4RNZA

Structure of helicobacter pylori csd3 from the hexagonal crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
369
structure length
359
Chain Sequence
MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Conserved hypothetical secreted protein
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 100
structure length 359
sequence length 369
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnzA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnzA02
1GGRA 1O2FA 4RNZA 2B13A 4LXCA 1AX3A 4QP5A 1GLCF 1GPRA 3CSQA 1GLAF 4BH5A 3IT7A 3IT5A 2GPRA 3OURB 3NYYA 3SLUA 1GLBF 1F3GA 5KVPA 4RNYA 3TUFB 2F3GA 2B0PA 1GLDF 3UZ0B 2B44A 2HSIA 1F3ZA 2MP0B 4ZYBA 1GLEF 4QPBA 4JBWM 5B0HA 1QWYA 2GU1A
chains in the Genus database with same CATH superfamily
2BT3A 1O2FA 3G16A 4IIAA 3UB1A 1DMNA 1MWRA 1D6UA 1BSCA 1F8NA 5AIFA 2OTJ3 5IF6A 5AIGA 1BNIA 1LOWA 3FZWA 3FH1A 1GOUA 2BIRA 4I4KA 7RNTA 1Q42A 3HOHA 3EX9A 1I2FA 3BNBA 3GAXA 1YJ93 1VQL3 3G0KA 1EUIC 1NB5I 8CHOA 3EBYA 1AY7A 1DETA 1U5OA 1MOLA 1D6YA 5M19A 1YGWA 3KSPA 1ROVA 3ER7A 1Q824 1GLBF 1NNVA 1Q9EA 1RGLA 2KXGA 3DY5A 3ALAA 5DRVA 3ZFZA 1HZ1A 3FSDA 3STDA 1BUQA 1UUWB 2L4VA 2B0PA 2CX1A 3EC9A 2XSHB 3FG3A 3K7CA 3UZ0B 2MF7A 2XFSA 3NX0A 1SPUA 4HZ9B 2RGQA 5RNTA 4NREA 3B8LA 1SIHA 1GLEF 1I3IA 1JV2B 3NHXA 2O3OA 3UL6A 1BRKA 1C7HA 5HGRA 3MG3A 4XBXA 5JBSA 4N6TA 4N6V0 1VQ63 3NM2A 4LYLB 1AX3A 1QAFA 3IMAB 1FUWA 1W2B2 1FZUA 3FF2A 4HM3B 3U1WA 4EBGA 3IT5A 1UGIA 5M18A 1RCKA 5BIRA 5AI1A 5BXQA 3H3HA 2OOVC 3A5EA 8RNTA 1MWUA 1DMQA 1B20A 1G02A 3JUOA 1RRHA 1AVLA 2W03A 4HKVB 4MMZB 4DKIA 6GSPA 3WDGB 1TU5A 1BVIA 1HKXA 3MG1A 1O7MB 3UJMA 3EF8A 1RNBA 1N9EA 2HSIA 3SVAA 2MP0B 1TP6A 1GMRA 1TRQA 1JB2A 1UUVB 2IMJA 3F8HA 1IV9A 3NQZA 4BL3A 2H0GA 4XDWA 1BIRA 3X40A 1OHOA 3I553 1DYUA 1QVG2 1RKYA 1K9M4 4HOHA 1BRHA 3JUMA 4J5GA 3CNXA 3KZTA 2P09A 2E2UA 3HK4A 2RBIA 1I2GA 1TRPA 1EA2A 1RGCA 3MKIA 4FCJA 1GYBA 4WWUC 5CXOA 1W02A 3AGOA 1YHQ3 1GOYA 3JUPA 2OQEA 1YJN3 2GEXA 4EV5A 2ZA4A 1C54A 2CFKA 2XGNA 2F3GA 4WYKB 3CD63 1VQ43 1BNFA 1YVSA 3LTCA 3BB9A 3NBRA 3OWYA 3Q90A 5G2GA 4K90B 3CCV3 1SJWA 3FGYA 3CPW2 1WMPA 3OXAA 2HOHA 3F9SA 1EQKA 3JVCA 3SOAA 1IYYA 1BAOA 1BANA 2BMQB 3KFQC 1W2ZA 3X41A 1STFI 1VQM3 2YFIB 3IT7A 4K1VA 7STDA 3AGNA 4J9AA 1MWTA 1MNLA 1OPYA 4JF8A 2MC8A 2P0XA 3OW22 2XRXB 3MWZA 1M9GA 3CCM3 3LXUX 3S27A 1JN5A 1NU3A 4N6LA 1B21A 1FGMA 1F3ZA 5IG0A 4EC6A 3EJVA 1JZOA 3OWSA 1B3SA 1FYSA 4J5KA 1JNQA 1ULJB 2BHMA 3AHSA 2CFDA 4HM1B 3G4S3 1SQWA 2RNTA 3GZXB 1IK3A 3QK9A 2QGUA 3CSQA 1TUHA 4N3VA 5ELJA 3EQQB 5AYRB 1FGQA 1JKGA 2GSPA 5I97A 2OTL3 3CME3 1GMQA 2HMKB 5STDA 3CC23 4O8SA 1VQN3 3LZAA 2QA43 2KCDA 2CG1A 3UL5A 1MGRA 3CU3A 4FMBA 4L8OA 2CWTA 1F3GA 1R4CA 1N8R4 4KFEA 5EEOA 2GXFA 1HYFA 3CNMA 4R4KA 4IPBA 1JBSA 1NJI4 1VQ93 3Q3FA 4X2HA 3SX1A 1B2SA 4L7KA 2Z6BA 4N6NB 1OGZA 3AMOA 3CXC2 2K0MA 5BVBA 1A67A 1TTOA 3NQYA 2ML6A 3FLJA 1EEJA 1WMOA 3WA3A 1W00A 5G1KA 1B2XA 1GPRA 1RGKA 1GLAF 1BRGA 5CK6A 3M8CA 1KC84 1GD4A 2W6JH 5IERA 2XF3A 2Y73A 3PGBA 1LOVA 2WO0A 4BL2A 1WTHA 4H3UA 1X1WA 3OWUA 1A2KA 1TFOA 4HM6B 1Q40B 1O7GB 3KKGA 1WMNA 1Q40A 1V58A 2IUJA 2I9WA 1RN4A 4R1KA 1OACA 1RN1A 1IU7A 1N9JA 1BOXA 1MGWA 5FGOA 1J2BA 4BTYA 3F40A 7GSPA 1PY3A 4NHFA 1RGEA 2WOHA 3V99A 5IG3A 3MHEA 2F5MA 1IVWA 1FUTA 1WQLB 2K54A 1VQP3 1BGSA 1KD14 4STDA 4CJNA 2BMRB 2F56A 4O02B 4Q53A 3LOYA 2Z76A 1I8VA 2KAAA 1UUGB 3QRDA 3SEDA 1BNRA 1LQGC 2XR8B 1UCKA 2AAEA 5GSPA 1IQYA 1YI23 3X42A 1SARA 2B1XB 4HAAA 1BNSA 1RHLA 3FF0A 4HM5B 1I0VA 3TDGA 3CCL3 1Q7HA 4GHOA 2LYXA 2CFGA 2XH9A 3PCSA 1TFKA 5KP1A 1BRNL 4FCMA 1NDOB 1GSPA 1IQ8A 1IV7A 4MJDA 2F99A 4ZYBA 3BU4A 3LYGA 3DXOA 4HM2B 4RNZA 1E97A 1GY7A 5IEPA 1GD3A 3CCE3 3SOYA 1RDSA 2ZHXB 3D79A 6STDA 1DVDA 3KIIA 2CFWA 1A90A 1BSAA 3BIRA 3KCHA 3PXMA 3E99A 4GSPA 5DREA 3WR2A 2QIYA 3MYTA 4AEQA 2HMLB 5IG4A 1E3VA 5AEUB 1PU4A 3G6E3 5CLKA 3F14A 4XM4A 