;  3H91 A;  3I8Z A;  4QB4 A;  3A8J E;  1U4M A;  4RKL A;  1PH5 A;  1NNX A;  1NCV A;  1SFO H;  2AWN A;  3R8B A;  3F8T A;  1IW7 D;  1TWA H;  1FJG L;  1MIU A;  2MGS A;  1L0Y B;  2ATW A;  2PZT A;  2I5H A;  3GTP B;  4DK1 A;  5LL6 X;  5FJ8 H;  4A3K G;  2YTY A;  5AFW A;  1MJC A;  2E8G A;  2RCF A;  2ZTD A;  3EA6 A;  1BXT A;  1JMC A;  2JA6 G;  2FFK B;  5LMN L;  1BVS A;  5ELC A;  3M4O H;  1B70 B;  3CRL C;  4A3E H;  3FPU B;  2QGQ A;  3J7Y W;  2Z8L A;  1YNN C;  2XN9 C;  1N8R C;  3ERS X;  1CUK A;  3IFT A;  2KHJ A;  2PI2 E;  1RTO A;  3GTQ H;  1NTG A;  1D5Z C;  1EQQ A;  3HOY B;  3CME A;  1L0X B;  3NWT A;  5DNF A;  3HOV B;  5K36 G;  1A15 A;  2YTV A;  5CV4 A;  1N36 L;  1J8I A;  4LF7 Q;  2K5N A;  2Z6K A;  4P73 A;  1BCP D;  1QIL A;  4C3I B;  3KK7 A;  4DAY B;  4A3D B;  2YU9 H;  4PMW A;  2UU9 L;  1WTO A;  2SEB D;  2Q2U A;  4R4C A;  1GKH A;  5C3W A;  1B50 A;  4DV0 Q;  3WOF A;  4BY7 G;  4ZKB B;  4IUN A;  1VQ7 A;  1I4G A;  3CCJ A;  4LF6 Q;  4KY7 A;  3GTL B;  1W2B A;  1ESR A;  4UP8 A;  1Q12 A;  2VUM B;  3EIV A;  3IFD A;  1EQV A;  4DK6 C;  1FR3 A;  1LM0 A;  3MZ5 A;  1KNE A;  1HNZ L;  4IPD A;  2X6L A;  3S2D B;  2F03 A;  2WIN B;  1BBU A;  5CV5 A;  4A3B G;  3RMH A;  4JI0 Q;  1KAA A;  3FKI B;  2KEC A;  3OIP A;  4UP9 A;  3S14 B;  2Z4H A;  4K5X A;  5JPN C;  1NE3 A;  1TWG B;  4IUV A;  5KNC A;  3BDL A;  4DXF A;  1XPO A;  3I7F A;  3MHB A;  4LFB L;  2LKV A;  4KMU C;  1IBL L;  3CCQ A;  4DV1 L;  1XPR A;  3EN2 A;  1RCV D;  3KF8 A;  2EJM A;  1Y1W H;  4R8N A;  4APV A;  3OSO A;  4H44 C;  2R92 B;  3MXN B;  1WTW A;  4DAV A;  5ELN A;  3I3C A;  3I91 A;  1OXS C;  3MWY W;  4KJN A;  1IYV A;  5M5Y B;  1CKN B;  3OHX C;  3UDX A;  3J80 E;  3J7A V;  2VB2 X;  4LFB Q;  2VW9 A;  3STB C;  4HIO A;  4IAL A;  2RSO A;  3J7Z C;  1EY5 A;  2Z4I A;  4LFC L;  3CQZ B;  4DR2 L;  3BZK A;  4PNY A;  4FO2 A;  2WAQ B;  4OWX B;  2OCE A;  1AE2 A;  1LTB D;  1GLB F;  2Q2I A;  1V9P A;  4IFD H;  3K5L A;  5KVP A;  2IT1 A;  1EIY B;  1FGB D;  1L1O C;  1G8Z D;  2YYZ A;  5EKK A;  3KLW A;  3D4W A;  3M4Q A;  2LS0 1;  1ET9 A;  5K36 H;  2WII B;  1GO3 E;  4PG3 A;  4JI4 Q;  1S5C D;  3OWF A;  1NUC A;  4CJ1 B;  1I94 Q;  2HCC A;  1YIT A;  1JQY D;  1QWY A;  1SE2 A;  1WI5 A;  1KC8 C;  2B8F A;  1R9T B;  1DZ1 A;  4XQN A;  4XYQ A;  2NVX B;  3T53 B;  3OUR B;  1TWF B;  3GTJ H;  4G7H C;  1BCP B;  2I5L X;  1CA6 A;  4TVA B;  4WJ3 M;  3A8I E;  4BY1 B;  1QCB D;  5EGT A;  2BA0 A;  1PFN A;  4A3G H;  5IGB A;  1VQE A;  4RHR A;  3K8A A;  5M3M H;  4FYD A;  1LLR D;  1F3G A;  3ONA B;  5JJK A;  3QB3 A;  1A3U A;  4HAE A;  3Q8D A;  2F3W A;  3S1R B;  4DPG A;  2JA8 H;  1E2W A;  4LFA L;  4LF6 L;  1VQH A;  1OXX K;  1PH8 A;  3X3M A;  3AQQ A;  3U9S A;  3E6Z X;  4IZ8 A;  1CKM A;  4DK3 C;  4CJ0 B;  4KHP Q;  