2PNCA 3BLZA 1B2MA 2IYJA 1QMAA 3GRDA 2FXTA 2CW9A 3NXJA 1X1XA 5KVPA 3Q1CA 1WNHA 3TUFB 3NM7A 1A2VA 4J8TA 4BIRA 1W01A 5AIIA 4WFOA 2HMNB 4JBWM 2ML5A 2P38A 1L5GB 4HM4B 1OUNA 2CWVA 5KP3A 3KE7A 2CG0A 1TJDA 1BNGA 3LT8A 1AVKA 1RGAA 3PCRA 3HX8A 2OWPA 4BH5A 1AV4A 2KF6A 4GL6A 3D5GA 3G713 4OK0A 1Q7Y4 4BTXA 1OF5B 1ZGXA 3OURB 2F5WA 3DGOA 4OUQA 1YGEA 3WOEB 1UCJA 3D5IA 3FKAA 4XBYA 3ZG0A 1UCLA 1RGHA 2O9UX 2JDIH 3PZWA 1BSBA 1OF5A 4NPBA 1JN5B 3JUQA 3K5TA 1LNHA 1BRJA 1LVNA 2IUKA 3DH2A 1FGOA 1ISKA 2BMOB 2XGLA 1ZX2A 2ZL8A 3EN1B 1JRQA 4CCVA 3D3LA 3NBJA 1YIT3 2GEYA 1QAKA 1RMSA 1NO3A 2YX9A 1V74A 1VQQA 2HMJB 1OHSA 1I0XA 2W9QA 1B2UA 3N54B 3NV0B 1YJW3 1DE3A 4LXCA 1Y4KA 2BO9B 1IVVA 3GZRA 4QP5A 1JKGB 4ILFA 3D9RA 3DGLA 3NV0A 3BNEA 1GY6A 3S5CA 4EYCA 1RJOA 4EW5A 1O7HB 2OOVA 3URPA 3KN4A 4HJLB 4KT3B 1RSNA 3RGAA 1FGTA 3T8UA 2ZDJA 1BUJA 2Z7AA 1CEWI 1ROAA 2F86B 3K63A 2FNQA 4HM0B 1T2HA 4OVMA 4RNYA 2LQVA 1W6CA 2W56B 4AKZA 1YIJ3 5AEWB 1GLDF 3Q2PA 3T8NA 5IEOA 2W56A 3OV4A 5IW9A 3AMOB 2Q07A 4HBRA 4CDLA 4FMDA 3RNTA 3DGNA 3EB8A 3UNLA 3N9HA 4MMYB 1US1A 3CPOA 2QEX3 3RDEA 4BTWA 1MWSA 1LNIA 3L0RA 3MPHA 1RNTA 1PYLA 2CWUA 1K8A4 3ECFA 3LTDA 4LSOA 2GPRA 1N5HA 2V1LA 3K9MC 3LTBA 3GZBA 2M7OA 1BSDA 2UX0A 3DGMA 1M904 3O8YA 4XBTA 3S29A 2HMMB 3K0ZA 4XB5A 1M1XB 2OQEC 2C4BA 3B4OA 1IDPA 1R4YA 2W2CA 2STDA 1K734 2F4YA 2L1SA 2D1WA 3I563 4TX4A 1IQXA 1IVUA 1T3BA 2CC3A 4LZIA 5D81A 2IA7A 2SARA 3S28A 4N6UA 1QJGA 1LXEA 4FMCA 1Q864 1NB3I 1O7WB 1EG9B 1RN7A 3IPTA 4R9LA 1CYUA 3J7Yd 2XSOB 4FR9A 2WGQA 1SIIA 3WHOA 2CFLA 3SYUA 1STDA 1T2IA 2WOFA 5AIHA 1JBRA 3LT9A 4K61A 1AR0A 2W0QA 3BNCA 1N5PA 1FGRA 2CHCA 1HU9A 4FCZA 2KF4A 1KQS2 1O7NB 2CH9A 3AHWA 3HIIA 1BNEA 3I0YA 1FA3A 1W6GA 4HM7B 1GS3A 3CMA3 2FGTA 3CCR3 3EBTA 4L8PA 3FG1A 1PFPA 1GY5A 2B44A 1IT8A 1OH0A 3D4AA 2YFLB 3KSED 4XDVA 5FW5A 5TGNA 4N6MA 1FUSA 4QPBA 1VQK3 5B0HA 1IVXA 1QALA 1UI7A 2R4IA 3WMDA 1X1YA 3DMCA 1GGRA 3HIGA 2GBXB 3OX9A 1VQO3 2B13A 3WOFB 1OCVA 4RNTA 1DMMA 2CKFB 2BU4A 3T0UA 2E2TA 2CIUA 1G96A 1BRIA 1E3RA 2SBLA 1RCLA 3B4PA 3MG2A 1S723 1VQ73 1K28A 4MEIA 4O2HA 3GWRA 4U13A 2A15A 3F7SA 3MSOA 3HZPA 4KZ1A 3CCS3 1RRLA 1X1UA 3IJEB 3CC43 5KP4A 1UGHI 2CK3H 2H0HA 2XEPA 4MMXB 3ZG5A 4EV2A 4R9KA 2HMOB 4N6OB 2F98A 2KRTA 4R80A 1S5AA 1W6YA 2B24B 2GU3A 3G8ZA 2KF5A 4IT7A 2GU1A 3WODG 3X3XA 4KFDA 4RZMA 2W9PA 9RNTA 3EN8A 1GLCF 3CCJ3 1N8QA 1OHPA 2KF3A 2BNGA 3DGYA 3FCSB 3GSPA 1CYVA 3H51A 1LOXA 1LRAA 2P0MA 1Z1SA 3DM8A 1UI8A 4QWTA 1BU4A 2P05A 6RNTA 1ULIB 3DUKA 2XFTA 1G0TA 3SLUA 3N8BA 1DVCA 4PEJA 1GMPA 4BU4A 1ZS7A 5CF2A 2IY2A 2R41A 4KVHA 1UCIA 1EKMA 5CF1A 1B27A 4WYKA 5LC7A 2OCTA 3PYJA 1RTUA 4WP5A 1M1K4 1LOYA 1RGFA 1UW1A 3B7CA 1VQ83 1BSEA 1QWYA 1I3FA 1OGXA 1GOVA 1TIJA 2RSXA 1IT7A 1FW7A 3FG4A 1V57A 2RCDA 1UDII 1W4NA 4FMAA 4CPKA 3WA2X 1B2ZA 1CQSA 5EQLA 3CCU3 1YVBI 1NWWA 1BNJA 3LMLA 1D6ZA 4ZM8A 3NYYA 3VF1A 3A76A 3LTAA 1KSIA 4KFFA 4RBNA 2UUGC 2WGOA 1I2EA 4LMIA 2PZVA 2YFJB 1I70A 3EHCA 1QVF2 5IENA 2JQ5A 3EE1A 2UGIA 3F7XA 1W7CA 5AYSC 2Y74A 5HOHA 1W5ZA 1LQMB 2GBWB 3SXXA 1U8CB 4JRFA 4AKYA 4K1UA 3CCQ3 4X2OA 5ELUA 3LH4A 3X3ZA 1O7PB 1K41A 3S67A 1BRSA 5EVHA 1T5YA 2J8XB 2H0IA 2C11A 2CX0A 3GZYB 4I5QA 3CC73 3X3YA 5JPUA 2Z77A 1YNVX 2K3DA 3NBBA 4HVNA 2W04A 4H61A 5IG5A 2D42A 3F8XA 4O3VA 5G1LA 3HI7A 3VGNA 1JJ22 1VQ53 4WHAA 1JZDA 3JUNA 2AADA 1JB4A 3V98A 1AQZA 1JBTA 1JB5A 4ORLA 3RGRA 4GB5A 2E2VA 3V92A 5D83A 4G1MB 2INXA 3PS8A 3BNDA 3DZLA 3NUVA 3VSYA 3ROBA 2RFRA 3U97A 1RGGA 4LEHA 5D82A 1RLSA 2C10A 4HM8B 4HZBB 4LGQA 1Q814 5JPPA 5LC6A 5BU4A 4HYZA 5M1AA 1CH0A 1VZZA 1A2PA 4EXRA 5A0OB 1KWIA 1ZO2A 1ASKA
chains in the Genus database with same CATH topology