2P5Z X;  2GA4 B;  3J81 j;  2EOT A;  1N32 L;  1KL9 A;  1YJW A;  3GTK B;  1I3Q B;  4JI6 Q;  2HSI A;  3B6Y A;  1Y1W G;  1HNZ Q;  1IBM Q;  2K52 A;  3SR1 A;  5CMD A;  4K2K A;  1Y8O B;  2KA7 A;  4A3G G;  1D1K A;  4H0L C;  3SDZ A;  2AQ2 B;  1JJC B;  4DR5 L;  3VR2 A;  4OO1 G;  2E5L L;  1EY8 A;  1HR0 W;  1BKB A;  5M5W B;  3S17 B;  3K58 A;  2F0U A;  2AKW B;  5FLM H;  4A3M B;  1ZKO A;  2KCT A;  4RA8 A;  1XXG A;  2EVB A;  4G57 A;  5M3M B;  4JI3 Q;  3HOV G;  4JBW A;  1LT6 D;  1D5M C;  2QCP X;  5KND A;  3HKS A;  4RFB A;  3BG3 A;  3O13 A;  1I4R A;  4OXP A;  5A35 A;  4UAI A;  4O42 A;  2JA9 A;  3RNU A;  1VQ6 A;  3A5Z B;  4R4Q A;  2F0L A;  4OWT B;  1ZXT A;  1PH2 A;  4JG2 A;  1KRT A;  1Y8N B;  1CK1 A;  4P71 A;  4OIK A;  4L6T B;  1MBY A;  2JA5 B;  1A8V A;  2ASB A;  3J80 c;  2VUM G;  3M3Y B;  3UDI A;  4DV1 Q;  4DR7 L;  3Q24 A;  1B8A A;  2WAC A;  1D7Q A;  1EZ8 A;  4GLX A;  3M4Y A;  4ID6 A;  4QQB X;  4WOR A;  3K7A B;  3SVM A;  3TP7 A;  3K7U C;  5C0X G;  2H1E A;  4QPB A;  1B7Y B;  3ND9 A;  4CKC A;  1EWC A;  1F9Q A;  3JAM E;  3T16 A;  4DV6 L;  1KDA A;  2IPK D;  4ME5 A;  4X3S A;  3NBH B;  4A3L H;  1A2T A;  2L5T A;  4CKB A;  3AFQ A;  5GAG C;  1GXD C;  3BU2 A;  2VB3 X;  4B3M L;  1UWV A;  3LNN A;  3T1H Q;  4RGN A;  1EOV A;  4DUZ Q;  2K03 A;  2OTL A;  4CHT B;  4MZ9 A;  2VS1 A;  4P75 A;  3CSQ A;  2R93 B;  1I6H H;  4BY1 H;  5EJW A;  1WFQ A;  3OYY A;  1K8G A;  4HIK A;  2Z9H A;  1WCM B;  1I6V C;  2K5V A;  2BDO A;  1WTR A;  4NPS A;  3S1R H;  1TWC B;  5COR A;  1MJE A;  3I70 A;  2B3G A;  1JR0 D;  1MSG A;  1SRU A;  3K5N A;  2N49 A;  3NQT A;  4IUQ A;  1VQM A;  5IOC A;  2Q2H A;  1A3V A;  1FGU A;  1H9J A;  3RR5 A;  5CBE E;  1M4V A;  1O7Y A;  2B63 G;  4HIM A;  4BWG B;  1VQO A;  2TSS A;  2A6H D;  3NTK A;  1EYA A;  2PZU A;  3A74 A;  2EDG A;  1VQL A;  3PF4 A;  1QUQ B;  3H15 A;  2PQA B;  2F4I A;  1AP0 A;  1ESF A;  5HGQ A;  3KJO A;  2NN6 G;  2O5I C;  5JPM C;  3GTG H;  2NVT H;  1OXV A;  4ALP A;  1NAP A;  1NBW A;  2AQ3 B;  3A54 A;  1F9P A;  1M8A A;  1AW7 A;  3FVQ A;  2JA8 G;  4QMG A;  3RZD H;  2PO4 A;  1N36 Q;  4FF1 A;  1H9M A;  3MXP A;  5IE8 A;  1TY2 A;  4NXM Q;  4Y52 H;  3TS0 A;  3TDQ A;  1N32 Q;  1ENF A;  2NVT B;  1GLE F;  1VDZ A;  2AUJ D;  2UUC Q;  1AZP A;  1ET6 A;  3L7Z C;  2VQF Q;  2GN5 A;  4P74 A;  1XTD A;  2K7V A;  1LTL A;  5A2Q E;  4MIU A;  4NXM L;  3NP8 A;  1HFN A;  1NR2 A;  1TVX A;  2QKI C;  1MSH A;  3A7A B;  2FXQ A;  1D8L A;  4P2C B;  1GD7 A;  1I6H B;  4DV4 L;  1S5E D;  1SLJ A;  1VS0 A;  2CWA A;  4RG1 A;  1LUZ A;  2A19 A;  1D2B A;  5IT9 L;  2EJG C;  5E4W C;  2SNS A;  5CGK A;  1YEZ A;  2F1M A;  4KKS A;  3WOE A;  4YY3 L;  1HNW L;  3IT5 A;  5EQ0 A;  1K9M C;  2F3G A;  3DM3 A;  4X66 Q;  1B3Q A;  5C3E H;  1R4Q B;  4YHH Q;  2NN6 