2BT3A 1O2FA 3G16A 4IIAA 3UB1A 1DMNA 1D6UA 2OTJ3 1F8NA 5AIFA 5IF6A 5AIGA 3FZWA 3FH1A 4I4KA 1Q42A 3EX9A 3BNBA 3GAXA 1YJ93 1VQL3 3G0KA 1NB5I 8CHOA 3EBYA 1U5OA 1MOLA 1D6YA 3KSPA 1ROVA 3ER7A 1Q824 1GLBF 3DY5A 2KXGA 5DRVA 3ALAA 3FSDA 3STDA 1BUQA 1UUWB 2L4VA 2B0PA 3EC9A 3FG3A 2XSHB 3K7CA 3UZ0B 2MF7A 2XFSA 3NX0A 1SPUA 4HZ9B 2RGQA 4NREA 3B8LA 1SIHA 1GLEF 1JV2B 3NHXA 2O3OA 3UL6A 1C7HA 5HGRA 3MG3A 4XBXA 5JBSA 4N6TA 4N6V0 1VQ63 3NM2A 1AX3A 1QAFA 3IMAB 1FUWA 1W2B2 3FF2A 4HM3B 3U1WA 4EBGA 3IT5A 5AI1A 5BXQA 3H3HA 2OOVC 1DMQA 3JUOA 1RRHA 1AVLA 2W03A 4HKVB 4MMZB 3WDGB 1TU5A 1HKXA 3MG1A 1O7MB 3UJMA 3EF8A 1N9EA 2HSIA 3SVAA 2MP0B 1TP6A 1UUVB 3F8HA 1JB2A 2IMJA 1IV9A 3NQZA 4XDWA 3X40A 1OHOA 3I553 1DYUA 1QVG2 1RKYA 1K9M4 3JUMA 3CNXA 3KZTA 2P09A 2E2UA 3HK4A 1EA2A 3MKIA 4FCJA 1GYBA 4WWUC 5CXOA 1W02A 1YHQ3 3JUPA 2OQEA 1YJN3 2GEXA 4EV5A 2CFKA 2XGNA 2F3GA 4WYKB 3CD63 1VQ43 3LTCA 3BB9A 3NBRA 3OWYA 3Q90A 5G2GA 4K90B 3CCV3 1SJWA 3FGYA 3CPW2 1WMPA 3OXAA 3F9SA 1EQKA 3JVCA 3SOAA 2BMQB 3KFQC 1W2ZA 3X41A 1STFI 1VQM3 2YFIB 3IT7A 4K1VA 7STDA 4J9AA 1OPYA 1MNLA 4JF8A 2MC8A 2P0XA 3OW22 2XRXB 3MWZA 1M9GA 3CCM3 3LXUX 3S27A 1JN5A 1NU3A 4N6LA 1FGMA 1F3ZA 5IG0A 4EC6A 3EJVA 3OWSA 1JNQA 1ULJB 2BHMA 2CFDA 4HM1B 3G4S3 1SQWA 3GZXB 1IK3A 3QK9A 2QGUA 3CSQA 1TUHA 4N3VA 5ELJA 3EQQB 5AYRB 1FGQA 1JKGA 5I97A 2OTL3 3CME3 2HMKB 5STDA 3CC23 4O8SA 1VQN3 3LZAA 2QA43 2KCDA 2CG1A 3UL5A 3CU3A 4FMBA 4L8OA 2CWTA 1F3GA 1R4CA 1N8R4 4KFEA 5EEOA 2GXFA 3CNMA 4R4KA 4IPBA 1VQ93 1NJI4 4X2HA 3SX1A 4L7KA 2Z6BA 4N6NB 1OGZA 3AMOA 3CXC2 2K0MA 5BVBA 1A67A 3NQYA 2ML6A 3FLJA 1WMOA 3WA3A 1W00A 1GPRA 1GLAF 5CK6A 1KC84 3M8CA 1GD4A 2W6JH 5IERA 2XF3A 2Y73A 3PGBA 2WO0A 1WTHA 4H3UA 3OWUA 1A2KA 1TFOA 4HM6B 1Q40B 1O7GB 3KKGA 1WMNA 1Q40A 2IUJA 2I9WA 4R1KA 1OACA 1IU7A 1N9JA 5FGOA 1J2BA 4BTYA 3F40A 4NHFA 2WOHA 3V99A 5IG3A 3MHEA 1IVWA 1WQLB 2K54A 1VQP3 1KD14 4STDA 2BMRB 4Q53A 4O02B 3LOYA 2Z76A 3SEDA 3QRDA 2XR8B 1IQYA 1YI23 3X42A 2B1XB 3FF0A 4HM5B 3TDGA 3CCL3 2LYXA 2CFGA 2XH9A 3PCSA 1TFKA 5KP1A 4FCMA 1NDOB 1IQ8A 1IV7A 4MJDA 2F99A 4ZYBA 3LYGA 3DXOA 4HM2B 4RNZA 1E97A 1GY7A 5IEPA 1GD3A 3CCE3 3SOYA 6STDA 1DVDA 3KIIA 2CFWA 1A90A 3PXMA 3E99A 5DREA 2QIYA 3MYTA 4AEQA 2HMLB 5IG4A 1E3VA 5AEUB 1PU4A 3G6E3 5CLKA 3F14A 4XM4A 2PNCA 3BLZA 1QMAA 3GRDA 2FXTA 2CW9A 3NXJA 3Q1CA 5KVPA 1WNHA 3TUFB 3NM7A 1A2VA 4J8TA 1W01A 5AIIA 4WFOA 2HMNB 4JBWM 2ML5A 2P38A 1L5GB 4HM4B 2CWVA 1OUNA 5KP3A 3KE7A 2CG0A 3LT8A 1AVKA 3PCRA 3HX8A 2OWPA 4BH5A 1AV4A 4GL6A 3G713 4OK0A 1Q7Y4 4BTXA 1OF5B 3OURB 3DGOA 4OUQA 1YGEA 3WOEB 3FKAA 4XBYA 2O9UX 2JDIH 3PZWA 1OF5A 1JN5B 3JUQA 3K5TA 1LNHA 1LVNA 2IUKA 1ISKA 1FGOA 2BMOB 2XGLA 1ZX2A 2ZL8A 3EN1B 1JRQA 4CCVA 3D3LA 3NBJA 1YIT3 2GEYA 1QAKA 1NO3A 2YX9A 1V74A 2HMJB 1OHSA 2W9QA 3N54B 3NV0B 1YJW3 4LXCA 1Y4KA 2BO9B 1IVVA 3GZRA 4QP5A 1JKGB 3D9RA 3DGLA 3NV0A 3BNEA 1GY6A 3S5CA 4EYCA 1RJOA 1O7HB 2OOVA 3KN4A 4HJLB 3RGAA 1FGTA 3T8UA 2ZDJA 2Z7AA 1CEWI 1ROAA 2F86B 3K63A 2FNQA 4HM0B 4OVMA 4RNYA 2LQVA 1W6CA 2W56B 4AKZA 1YIJ3 5AEWB 1GLDF 3Q2PA 3T8NA 5IEOA 2W56A 3OV4A 5IW9A 3AMOB 2Q07A 4HBRA 4CDLA 4FMDA 3DGNA 3EB8A 3UNLA 3N9HA 4MMYB 1US1A 3CPOA 2QEX3 3RDEA 4BTWA 3L0RA 3MPHA 2CWUA 1K8A4 3ECFA 3LTDA 4LSOA 2GPRA 1N5HA 2V1LA 3K9MC 3LTBA 3GZBA 2M7OA 2UX0A 3DGMA 1M904 3O8YA 4XBTA 3S29A 2HMMB 3K0ZA 4XB5A 1M1XB 2OQEC 3B4OA 1IDPA 2W2CA 2STDA 1K734 2D1WA 3I563 4TX4A 1IQXA 1IVUA 2CC3A 4LZIA 5D81A 2IA7A 3S28A 4N6UA 1QJGA 1LXEA 4FMCA 1Q864 1NB3I 1EG9B 1O7WB 1RN7A 3IPTA 4R9LA 1CYUA 3J7Yd 2XSOB 4FR9A 2WGQA 1SIIA 2CFLA 1STDA 2WOFA 5AIHA 3LT9A 4K61A 1AR0A 2W0QA 3BNCA 1N5PA 1FGRA 2CHCA 1HU9A 4FCZA 1KQS2 1O7NB 2CH9A 3HIIA 3I0YA 1FA3A 1W6GA 4HM7B 1GS3A 3CMA3 2FGTA 3CCR3 3EBTA 4L8PA 3FG1A 1PFPA 1GY5A 2B44A 1IT8A 1OH0A 2YFLB 3KSED 4XDVA 5FW5A 5TGNA 4N6MA 4QPBA 1VQK3 5B0HA 2R4IA 1IVXA 1UI7A 1QALA 3WMDA 1VQO3 3DMCA 1GGRA 3HIGA 2GBXB 3OX9A 2B13A 3WOFB 1OCVA 1DMMA 2CKFB 3T0UA 2E2TA 2CIUA 1G96A 1E3RA 2SBLA 3B4PA 3MG2A 1S723 1VQ73 1K28A 4MEIA 4O2HA 3GWRA 4U13A 2A15A 3F7SA 3MSOA 3HZPA 4KZ1A 3CCS3 1RRLA 3IJEB 3CC43 5KP4A 2CK3H 2XEPA 