I;  3GTM H;  2KQ3 A;  4KTA A;  3S17 H;  4BBR G;  2L15 A;  4FDB A;  4FXK C;  4GLA C;  1HUN A;  4AIM A;  4POG A;  1IYJ B;  3R93 A;  4IN3 A;  2UUA Q;  2B63 H;  1H9R A;  1C0A A;  2PYK A;  2XSC A;  2UUB L;  2R3Z A;  5GRO A;  1PFS A;  3J80 i;  3MEH A;  3SK6 A;  1ZEQ X;  3T4A C;  1KD1 C;  1O2F A;  1ENC A;  3S1M B;  1PRT C;  1PA6 A;  1OTC A;  2XVS A;  2DY8 A;  2K05 A;  5FO8 B;  1PH6 A;  1NMG A;  1LTG D;  4OON A;  2EYP A;  1J5E Q;  3LGJ A;  4X64 Q;  5JVH 3;  2EY6 A;  3KDF A;  1HNX Q;  4GN5 A;  3S1Q H;  4A3C G;  3M85 A;  1IYU A;  3GDE A;  2WFW A;  3BDO A;  1AX3 A;  3Q6S A;  1HTP A;  1E1O A;  1HH2 P;  1CHQ D;  2DNE A;  2PI2 A;  3L3O C;  3E9H A;  3CPW A;  1BBX C;  1XNQ Q;  1OXU A;  3QR8 A;  4HJ5 A;  3E3X A;  1JJ2 A;  3J7A F;  2G5D A;  3HKZ E;  2B0P A;  1JT8 A;  3HP3 A;  4A3B B;  1TWC H;  4CKE A;  1X56 A;  2B2W A;  4A3E B;  4Q0F A;  3VYS A;  1VCI A;  3I90 A;  1E2Z A;  2DUD A;  3PO3 G;  2JA6 B;  1SBB B;  3D8G A;  3U58 A;  3T51 B;  1SNO A;  3MA2 B;  4JC0 A;  4MTK A;  2PNR C;  3AFP A;  3I72 A;  5I6W A;  5M5W H;  4DV3 L;  4CDC C;  1EEF D;  1ZYR D;  5J3B A;  3J81 L;  1RHP A;  1SYG A;  2NYZ D;  2BE5 D;  1E1T A;  1GUS A;  1HR0 L;  3ITP A;  1CSQ A;  3DMU A;  5D3I B;  4A75 A;  1WCM G;  1SRO A;  2CWP A;  4GOP B;  4Z9C B;  5EBD A;  2N78 A;  1PH7 A;  4J1M A;  1KDB A;  4LUO A;  4JI1 L;  3TME A;  4JW0 A;  4OEL B;  4DNT B;  1V1P A;  1IKM A;  4L5T A;  1KAW A;  4DV2 Q;  3Q23 A;  1E7Z A;  4DV2 L;  1KQS A;  1F2L A;  4N8F A;  3P20 A;  2A74 C;  4DR4 Q;  2KEE A;  4RAU C;  4EX5 A;  4JCV E;  1SR3 A;  3PMF A;  4KV6 A;  4GLV B;  1TWH H;  3A55 A;  1GJX A;  2VQF L;  2R7D A;  4DA2 A;  4IJL A;  1U4P A;  1VMP A;  4N9T A;  1BR9 A;  1K83 H;  2XRQ D;  1M1K C;  4DR3 L;  3AB9 A;  2KOL A;  4BBS G;  1G51 A;  3CRK C;  1SE3 A;  3CQZ H;  1CKO A;  2K33 A;  5LMU Q;  4DR1 L;  4AQY L;  3LWU A;  3NEN A;  4A3I G;  3CP0 A;  2WAQ E;  1QG7 A;  1TY0 A;  3TZU A;  1C7Y A;  1JC7 A;  1RTN A;  4TSS A;  1RIP A;  4ZYS A;  3A56 A;  3H0G H;  3FRP B;  1N33 Q;  3CCE A;  5C3E G;  1I5F A;  1TS2 A;  1Q1E A;  1X3P A;  2ZJR A;  1IL2 A;  4JVZ A;  5EKI A;  3V05 A;  1EIF A;  1EUJ A;  2A69 D;  3W1B A;  4HED A;  2AQ1 B;  1SYE A;  2PQA A;  4P72 A;  4QL5 A;  5I9O A;  1DD2 A;  1TKW B;  2GU1 A;  2NTS A;  3K7A H;  2F52 A;  3KF6 A;  1KTK A;  3NHH A;  3TP6 A;  3ZYY X;  2D0O A;  3GTK H;  4XIG S;  1ENA A;  2YV5 A;  3T13 A;  4WJ4 A;  1WTP A;  1Y1W B;  3PCO B;  2RQX A;  1JB7 A;  3F2C A;  3FEW X; 
#chains in the Genus database with same CATH homology