4MMXB 4EV2A 4R9KA 2HMOB 4N6OB 2F98A 2KRTA 4R80A 1S5AA 1W6YA 2B24B 2GU3A 3G8ZA 4IT7A 2GU1A 3WODG 3X3XA 4KFDA 4RZMA 2W9PA 3EN8A 1GLCF 3CCJ3 1N8QA 1OHPA 3FCSB 2BNGA 3H51A 1CYVA 1LOXA 2P0MA 1Z1SA 3DM8A 1UI8A 4QWTA 2P05A 1ULIB 3DUKA 2XFTA 3SLUA 3N8BA 1DVCA 4PEJA 5CF2A 4KVHA 1EKMA 5CF1A 4WYKA 5LC7A 2OCTA 3PYJA 4WP5A 1M1K4 1UW1A 3B7CA 1VQ83 1QWYA 1OGXA 1TIJA 2RSXA 1IT7A 3FG4A 2RCDA 1W4NA 4FMAA 3WA2X 1CQSA 5EQLA 3CCU3 1YVBI 1NWWA 3LMLA 1D6ZA 4ZM8A 3NYYA 3VF1A 3A76A 3LTAA 1KSIA 4KFFA 4RBNA 2WGOA 4LMIA 2PZVA 2YFJB 3EHCA 1QVF2 5IENA 2JQ5A 3EE1A 3F7XA 1W7CA 5AYSC 2Y74A 1W5ZA 2GBWB 3SXXA 1U8CB 4JRFA 4AKYA 4K1UA 3CCQ3 4X2OA 5ELUA 3LH4A 3X3ZA 1O7PB 1K41A 3S67A 5EVHA 1T5YA 3GZYB 2C11A 3CC73 3X3YA 5JPUA 2Z77A 4HVNA 3NBBA 2W04A 4H61A 5IG5A 2D42A 3F8XA 4O3VA 3HI7A 3VGNA 1JJ22 1VQ53 4WHAA 3JUNA 3V98A 1JB4A 1JB5A 4ORLA 3RGRA 4GB5A 2E2VA 3V92A 5D83A 4G1MB 2INXA 3PS8A 3BNDA 3DZLA 3NUVA 3VSYA 3ROBA 2RFRA 3U97A 1Q814 4LEHA 5D82A 2C10A 4HM8B 4LGQA 4HZBB 5JPPA 5LC6A 4HYZA 4EXRA 5A0OB 1VZZA 1KWIA 1ZO2A 1ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGR A;  1O2F A;  4RNZ A;  2B13 A;  4LXC A;  1AX3 A;  4QP5 A;  1GLC F;  1GPR A;  3CSQ A;  1GLA F;  4BH5 A;  3IT7 A;  3IT5 A;  2GPR A;  3OUR B;  3NYY A;  3SLU A;  1GLB F;  1F3G A;  5KVP A;  4RNY A;  3TUF B;  2F3G A;  2B0P A;  1GLD F;  3UZ0 B;  2B44 A;  2HSI A;  1F3Z A;  2MP0 B;  4ZYB A;  1GLE F;  4QPB A;  4JBW M;  5B0H A;  1QWY A;  2GU1 A; 
#chains in the Genus database with same CATH topology
 2BT3 A;  1O2F A;  3G16 A;  4IIA A;  3UB1 A;  1DMN A;  1MWR A;  1D6U A;  1BSC A;  1F8N A;  5AIF A;  2OTJ 3;  5IF6 A;  5AIG A;  1BNI A;  1LOW A;  3FZW A;  3FH1 A;  1GOU A;  2BIR A;  4I4K A;  7RNT A;  1Q42 A;  3HOH A;  3EX9 A;  1I2F A;  3BNB A;  3GAX A;  1YJ9 3;  1VQL 3;  3G0K A;  1EUI C;  1NB5 I;  8CHO A;  3EBY A;  1AY7 A;  1DET A;  1U5O A;  1MOL A;  1D6Y A;  5M19 A;  1YGW A;  3KSP A;  1ROV A;  3ER7 A;  1Q82 4;  1GLB F;  1NNV A;  1Q9E A;  1RGL A;  2KXG A;  3DY5 A;  3ALA A;  5DRV A;  3ZFZ A;  1HZ1 A;  3FSD A;  3STD A;  1BUQ A;  1UUW B;  2L4V A;  2B0P A;  2CX1 A;  3EC9 A;  2XSH B;  3FG3 A;  3K7C A;  3UZ0 B;  2MF7 A;  2XFS A;  3NX0 A;  1SPU A;  4HZ9 B;  2RGQ A;  5RNT A;  4NRE A;  3B8L A;  1SIH A;  1GLE F;  1I3I A;  1JV2 B;  3NHX A;  2O3O A;  3UL6 A;  1BRK A;  1C7H A;  5HGR A;  3MG3 A;  4XBX A;  5JBS A;  4N6T A;  4N6V 0;  1VQ6 3;  3NM2 A;  4LYL B;  1AX3 A;  1QAF A;  3IMA B;  1FUW A;  1W2B 2;  1FZU A;  3FF2 A;  4HM3 B;  3U1W A;  4EBG A;  3IT5 A;  1UGI A;  5M18 A;  1RCK A;  5BIR A;  5AI1 A;  5BXQ A;  3H3H A;  2OOV C;  3A5E A;  8RNT A;  1MWU A;  1DMQ A;  1B20 A;  1G02 A;  3JUO A;  1RRH A;  1AVL A;  2W03 A;  4HKV B;  4MMZ B;  4DKI A;  6GSP A;  3WDG B;  1TU5 A;  1BVI A;  1HKX A;  3MG1 A;  1O7M B;  3UJM A;  3EF8 A;  1RNB A;  1N9E A;  2HSI A;  3SVA A;  2MP0 B;  1TP6 A;  1GMR A;  1TRQ A;  1JB2 A;  1UUV B;  2IMJ A;  3F8H A;  1IV9 A;  3NQZ A;  4BL3 A;  2H0G A;  4XDW A;  1BIR A;  3X40 A;  1OHO A;  3I55 3;  1DYU A;  1QVG 2;  1RKY A;  1K9M 4;  4HOH A;  1BRH A;  3JUM A;  4J5G A;  3CNX A;  3KZT A;  2P09 A;  2E2U A;  3HK4 A;  2RBI A;  1I2G A;  1TRP A;  1EA2 A;  1RGC A;  3MKI A;  4FCJ A;  1GYB A;  4WWU C;  5CXO A;  1W02 A;  3AGO A;  1YHQ 3;  1GOY A;  3JUP A;  2OQE A;  1YJN 3;  2GEX A;  4EV5 A;  2ZA4 A;  1C54 A;  2CFK A;  2XGN A;  2F3G A;  4WYK B;  3CD6 3;  1VQ4 3;  1BNF A;  1YVS A;  3LTC A;  3BB9 A;  3NBR A;  3OWY A;  3Q90 A;  5G2G A;  4K90 B;  3CCV 3;  1SJW A;  3FGY A;  3CPW 2;  1WMP A;  3OXA A;  2HOH A;  3F9S A;  1EQK A;  3JVC A;  3SOA A;  1IYY A;  1BAO A;  1BAN A;  2BMQ B;  3KFQ C;  1W2Z A;  3X41 A;  1STF I;  1VQM 3;  2YFI B;  3IT7 A;  4K1V A;  7STD A;  3AGN A;  4J9A A;  1MWT A;  1MNL A;  1OPY A;  4JF8 A;  2MC8 A;  2P0X A;  3OW2 2;  2XRX B;  3MWZ A;  1M9G A;  3CCM 3;  3LXU X;  3S27 A;  1JN5 A;  1NU3 A;  4N6L A;  1B21 A;  1FGM A;  1F3Z A;  5IG0 A;  4EC6 A;  3EJV A;  1JZO A;  3OWS A;  1B3S A;  1FYS A;  4J5K A;  1JNQ A;  1ULJ B;  2BHM A;  3AHS A;  2CFD A;  4HM1 B;  3G4S 3;  1SQW A;  2RNT A;  3GZX B;  1IK3 A;  3QK9 A;  2QGU A;  3CSQ A;  1TUH A;  4N3V A;  5ELJ A;  3EQQ B;  5AYR B;  1FGQ A;  1JKG A;  2GSP A;  5I97 A;  2OTL 3;  3CME 3;  1GMQ A;  2HMK B;  5STD A;  3CC2 3;  4O8S A;  1VQN 3;  3LZA A;  2QA4 3;  2KCD A;  2CG1 A;  3UL5 A;  1MGR A;  3CU3 A;  4FMB A;  4L8O A;  2CWT A;  1F3G A;  1R4C A;  1N8R 4;  4KFE A;  5EEO A;  2GXF A;  1HYF A;  3CNM A;  4R4K A;  4IPB A;  1JBS A;  1NJI 4;  1VQ9 3;  3Q3F A;  4X2H A;  3SX1 A;  1B2S A;  4L7K A;  2Z6B A;  4N6N B;  1OGZ A;  3AMO A;  3CXC 2;  2K0M A;  5BVB A;  1A67 A;  1TTO A;  3NQY A;  2ML6 A;  3FLJ A;  1EEJ A;  1WMO A;  3WA3 A;  1W00 A;  5G1K A;  1B2X A;  1GPR A;  1RGK A;  1GLA F;  1BRG A;  5CK6 A;  3M8C A;  1KC8 4;  1GD4 A;  2W6J H;  5IER A;  2XF3 A;  2Y73 A;  3PGB A;  1LOV A;  2WO0 A;  4BL2 A;  1WTH A;  4H3U A;  1X1W A;  3OWU A;  1A2K A;  1TFO A;  4HM6 B;  1Q40 B;  1O7G B;  3KKG A;  1WMN A;  1Q40 A;  1V58 A;  2IUJ A;  2I9W A;  1RN4 A;  4R1K A;  1OAC A;  1RN1 A;  1IU7 A;  1N9J A;  1BOX A;  1MGW A;  5FGO A;  1J2B A;  4BTY A;  3F40 A;  7GSP A;  1PY3 A;  4NHF A;  1RGE A;  2WOH A;  3V99 A;  5IG3 A;  3MHE A;  2F5M A;  1IVW A;  1FUT A;  1WQL B;  2K54 A;  1VQP 3;  1BGS A;  1KD1 4;  4STD A;  4CJN A;  2BMR B;  2F56 A;  4O02 B;  4Q53 A;  3LOY A;  2Z76 A;  1I8V A;  2KAA A;  1UUG B;  3QRD A;  3SED A;  1BNR A;  1LQG C;  2XR8 B;  1UCK A;  2AAE A;  5GSP A;  1IQY A;  1YI2 3;  3X42 A;  1SAR A;  2B1X B;  4HAA A;  1BNS A;  1RHL A;  3FF0 A;  4HM5 B;  1I0V A;  3TDG A;  3CCL 3;  1Q7H A;  4GHO A;  2LYX A;  2CFG A;  2XH9 A;  3PCS A;  1TFK A;  5KP1 A;  1BRN L;  4FCM A;  1NDO B;  1GSP A;  1IQ8 A;  1IV7 A;  4MJD A;  2F99 A;  4ZYB A;  3BU4 A;  3LYG A;  3DXO A;  4HM2 B;  4RNZ A;  1E97 A;  1GY7 A;  5IEP A;  1GD3 A;  3CCE 3;  3SOY A;  1RDS A;  2ZHX B;  3D79 A;  6STD A;  1DVD A;  3KII A;  2CFW A;  1A90 A;  1BSA A;  3BIR A;  3KCH A;  3PXM A;  3E99 A;  4GSP A;  5DRE A;  3WR2 A;  2QIY A;  3MYT A;  4AEQ A;  2HML B;  5IG4 A;  1E3V A;  5AEU B;  1PU4 A;  3G6E 3;  5CLK A;  3F14 A;  4XM4 A;  2PNC A;  3BLZ A;  1B2M A;  2IYJ A;  1QMA A;  3GRD A;  2FXT A;  2CW9 A;  3NXJ A;  1X1X A;  5KVP A;  3Q1C A;  1WNH A;  3TUF B;  3NM7 A;  1A2V A;  4J8T A;  4BIR A;  1W01 A;  5AII A;  4WFO A;  2HMN B;  4JBW M;  2ML5 A;  2P38 A;  1L5G B;  4HM4 B;  1OUN A;  2CWV A;  5KP3 A;  3KE7 A;  2CG0 A;  1TJD A;  1BNG A;  3LT8 A;  1AVK A;  1RGA A;  3PCR A;  3HX8 A;  2OWP A;  4BH5 A;  1AV4 A;  2KF6 A;  4GL6 A;  3D5G A;  3G71 3;  4OK0 A;  1Q7Y 4;  4BTX A;  1OF5 B;  1ZGX A;  3OUR B;  2F5W A;  3DGO A;  4OUQ A;  1YGE A;  3WOE B;  1UCJ A;  3D5I A;  3FKA A;  4XBY A;  3ZG0 A;  1UCL A;  1RGH A;  2O9U X;  2JDI H;  3PZW A;  1BSB A;  1OF5 A;  4NPB A;  1JN5 B;  3JUQ A;  3K5T A;  1LNH A;  1BRJ A;  1LVN A;  2IUK A;  3DH2 A;  1FGO A;  1ISK A;  2BMO B;  2XGL A;  1ZX2 A;  2ZL8 A;  3EN1 B;  1JRQ A;  4CCV A;  3D3L A;  3NBJ A;  1YIT 3;  2GEY A;  1QAK A;  1RMS A;  1NO3 A;  2YX9 A;  1V74 A;  1VQQ A;  2HMJ B;  1OHS A;  1I0X A;  2W9Q A;  1B2U A;  3N54 B;  3NV0 B;  1YJW 3;  1DE3 A;  4LXC A;  1Y4K A;  2BO9 B;  1IVV A;  3GZR A;  4QP5 A;  1JKG B;  4ILF A;  3D9R A;  3DGL A;  3NV0 A;  3BNE A;  1GY6 A;  3S5C A;  4EYC A;  1RJO A;  4EW5 A;  1O7H B;  2OOV A;  3URP A;  3KN4 A;  4HJL B;  4KT3 B;  1RSN A;  3RGA A;  1FGT A;  3T8U A;  2ZDJ A;  1BUJ A;  2Z7A A;  1CEW I;  1ROA A;  2F86 B;  3K63 A;  2FNQ A;  4HM0 B;  1T2H A;  4OVM A;  4RNY A;  2LQV A;  1W6C A;  2W56 B;  4AKZ A;  1YIJ 3;  5AEW B;  1GLD F;  3Q2P A;  3T8N A;  5IEO A;  2W56 A;  3OV4 A;  5IW9 A;  3AMO B;  2Q07 A;  4HBR A;  4CDL A;  4FMD A;  3RNT A;  3DGN A;  3EB8 A;  3UNL A;  3N9H A;  