 1SYD A;  4EVO A;  3H09 A;  3MAQ A;  3GP7 A;  1CM9 A;  1HQR D;  1C4Q A;  1STA A;  4NKL A;  1J9O A;  1QB5 D;  2PZW A;  4BS9 A;  1EOT A;  5EKL A;  4TKO B;  4IUU A;  4ZUJ A;  3PUZ A;  4FF3 A;  5CR3 A;  2O2L D;  2KHS A;  2PW7 A;  3BYY B;  1STH A;  3GQB A;  3KLS X;  3TP8 A;  5DAU A;  2A5H A;  1STY A;  3F2U A;  4HCE A;  3GTQ B;  2Q8R E;  1O7L A;  2A6E D;  4RH6 A;  4K6D A;  4I7Z C;  3C3L A;  3BYT B;  4IQZ A;  5KGU A;  4A3F B;  2LY7 A;  4KD4 A;  1RDP D;  2IJ0 A;  4EQN A;  4DAY A;  4M8A A;  2K01 A;  3H3V C;  5A2Q L;  4R9W A;  3K59 A;  2R6G A;  4U67 3;  1VF7 A;  4X3T A;  3RUZ A;  1E0B A;  2PMZ B;  1JIC A;  4DXG A;  1SYF A;  5E3F A;  5I2Y A;  1STB A;  4O1N A;  3DWA A;  4WFN 3;  1C8C A;  5JEA J;  3NQI A;  3PO2 B;  4K8I A;  3KBX A;  5J39 A;  1TS5 A;  1KAB A;  1K83 B;  2L12 A;  1LV9 A;  4FNF A;  4GZY C;  3P1H A;  3T56 B;  4IFD G;  2VXW A;  4XT1 B;  5CBA E;  5C0X H;  3HOX B;  2B2U C;  3QOL A;  2E75 C;  1Q1B A;  5KNB A;  1SAP A;  2F0H A;  1CTM A;  1EYC A;  5EPL A;  2EYF A;  3WDN A;  1CZW A;  2AUK A;  1HFG A;  3ERQ A;  2JYO A;  4OGQ C;  4BA2 I;  4N9P A;  2EYL A;  2QIL A;  3VYU A;  2F0N A;  3MXG A;  1ILP A;  4OO1 H;  1TQO A;  4IUR A;  3HS0 C;  3LWE A;  2ZXR A;  4DGZ A;  2BDN A;  3EQL C;  3E0J A;  2JE6 I;  4K2L A;  1Z7T A;  3FMC A;  1JWU D;  3SE0 A;  2K6A A;  4FVM A;  3SLU A;  1WTX A;  3VA7 A;  1LAB A;  2EXZ A;  3IAY A;  4ZLT F;  2EYJ A;  3P7J A;  1PZK D;  3C1E A;  3HOZ B;  4RGM A;  1SJE D;  1G91 A;  4TRD A;  1DOM A;  4UDU C;  1GUO A;  2E76 C;  2C9O A;  1SND A;  4F87 A;  3SK8 A;  2OT2 A;  2OXP A;  2RKS A;  4OL7 A;  1W6J A;  2C5C A;  2XIW A;  3HZX A;  4BY7 B;  1TU2 B;  4FP5 D;  4CBV A;  1OXT A;  2EY1 A;  5CYU A;  5I9P A;  3S9W A;  4DK0 A;  1G2S A;  2IX1 A;  1QJO A;  5IOD A;  1ROD A;  1SDF A;  2X69 A;  4DU9 A;  1JOR A;  3L9A X;  1GUG A;  2JEA I;  2JEB I;  4ZRZ A;  5LL6 S;  5M5X B;  3Q0A A;  3N6R A;  5J1Z A;  1VMC A;  2HDL A;  1WD1 A;  3OW7 A;  1JOK A;  3I73 A;  4BA1 I;  3R2T A;  3K5M A;  5D3D A;  1SE4 A;  2A6H C;  2LFN A;  4J8Q A;  4IUP A;  2O4X A;  1OO9 B;  2Q8I B;  2N55 A;  2JP1 A;  1EFI D;  1SYC A;  1TII D;  5CV8 A;  2B13 A;  4G7Z C;  4K6L A;  5ELD A;  1A2U A;  3K0Y A;  1IKL A;  1DOK A;  4LMQ D;  3HEJ A;  1HPC A;  2PCF B;  1LT4 D;  4NDX A;  1PYW D;  3KBG A;  3R2I A;  2F0Q A;  3NE5 B;  2BA1 A;  1G6Z A;  1R4P B;  4HN7 A;  2KVM A;  2Q8T A;  2EY2 A;  4PMC A;  3E5S A;  1PZJ D;  1F9S A;  4XQQ A;  1KLU D;  1JWM D;  4L8J A;  5BN3 A;  4WJW A;  3S15 B;  5FLX E;  3VYT A;  2F0F A;  1VF5 C;  5G3L F;  2J4X A;  2NB0 A;  1SNC A;  4BBS B;  1BF4 A;  3LX0 A;  3DWQ A;  1JCK B;  1CHP D;  2NZ1 D;  1LT3 D;  1V43 A;  3VYR A;  1QNK A;  4KN7 C;  2FHT A;  4LK1 C;  1HTL D;  1Y69 U;  3VR5 A;  4A3G B;  5I6Y A;  4RKB A;  2MPM A;  2YU9 B;  2E2H B;  1FNV A;  3NTI A;  1W6K A;  3NBH A;  5JJZ A;  2X6G A;  2K04 A;  3MFG A;  2F0K A;  1X3Q A;  4RGO S;  4LJZ C;  2MUY A;  4M1U B;  1H9S A;  3RLF A;  4K8J A;  4FF4 A;  4XXE A;  4RCN A;  1RKN A;  4KI0 A;  2M00 A;  3I4L A;  3SXH