4MMY B;  1US1 A;  3CPO A;  2QEX 3;  3RDE A;  4BTW A;  1MWS A;  1LNI A;  3L0R A;  3MPH A;  1RNT A;  1PYL A;  2CWU A;  1K8A 4;  3ECF A;  3LTD A;  4LSO A;  2GPR A;  1N5H A;  2V1L A;  3K9M C;  3LTB A;  3GZB A;  2M7O A;  1BSD A;  2UX0 A;  3DGM A;  1M90 4;  3O8Y A;  4XBT A;  3S29 A;  2HMM B;  3K0Z A;  4XB5 A;  1M1X B;  2OQE C;  2C4B A;  3B4O A;  1IDP A;  1R4Y A;  2W2C A;  2STD A;  1K73 4;  2F4Y A;  2L1S A;  2D1W A;  3I56 3;  4TX4 A;  1IQX A;  1IVU A;  1T3B A;  2CC3 A;  4LZI A;  5D81 A;  2IA7 A;  2SAR A;  3S28 A;  4N6U A;  1QJG A;  1LXE A;  4FMC A;  1Q86 4;  1NB3 I;  1O7W B;  1EG9 B;  1RN7 A;  3IPT A;  4R9L A;  1CYU A;  3J7Y d;  2XSO B;  4FR9 A;  2WGQ A;  1SII A;  3WHO A;  2CFL A;  3SYU A;  1STD A;  1T2I A;  2WOF A;  5AIH A;  1JBR A;  3LT9 A;  4K61 A;  1AR0 A;  2W0Q A;  3BNC A;  1N5P A;  1FGR A;  2CHC A;  1HU9 A;  4FCZ A;  2KF4 A;  1KQS 2;  1O7N B;  2CH9 A;  3AHW A;  3HII A;  1BNE A;  3I0Y A;  1FA3 A;  1W6G A;  4HM7 B;  1GS3 A;  3CMA 3;  2FGT A;  3CCR 3;  3EBT A;  4L8P A;  3FG1 A;  1PFP A;  1GY5 A;  2B44 A;  1IT8 A;  1OH0 A;  3D4A A;  2YFL B;  3KSE D;  4XDV A;  5FW5 A;  5TGN A;  4N6M A;  1FUS A;  4QPB A;  1VQK 3;  5B0H A;  1IVX A;  1QAL A;  1UI7 A;  2R4I A;  3WMD A;  1X1Y A;  3DMC A;  1GGR A;  3HIG A;  2GBX B;  3OX9 A;  1VQO 3;  2B13 A;  3WOF B;  1OCV A;  4RNT A;  1DMM A;  2CKF B;  2BU4 A;  3T0U A;  2E2T A;  2CIU A;  1G96 A;  1BRI A;  1E3R A;  2SBL A;  1RCL A;  3B4P A;  3MG2 A;  1S72 3;  1VQ7 3;  1K28 A;  4MEI A;  4O2H A;  3GWR A;  4U13 A;  2A15 A;  3F7S A;  3MSO A;  3HZP A;  4KZ1 A;  3CCS 3;  1RRL A;  1X1U A;  3IJE B;  3CC4 3;  5KP4 A;  1UGH I;  2CK3 H;  2H0H A;  2XEP A;  4MMX B;  3ZG5 A;  4EV2 A;  4R9K A;  2HMO B;  4N6O B;  2F98 A;  2KRT A;  4R80 A;  1S5A A;  1W6Y A;  2B24 B;  2GU3 A;  3G8Z A;  2KF5 A;  4IT7 A;  2GU1 A;  3WOD G;  3X3X A;  4KFD A;  4RZM A;  2W9P A;  9RNT A;  3EN8 A;  1GLC F;  3CCJ 3;  1N8Q A;  1OHP A;  2KF3 A;  2BNG A;  3DGY A;  3FCS B;  3GSP A;  1CYV A;  3H51 A;  1LOX A;  1LRA A;  2P0M A;  1Z1S A;  3DM8 A;  1UI8 A;  4QWT A;  1BU4 A;  2P05 A;  6RNT A;  1ULI B;  3DUK A;  2XFT A;  1G0T A;  3SLU A;  3N8B A;  1DVC A;  4PEJ A;  1GMP A;  4BU4 A;  1ZS7 A;  5CF2 A;  2IY2 A;  2R41 A;  4KVH A;  1UCI A;  1EKM A;  5CF1 A;  1B27 A;  4WYK A;  5LC7 A;  2OCT A;  3PYJ A;  1RTU A;  4WP5 A;  1M1K 4;  1LOY A;  1RGF A;  1UW1 A;  3B7C A;  1VQ8 3;  1BSE A;  1QWY A;  1I3F A;  1OGX A;  1GOV A;  1TIJ A;  2RSX A;  1IT7 A;  1FW7 A;  3FG4 A;  1V57 A;  2RCD A;  1UDI I;  1W4N A;  4FMA A;  4CPK A;  3WA2 X;  1B2Z A;  1CQS A;  5EQL A;  3CCU 3;  1YVB I;  1NWW A;  1BNJ A;  3LML A;  1D6Z A;  4ZM8 A;  3NYY A;  3VF1 A;  3A76 A;  3LTA A;  1KSI A;  4KFF A;  4RBN A;  2UUG C;  2WGO A;  1I2E A;  4LMI A;  2PZV A;  2YFJ B;  1I70 A;  3EHC A;  1QVF 2;  5IEN A;  2JQ5 A;  3EE1 A;  2UGI A;  3F7X A;  1W7C A;  5AYS C;  2Y74 A;  5HOH A;  1W5Z A;  1LQM B;  2GBW B;  3SXX A;  1U8C B;  4JRF A;  4AKY A;  4K1U A;  3CCQ 3;  4X2O A;  5ELU A;  3LH4 A;  3X3Z A;  1O7P B;  1K41 A;  3S67 A;  1BRS A;  5EVH A;  1T5Y A;  2J8X B;  2H0I A;  2C11 A;  2CX0 A;  3GZY B;  4I5Q A;  3CC7 3;  3X3Y A;  5JPU A;  2Z77 A;  1YNV X;  2K3D A;  3NBB A;  4HVN A;  2W04 A;  4H61 A;  5IG5 A;  2D42 A;  3F8X A;  4O3V A;  5G1L A;  3HI7 A;  3VGN A;  1JJ2 2;  1VQ5 3;  4WHA A;  1JZD A;  3JUN A;  2AAD A;  1JB4 A;  3V98 A;  1AQZ A;  1JBT A;  1JB5 A;  4ORL A;  3RGR A;  4GB5 A;  2E2V A;  3V92 A;  5D83 A;  4G1M B;  2INX A;  3PS8 A;  3BND A;  3DZL A;  3NUV A;  3VSY A;  3ROB A;  2RFR A;  3U97 A;  1RGG A;  4LEH A;  5D82 A;  1RLS A;  2C10 A;  4HM8 B;  4HZB B;  4LGQ A;  1Q81 4;  5JPP A;  5LC6 A;  5BU4 A;  4HYZ A;  5M1A A;  1CH0 A;  1VZZ A;  1A2P A;  4EXR A;  5A0O B;  1KWI A;  1ZO2 A;  1ASK A; 
#chains in the Genus database with same CATH homology