A;  1GUN A;  1AFP A;  3PUW A;  2B2V C;  3KLR A;  1ONL A;  2QDB A;  3MTS A;  4BH5 A;  2RA4 A;  1PRT F;  4A3I B;  2FMC A;  1UEA B;  1GUT A;  3J80 L;  3FDT A;  4DN4 M;  5CC4 A;  1EEI D;  3MC0 B;  1YNJ D;  1SEB D;  2RDH A;  3GTM B;  5M9O A;  2B2Y A;  1QNU A;  4CJ2 C;  1EU4 A;  4IUT A;  1ICW A;  1S5B D;  1STE A;  3K5O A;  4DF7 A;  3I4N B;  1FNU A;  1UNS A;  3N52 A;  1BCP F;  3BDC A;  2L9H A;  2IW3 A;  1PRT B;  5D14 A;  1PFB A;  2B2Y C;  4NP5 A;  4C56 C;  4EQP A;  3PUV A;  3S1Q B;  1JE4 A;  5CV9 A;  1PMR A;  2EYO A;  1IHZ A;  3S2H B;  2WKC A;  5K5P A;  2D62 A;  3IKJ A;  1DJR D;  1B2T A;  4HTH A;  1GLA F;  2JSO A;  3G6J B;  1BDO A;  1PRT D;  5IGF A;  1JOQ A;  3MFY A;  5HUR A;  5IGE A;  5JAV A;  4ZK9 B;  2F0G A;  5B0H A;  2FMM A;  3NSW A;  2L1B A;  1G2T A;  4DNR B;  1F9R A;  4ZKC B;  2F0T A;  2ZXP A;  3HOU B;  4TQU S;  3TBI B;  5C0X J;  4KJO A;  2K5W A;  3GTO B;  2VNU D;  4KK7 A;  2DY7 A;  3EFX D;  2ENB A;  3CU7 A;  1CFM A;  2Z1C A;  2WKD A;  2NVQ B;  1SMY D;  1U4L A;  2NUC A;  4QP5 A;  1Z6H A;  3Q22 A;  5J22 A;  3BS1 A;  2EZV A;  1BNZ A;  1MI2 A;  5IGD A;  3OPO A;  2B2V A;  4QCL A;  3NK9 A;  4H7B A;  2FIN B;  5IGG A;  1F2Z A;  3D6C A;  4J6H A;  1LO5 D;  4A93 B;  2WV6 D;  1NSN S;  3C46 A;  2RSN A;  2FJ2 A;  3S16 B;  2E74 C;  2CVR A;  1EWH A;  2F3V A;  3TSS A;  1I50 B;  1S5D D;  1F2M A;  3HRZ C;  2MJ8 A;  1K8M A;  2N88 A;  3X3N A;  3VA5 A;  3W3A A;  3VR3 A;  4G4K A;  4XYO A;  3DXJ C;  4ILW A;  1BQQ T;  2ZT9 C;  1EU3 A;  4OIJ A;  3QO2 A;  1LTS D;  1II3 A;  2EPB A;  3GV6 A;  1EY7 A;  3PUX A;  1HA6 A;  3DHQ A;  5TSS A;  3PO3 B;  1H9S B;  2XRS D;  3GV3 A;  1UAP A;  1Y8P B;  1LT5 D;  1TS4 A;  3NPP A;  3JAM L;  2F0I A;  2A68 C;  5FOB B;  5KIX A;  5JVG 3;  3A8K E;  5BN5 A;  2O5J C;  5D65 A;  5ELB A;  3C1F A;  2B2T C;  2A6E C;  2F0P A;  1CA5 A;  1O7Z A;  3VR4 A;  1F77 A;  4G7O C;  1PTO F;  2L4N A;  4R8I A;  2J7Z A;  1IL8 A;  3S1N B;  1A6X A;  4HMI A;  4KKT A;  1V8Q A;  2K5Q A;  1LTI D;  3NXW A;  1KDC A;  5FO7 B;  1HA5 A;  1SNM A;  1EL0 A;  1AZQ A;  3QJY A;  3H6M A;  3ERO A;  3MXN A;  1NR4 A;  1B9M A;  5IIF A;  5HGT A;  1SSO A;  1PXU A;  2OEO A;  2J0T D;  1PLF A;  2ZXO A;  2G9D A;  2IL8 A;  3TP5 A;  2K28 A;  1XYI A;  3CHB D;  1GGR A;  1CQF A;  5IT9 E;  4C3J G;  1BO0 A;  1EY9 A;  1TWH B;  3EVQ A;  4MHE A;  1F2Y A;  1RJT A;  4KY5 A;  1ML0 D;  2WB1 B;  3V96 A;  1B4O A;  3TN2 A;  3R3O A;  1G29 1;  4XTC S;  1Q90 A;  3HKZ B;  3V2T A;  5BN4 A;  1YNN D;  1AN8 A;  5C4Z A;  2EY5 A;  2NN6 H;  3KUP A;  4B9X A;  2B39 A;  3QIA A;  5CV7 A;  1CQV A;  5C5M A;  2XWJ B;  2HDM A;  3RZO B;  4C2M B;  1I4Q A;  3A7L A;  1LTR D;  5ELF A;  4ULL A;  4DAP A;  1QOH A;  2EJF C;  2F0J A;  4EQO A;  2BOS A;  4L63 B;  2I46 A;  3H0G B;  