 2BT3 A;  1O2F A;  3G16 A;  4IIA A;  3UB1 A;  1DMN A;  1D6U A;  2OTJ 3;  1F8N A;  5AIF A;  5IF6 A;  5AIG A;  3FZW A;  3FH1 A;  4I4K A;  1Q42 A;  3EX9 A;  3BNB A;  3GAX A;  1YJ9 3;  1VQL 3;  3G0K A;  1NB5 I;  8CHO A;  3EBY A;  1U5O A;  1MOL A;  1D6Y A;  3KSP A;  1ROV A;  3ER7 A;  1Q82 4;  1GLB F;  3DY5 A;  2KXG A;  5DRV A;  3ALA A;  3FSD A;  3STD A;  1BUQ A;  1UUW B;  2L4V A;  2B0P A;  3EC9 A;  3FG3 A;  2XSH B;  3K7C A;  3UZ0 B;  2MF7 A;  2XFS A;  3NX0 A;  1SPU A;  4HZ9 B;  2RGQ A;  4NRE A;  3B8L A;  1SIH A;  1GLE F;  1JV2 B;  3NHX A;  2O3O A;  3UL6 A;  1C7H A;  5HGR A;  3MG3 A;  4XBX A;  5JBS A;  4N6T A;  4N6V 0;  1VQ6 3;  3NM2 A;  1AX3 A;  1QAF A;  3IMA B;  1FUW A;  1W2B 2;  3FF2 A;  4HM3 B;  3U1W A;  4EBG A;  3IT5 A;  5AI1 A;  5BXQ A;  3H3H A;  2OOV C;  1DMQ A;  3JUO A;  1RRH A;  1AVL A;  2W03 A;  4HKV B;  4MMZ B;  3WDG B;  1TU5 A;  1HKX A;  3MG1 A;  1O7M B;  3UJM A;  3EF8 A;  1N9E A;  2HSI A;  3SVA A;  2MP0 B;  1TP6 A;  1UUV B;  3F8H A;  1JB2 A;  2IMJ A;  1IV9 A;  3NQZ A;  4XDW A;  3X40 A;  1OHO A;  3I55 3;  1DYU A;  1QVG 2;  1RKY A;  1K9M 4;  3JUM A;  3CNX A;  3KZT A;  2P09 A;  2E2U A;  3HK4 A;  1EA2 A;  3MKI A;  4FCJ A;  1GYB A;  4WWU C;  5CXO A;  1W02 A;  1YHQ 3;  3JUP A;  2OQE A;  1YJN 3;  2GEX A;  4EV5 A;  2CFK A;  2XGN A;  2F3G A;  4WYK B;  3CD6 3;  1VQ4 3;  3LTC A;  3BB9 A;  3NBR A;  3OWY A;  3Q90 A;  5G2G A;  4K90 B;  3CCV 3;  1SJW A;  3FGY A;  3CPW 2;  1WMP A;  3OXA A;  3F9S A;  1EQK A;  3JVC A;  3SOA A;  2BMQ B;  3KFQ C;  1W2Z A;  3X41 A;  1STF I;  1VQM 3;  2YFI B;  3IT7 A;  4K1V A;  7STD A;  4J9A A;  1OPY A;  1MNL A;  4JF8 A;  2MC8 A;  2P0X A;  3OW2 2;  2XRX B;  3MWZ A;  1M9G A;  3CCM 3;  3LXU X;  3S27 A;  1JN5 A;  1NU3 A;  4N6L A;  1FGM A;  1F3Z A;  5IG0 A;  4EC6 A;  3EJV A;  3OWS A;  1JNQ A;  1ULJ B;  2BHM A;  2CFD A;  4HM1 B;  3G4S 3;  1SQW A;  3GZX B;  1IK3 A;  3QK9 A;  2QGU A;  3CSQ A;  1TUH A;  4N3V A;  5ELJ A;  3EQQ B;  5AYR B;  1FGQ A;  1JKG A;  5I97 A;  2OTL 3;  3CME 3;  2HMK B;  5STD A;  3CC2 3;  4O8S A;  1VQN 3;  3LZA A;  2QA4 3;  2KCD A;  2CG1 A;  3UL5 A;  3CU3 A;  4FMB A;  4L8O A;  2CWT A;  1F3G A;  1R4C A;  1N8R 4;  4KFE A;  5EEO A;  2GXF A;  3CNM A;  4R4K A;  4IPB A;  1VQ9 3;  1NJI 4;  4X2H A;  3SX1 A;  4L7K A;  2Z6B A;  4N6N B;  1OGZ A;  3AMO A;  3CXC 2;  2K0M A;  5BVB A;  1A67 A;  3NQY A;  2ML6 A;  3FLJ A;  1WMO A;  3WA3 A;  1W00 A;  1GPR A;  1GLA F;  5CK6 A;  1KC8 4;  3M8C A;  1GD4 A;  2W6J H;  5IER A;  2XF3 A;  2Y73 A;  3PGB A;  2WO0 A;  1WTH A;  4H3U A;  3OWU A;  1A2K A;  1TFO A;  4HM6 B;  1Q40 B;  1O7G B;  3KKG A;  1WMN A;  1Q40 A;  2IUJ A;  2I9W A;  4R1K A;  1OAC A;  1IU7 A;  1N9J A;  5FGO A;  1J2B A;  4BTY A;  3F40 A;  4NHF A;  2WOH A;  3V99 A;  5IG3 A;  3MHE A;  1IVW A;  1WQL B;  2K54 A;  1VQP 3;  1KD1 4;  4STD A;  2BMR B;  4Q53 A;  4O02 B;  3LOY A;  2Z76 A;  3SED A;  3QRD A;  2XR8 B;  1IQY A;  1YI2 3;  3X42 A;  2B1X B;  3FF0 A;  4HM5 B;  3TDG A;  3CCL 3;  2LYX A;  2CFG A;  2XH9 A;  3PCS A;  1TFK A;  5KP1 A;  4FCM A;  1NDO B;  1IQ8 A;  1IV7 A;  4MJD A;  2F99 A;  4ZYB A;  3LYG A;  3DXO A;  4HM2 B;  4RNZ A;  1E97 A;  1GY7 A;  5IEP A;  1GD3 A;  3CCE 3;  3SOY A;  6STD A;  1DVD A;  3KII A;  2CFW A;  1A90 A;  3PXM A;  3E99 A;  5DRE A;  2QIY A;  3MYT A;  4AEQ A;  2HML B;  5IG4 A;  1E3V A;  5AEU B;  1PU4 A;  3G6E 3;  5CLK A;  3F14 A;  4XM4 A;  2PNC A;  3BLZ A;  1QMA A;  3GRD A;  2FXT A;  2CW9 A;  3NXJ A;  3Q1C A;  5KVP A;  1WNH A;  3TUF B;  3NM7 A;  1A2V A;  4J8T A;  1W01 A;  5AII A;  4WFO A;  2HMN B;  4JBW M;  2ML5 A;  2P38 A;  1L5G B;  4HM4 B;  2CWV A;  1OUN A;  5KP3 A;  3KE7 A;  2CG0 A;  3LT8 A;  1AVK A;  3PCR A;  3HX8 A;  2OWP A;  4BH5 A;  1AV4 A;  4GL6 A;  3G71 3;  4OK0 A;  1Q7Y 4;  4BTX A;  1OF5 B;  3OUR B;  3DGO A;  4OUQ A;  1YGE A;  3WOE B;  3FKA A;  4XBY A;  2O9U X;  2JDI H;  3PZW A;  1OF5 A;  1JN5 B;  3JUQ A;  3K5T A;  1LNH A;  1LVN A;  2IUK A;  1ISK A;  1FGO A;  2BMO B;  2XGL A;  1ZX2 A;  2ZL8 A;  3EN1 B;  1JRQ A;  4CCV A;  3D3L A;  3NBJ A;  1YIT 3;  2GEY A;  1QAK A;  1NO3 A;  2YX9 A;  1V74 A;  2HMJ B;  1OHS A;  2W9Q A;  3N54 B;  3NV0 B;  1YJW 3;  4LXC A;  1Y4K A;  2BO9 B;  1IVV A;  3GZR A;  4QP5 A;  1JKG B;  3D9R A;  3DGL A;  3NV0 A;  3BNE A;  1GY6 A;  3S5C A;  4EYC A;  1RJO A;  1O7H B;  2OOV A;  3KN4 A;  4HJL B;  3RGA A;  1FGT A;  3T8U A;  2ZDJ A;  2Z7A A;  1CEW I;  1ROA A;  2F86 B;  3K63 A;  2FNQ A;  4HM0 B;  4OVM A;  4RNY A;  2LQV A;  1W6C A;  2W56 B;  4AKZ A;  1YIJ 3;  5AEW B;  1GLD F;  3Q2P A;  3T8N A;  5IEO A;  2W56 A;  3OV4 A;  5IW9 A;  3AMO B;  2Q07 A;  4HBR A;  4CDL A;  4FMD A;  3DGN A;  3EB8 A;  3UNL A;  3N9H A;  4MMY B;  1US1 A;  3CPO A;  2QEX 3;  3RDE A;  4BTW A;  3L0R A;  3MPH A;  2CWU A;  1K8A 4;  3ECF A;  3LTD A;  4LSO A;  2GPR A;  1N5H A;  2V1L A;  3K9M C;  3LTB A;  3GZB A;  2M7O A;  2UX0 A;  3DGM A;  1M90 4;  3O8Y A;  4XBT A;  3S29 A;  2HMM B;  3K0Z A;  4XB5 A;  1M1X B;  2OQE C;  3B4O A;  1IDP A;  2W2C A;  2STD A;  1K73 4;  2D1W A;  3I56 3;  4TX4 A;  1IQX A;  1IVU A;  2CC3 A;  4LZI A;  5D81 A;  2IA7 A;  3S28 A;  4N6U A;  1QJG A;  1LXE A;  4FMC A;  1Q86 4;  1NB3 I;  1EG9 B;  1O7W B;  1RN7 A;  3IPT A;  4R9L A;  1CYU A;  3J7Y d;  2XSO B;  4FR9 A;  2WGQ A;  1SII A;  2CFL A;  1STD A;  2WOF A;  5AIH A;  3LT9 A;  4K61 A;  1AR0 A;  2W0Q A;  3BNC A;  1N5P A;  1FGR A;  2CHC A;  1HU9 A;  4FCZ A;  1KQS 2;  1O7N B;  2CH9 A;  3HII A;  3I0Y A;  1FA3 A;  1W6G A;  4HM7 B;  1GS3 A;  3CMA 3;  2FGT A;  3CCR 3;  3EBT A;  4L8P A;  3FG1 A;  1PFP A;  1GY5 A;  2B44 A;  1IT8 A;  1OH0 A;  2YFL B;  3KSE D;  4XDV A;  5FW5 A;  5TGN A;  4N6M A;  4QPB A;  1VQK 3;  5B0H A;  2R4I A;  1IVX A;  1UI7 A;  1QAL A;  3WMD A;  1VQO 3;  3DMC A;  1GGR A;  3HIG A;  2GBX B;  3OX9 A;  2B13 A;  3WOF B;  1OCV A;  1DMM A;  2CKF B;  3T0U A;  2E2T A;  2CIU A;  1G96 A;  1E3R A;  2SBL A;  3B4P A;  3MG2 A;  1S72 3;  1VQ7 3;  1K28 A;  4MEI A;  4O2H A;  3GWR A;  4U13 A;  2A15 A;  3F7S A;  3MSO A;  3HZP A;  4KZ1 A;  3CCS 3;  1RRL A;  3IJE B;  3CC4 3;  5KP4 A;  2CK3 H;  2XEP A;  4MMX B;  4EV2 A;  4R9K A;  2HMO B;  4N6O B;  2F98 A;  2KRT A;  4R80 A;  1S5A A;  1W6Y A;  2B24 B;  2GU3 A;  3G8Z A;  4IT7 A;  2GU1 A;  3WOD G;  3X3X A;  4KFD A;  4RZM A;  2W9P A;  3EN8 A;  1GLC F;  3CCJ 3;  1N8Q A;  1OHP A;  3FCS B;  2BNG A;  3H51 A;  1CYV A;  1LOX A;  2P0M A;  1Z1S A;  3DM8 A;  1UI8 A;  4QWT A;  2P05 A;  1ULI B;  3DUK A;  2XFT A;  3SLU A;  3N8B A;  1DVC A;  4PEJ A;  5CF2 A;  4KVH A;  1EKM A;  5CF1 A;  4WYK A;  5LC7 A;  2OCT A;  3PYJ A;  4WP5 A;  1M1K 4;  1UW1 A;  3B7C A;  1VQ8 3;  1QWY A;  1OGX A;  1TIJ A;  2RSX A;  1IT7 A;  3FG4 A;  2RCD A;  1W4N A;  4FMA A;  3WA2 X;  1CQS A;  5EQL A;  3CCU 3;  1YVB I;  1NWW A;  3LML A;  1D6Z A;  4ZM8 A;  3NYY A;  3VF1 A;  3A76 A;  3LTA A;  1KSI A;  4KFF A;  4RBN A;  2WGO A;  4LMI A;  2PZV A;  2YFJ B;  3EHC A;  1QVF 2;  5IEN A;  2JQ5 A;  3EE1 A;  3F7X A;  1W7C A;  5AYS C;  2Y74 A;  1W5Z A;  2GBW B;  3SXX A;  1U8C B;  4JRF A;  4AKY A;  4K1U A;  3CCQ 3;  4X2O A;  5ELU A;  3LH4 A;  3X3Z A;  1O7P B;  1K41 A;  3S67 A;  5EVH A;  1T5Y A;  3GZY B;  2C11 A;  3CC7 3;  3X3Y A;  5JPU A;  2Z77 A;  4HVN A;  3NBB A;  2W04 A;  4H61 A;  5IG5 A;  2D42 A;  3F8X A;  4O3V A;  3HI7 A;  3VGN A;  1JJ2 2;  1VQ5 3;  4WHA A;  3JUN A;  3V98 A;  1JB4 A;  1JB5 A;  4ORL A;  3RGR A;  4GB5 A;  2E2V A;  3V92 A;  5D83 A;  4G1M B;  2INX A;  3PS8 A;  3BND A;  3DZL A;  3NUV A;  3VSY A;  3ROB A;  2RFR A;  3U97 A;  1Q81 4;  4LEH A;  5D82 A;  2C10 A;  4HM8 B;  4LGQ A;  4HZB B;  5JPP A;  5LC6 A;  4HYZ A;  4EXR A;  5A0O B;  1VZZ A;  1KWI A;  1ZO2 A;  1ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...