5C5L A;  1HUM A;  5JOB A;  1O80 A;  2NVY B;  2MP0 B;  2AWO A;  3MXU A;  4F8M A;  1EIG A;  1PTO D;  3J81 E;  5DEH A;  1HXY D;  5NUC A;  1CT1 D;  1BUV T;  1YNJ C;  1LAC A;  1GOZ A;  5I2X A;  5DM6 3;  2E2I B;  5C3E B;  1TS3 A;  5FKA C;  1DXM A;  2PQE A;  4ODG A;  4A3K B;  1KNA A;  1SJH D;  1XWE A;  2M2L A;  2QEJ C;  1A3T A;  5IGC A;  1U4R A;  4V0B A;  1STN A;  3FPP A;  4U68 A;  5ELE A;  2ICI A;  4FF2 A;  1O78 A;  4ABN A;  1X32 A;  1K8O A;  1AEX A;  2XWB B;  2F0D A;  1EY6 A;  4C1N K;  4E6I A;  3DWP A;  4C3H B;  2A69 C;  5G3L D;  1B53 A;  2IX0 A;  2OF1 A;  1SNP A;  1V1O A;  2B8G A;  5I4D A;  3SHL A;  4HR7 B;  4B08 A;  4AYB B;  4XQJ A;  3C2P A;  1CZG A;  2B63 B;  3MVV A;  3D31 A;  4DFA A;  2L11 A;  4V19 0;  2HCI A;  1SXT A;  1TT2 A;  4I65 A;  3PIP 3;  3SK4 A;  4Q5V A;  3K6O A;  2DNC A;  1XX8 A;  4XT3 B;  4ZAI A;  2WP8 J;  4ZQ3 A;  2H4O A;  1WVL A;  3OOC A;  4WRD A;  2B44 A;  3BVM A;  3TUF B;  5T1I A;  2K32 A;  1MGS A;  3DM1 A;  2KUM A;  3G7L A;  1SMY C;  2RBM A;  3OIQ A;  3OMG A;  1GUW A;  1EZ6 A;  5EPK A;  5JEA H;  3URY A;  1GHK A;  1TWA B;  4HCS A;  3OWE B;  3D4D A;  3BVZ A;  2IX3 A;  1WTV A;  4RNY A;  5JEA G;  4YIJ A;  4QUF A;  3AU7 A;  2M9V A;  4CGY B;  1T5X D;  1PDQ A;  4PMB A;  1D1I A;  5C44 B;  4PQX A;  5C4H A;  1EYD A;  1XTC D;  5DM7 3;  1DM0 B;  5E4X A;  2D9U A;  1GLD F;  1S5F D;  4IFD I;  2NTT A;  2E2D C;  3DEO A;  5EPJ A;  3TZD A;  4C3I G;  2F0E A;  2MHV A;  1IW7 C;  2EYH A;  3P75 A;  3NWS A;  2SNM A;  1PTO H;  4BBR B;  2NWG A;  3CKI B;  4X3U A;  2D2C C;  4K14 A;  1KLG D;  1PFM A;  2RVL A;  1JWS D;  4HMJ A;  3GTJ B;  3HOW B;  1Q3L A;  2F0V A;  4KD3 A;  4LAA A;  3M4O B;  2E2J B;  4KN4 C;  2HQE A;  1Y1V B;  1WTQ A;  1UUP A;  1WD0 A;  5FK9 C;  2CW0 C;  1BOS A;  1SNQ A;  2B2U A;  1RF2 D;  4FXG C;  2BE5 C;  5LHY 1;  3AMU A;  2K5D A;  1FNW A;  1S4Z A;  3D6W A;  4OO1 I;  5M3F B;  2EYM A;  4HSV A;  1BCP C;  3GTG B;  2R7Z B;  3K57 A;  1PZI D;  1QE6 A;  1EY4 A;  4K5W A;  3NYY A;  1JB3 A;  4OHJ A;  2KCC A;  1EY0 A;  3IL8 A;  3NTH A;  1PTO C;  1CI3 M;  1I4X A;  4S3S A;  1Z47 A;  3I4M B;  3NUC A;  2B2W C;  3DEP A;  4C3H G;  3EJI A;  2RDF A;  2SOB A;  2F0O A;  3IT7 A;  2D5D A;  3SEB A;  3PIO 3;  1I4H A;  4RCO A;  4RWS C;  2RDG A;  3W2D A;  3D4R A;  4Y7N B;  3SK5 A;  3BZD B;  4ZYB A;  4PV1 C;  1HRJ A;  2EE1 A;  4KHZ A;  1GHJ A;  2SDF A;  1E2V A;  4C1N I;  1TR5 A;  2XNA C;  1B3A A;  2GPR A;  2ID0 A;  1F3Z A;  2F0M A;  2F0W A;  3RZD B;  5C0X I;  1T5E A;  5C4X B;  3ND8 A;  2JA8 B;  4XDX A;  4NW2 A;  3M7N A;  1B9N A;  2MP1 A;  1V1P B;  2F0S A;  2KJX A;  2B2T A;  1I4P A;  3DUZ A;  4KKU A;  4B9W A;  2G9H D;  5C3X A;  5C6A A;  5E1F A;  5KRU A;  5C4J B;  3HG9 A;  1GLC F;  1C48 A;  2HUG A;  4KHV A;  2KED A;  5F2D A;  4RNZ A;  1STG A;  1LTA D;  4H13 C;  3U9O A;  4X3K A;  1FD7 D;  1EQT A;  3GO5 A;  4HSP A;  2KCN A;  2DN8 A;  4A3J B;  2A68 D;  5ISR A;  5KYI A;  1ILQ A;  3VR6 A;  4K5V A;  3KLS A;  2V4D A;  1H9K A;  4QF4 A;  1SYB A;  1ZYR C;  2Y0S B;  3D3R A;  3M7G A;  4KY6 A;  5CV6 A;  2IWH A;  1EIH A;  3H94 A;  4ZUI A;  1HQM C;  4QUC A;  2A73 B;  2PW5 A;  4C3J B;  2ICE C;  4RGT A;  2PPB C;  1DOL A;  1GPR A;  1SFO B;  1HCZ A;  4F7X A;  2NBF A;  1DCZ A;  1LTT D;  1Q8I A;  2L55 A;  5FO9 B;  3BVG A;  2TMP A;  4QIW B;  4MN3 A;  4F88 A;  1U9R A;  5COY A;  2CHB D;  1HHV A;  2BCO A;  3PV0 A;  2LMC B;  3QG1 A;  3QOJ A;  1RD9 D;  3OMC A;  4IFD J;  1DYQ A;  4EGV A;  3UZ0 B;  1DON A;  2JA7 B;  2JXM B;  4RHS A;  1MD2 D;  2CQA A;  1D6E C;  1B1Z A;  3RD4 A;  4JBW M;  5FLX L;  4FXD A;  4NMZ A;  3QWN A;  3PUY A;  2I07 B;  2L0C A;  2R61 A;  5KYL A;  5T1G A;  4JK1 C;  3GD7 A;  2QF7 A;  3NBI A;  3UI2 A;  1JOO A;  5EBC A;  1FYC A;  3HGB A;  5KEE A;  1D5X C;  1PTO B;  1B44 D;  4LXC A;  2K1B A;  2CW0 D;  3H91 A;  3I8Z A;  4QB4 A;  3A8J E;  1U4M A;  4RKL A;  1NCV A;  2AWN A;  3R8B A;  1IW7 D;  2MGS A;  1L0Y B;  2PZT A;  3GTP B;  4DK1 A;  5LL6 X;  5AFW A;  3EA6 A;  1BXT A;  2FFK B;  5ELC A;  3CRL C;  3FPU B;  3J7Y W;  2Z8L A;  1YNN C;  2XN9 C;  3IFT A;  1RTO A;  1D5Z C;  3HOY B;  1L0X B;  3NWT A;  5DNF A;  3HOV B;  5K36 G;  1A15 A;  5CV4 A;  1J8I A;  1BCP D;  1QIL A;  4C3I B;  3KK7 A;  4A3D B;  4PMW A;  1WTO A;  2SEB D;  5C3W A;  1B50 A;  3WOF A;  4ZKB B;  4IUN A;  1I4G A;  4KY7 A;  3GTL B;  1ESR A;  1Q12 A;  2VUM B;  3IFD A;  1EQV A;  1FR3 A;  3MZ5 A;  1KNE A;  2X6L A;  3S2D B;  2F03 A;  2WIN B;  5CV5 A;  3RMH A;  1KAA A;  3FKI B;  2KEC A;  3OIP A;  3S14 B;  2Z4H A;  4K5X A;  5JPN C;  1TWG B;  4IUV A;  5KNC A;  3BDL A;  4DXF A;  3MHB A;  2LKV A;  4KMU C;  1RCV D;  3KF8 A;  2EJM A;  4R8N A;  3OSO A;  4H44 C;  2R92 B;  1WTW A;  4DAV A;  3I3C A;  3I91 A;  1OXS C;  3MWY W;  4KJN A;  1IYV A;  5M5Y B;  3J7A V;  3OHX C;  3J80 E;  2VB2 X;  4IAL A;  2RSO A;  1EY5 A;  2Z4I A;  3CQZ B;  4PNY A;  4FO2 A;  2WAQ B;  1GLB F;  1LTB D;  4IFD H;  3K5L A;  5KVP A;  2IT1 A;  1FGB D;  1G8Z D;  2YYZ A;  5EKK A;  3D4W A;  2LS0 1;  1ET9 A;  5K36 H;  2WII B;  1S5C D;  3OWF A;  1NUC A;  4CJ1 B;  2HCC A;  1JQY D;  1QWY A;  1SE2 A;  1R9T B;  2B8F A;  1DZ1 A;  4XQN A;  4XYQ A;  2NVX B;  3T53 B;  3OUR B;  1TWF B;  4G7H C;  1BCP B;  1CA6 A;  3A8I E;  4BY1 B;  1QCB D;  5EGT A;  2BA0 A;  1PFN A;  5IGB A;  4RHR A;  4FYD A;  1LLR D;  1F3G A;  3ONA B;  3QB3 A;  1A3U A;  4HAE A;  2F3W A;  3S1R B;  1E2W A;  1OXX K;  3X3M A;  3U9S A;  3E6Z X;  4IZ8 A;  4CJ0 B;  2GA4 B;  2EOT A;  3GTK B;  1I3Q B;  2HSI A;  3SR1 A;  5CMD A;  4K2K A;  1Y8O B;  2KA7 A;  1D1K A;  4H0L C;  3SDZ A;  2AQ2 B;  3VR2 A;  4OO1 G;  1EY8 A;  5M5W B;  3S17 B;  3K58 A;  2F0U A;  4A3M B;  1ZKO A;  4RA8 A;  1XXG A;  2EVB A;  4G57 A;  5M3M B;  4JBW A;  1LT6 D;  1D5M C;  2QCP X;  5KND A;  4RFB A;  3BG3 A;  3O13 A;  1I4R A;  5A35 A;  4UAI A;  4O42 A;  2F0L A;  1ZXT A;  1Y8N B;  1CK1 A;  4OIK A;  1MBY A;  4L6T B;  2JA5 B;  3M3Y B;  3Q24 A;  2WAC A;  1EZ8 A;  3M4Y A;  4ID6 A;  4WOR A;  3K7A B;  3SVM A;  3TP7 A;  5C0X G;  4QPB A;  2H1E A;  3ND9 A;  4CKC A;  1EWC A;  1F9Q A;  3JAM E;  3T16 A;  1KDA A;  2IPK D;  4ME5 A;  4X3S A;  1A2T A;  2L5T A;  4CKB A;  1GXD C;  2VB3 X;  3LNN A;  4RGN A;  2K03 A;  4CHT B;  3CSQ A;  2R93 B;  5EJW A;  1WCM B;  1I6V C;  2BDO A;  1WTR A;  1TWC B;  5COR A;  3I70 A;  1JR0 D;  1MSG A;  3K5N A;  3NQT A;  4IUQ A;  5IOC A;  1A3V A;  1H9J A;  5CBE E;  1M4V A;  1O7Y A;  4BWG B;  2TSS A;  2A6H D;  3NTK A;  1EYA A;  2PZU A;  2EDG A;  2F4I A;  1AP0 A;  1ESF A;  2NN6 G;  2O5I C;  5JPM C;  1OXV A;  1NAP A;  2AQ3 B;  3A54 A;  1F9P A;  1M8A A;  1AW7 A;  3FVQ A;  4QMG A;  2PO4 A;  4FF1 A;  1H9M A;  3MXP A;  1TY2 A;  3TDQ A;  1ENF A;  2NVT B;  1GLE F;  1VDZ A;  2AUJ D;  1AZP A;  1ET6 A;  3L7Z C;  2K7V A;  5A2Q E;  4MIU A;  3NP8 A;  1HFN A;  1NR2 A;  1TVX A;  2QKI C;  1MSH A;  3A7A B;  4P2C B;  1I6H B;  1S5E D;  1D2B A;  5IT9 L;  2EJG C;  5E4W C;  2SNS A;  5CGK A;  2F1M A;  4KKS A;  3WOE A;  3IT5 A;  5EQ0 A;  2F3G A;  1R4Q B;  2NN6 I;  2KQ3 A;  4KTA A;  4FXK C;  1HUN A;  3R93 A;  4IN3 A;  1H9R A;  2PYK A;  2XSC A;  2R3Z A;  3SK6 A;  3MEH A;  1ZEQ X;  3T4A C;  1O2F A;  1ENC A;  3S1M B;  1PRT C;  2XVS A;  2DY8 A;  2K05 A;  5FO8 B;  1LTG D;  2EYP A;  5JVH 3;  2EY6 A;  3M85 A;  1IYU A;  3BDO A;  1AX3 A;  3Q6S A;  1HTP A;  1CHQ D;  2DNE A;  3L3O C;  1BBX C;  1OXU A;  3J7A F;  2B0P A;  3HP3 A;  4A3B B;  4CKE A;  2B2W A;  4A3E B;  4Q0F A;  3VYS A;  1VCI A;  3I90 A;  1E2Z A;  2JA6 B;  1SBB B;  3D8G A;  3T51 B;  1SNO A;  3MA2 B;  2PNR C;  3I72 A;  5I6W A;  1EEF D;  1ZYR D;  3J81 L;  1RHP A;  1SYG A;  2NYZ D;  2BE5 D;  1GUS A;  3ITP A;  3DMU A;  5D3I B;  4Z9C B;  5EBD A;  4J1M A;  1KDB A;  3TME A;  4DNT B;  1V1P A;  1IKM A;  3Q23 A;  1F2L A;  3P20 A;  2A74 C;  2KEE A;  4RAU C;  3PMF A;  4KV6 A;  3A55 A;  1GJX A;  4DA2 A;  1U4P A;  1VMP A;  4N9T A;  1BR9 A;  2XRQ D;  3AB9 A;  2KOL A;  3CRK C;  1SE3 A;  2K33 A;  3LWU A;  1QG7 A;  1TY0 A;  3TZU A;  1JC7 A;  1RTN A;  4TSS A;  4ZYS A;  3A56 A;  3FRP B;  1TS2 A;  1Q1E A;  1X3P A;  5EKI A;  3V05 A;  2A69 D;  4HED A;  2AQ1 B;  1SYE A;  5I9O A;  1DD2 A;  1TKW B;  2GU1 A;  2NTS A;  1KTK A;  3NHH A;  3TP6 A;  3ZYY X;  4XIG S;  1ENA A;  3T13 A;  1WTP A;  1Y1W B;  2RQX A;  3FEW X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...