4RNZA

Structure of helicobacter pylori csd3 from the hexagonal crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
369
structure length
359
Chain Sequence
MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Conserved hypothetical secreted protein
total genus 100
structure length 359
sequence length 369
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnzA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnzA02
2GPRA 1GPRA 3OURB 4LXCA 1QWYA 3TUFB 4QP5A 3UZ0B 3IT5A 3SLUA 3NYYA 4BH5A 1GGRA 5KVPA 1O2FA 1GLEF 3CSQA 2B44A 2HSIA 2B0PA 1AX3A 2GU1A 2MP0B 1F3ZA 4RNZA 1GLAF 5B0HA 1GLCF 1GLBF 4QPBA 4ZYBA 1F3GA 4RNYA 4JBWM 1GLDF 2B13A 3IT7A 2F3GA
chains in the Genus database with same CATH superfamily
4BTXA 5JPPA 1JNQA 3S5CA 5CF2A 1X1XA 2CW9A 5EQLA 1YHQ3 4HM2B 1N8R4 1KQS2 4R1KA 3SVAA 3EE1A 2BMRB 2CG1A 4N6LA 3X41A 4BH5A 1N5HA 1RGKA 2GXFA 2L4VA 3N8BA 2OQEC 4LGQA 4MJDA 4NPBA 3D9RA 5LC7A 1B2XA 1PU4A 3FGYA 5I97A 1K41A 4J5KA 1ISKA 3MG2A 4QWTA 5D83A 1VQ93 1EG9B 3HZPA 3LTDA 5D81A 4N6OB 1WMPA 1GY7A 2STDA 1RGGA 1UI8A 2FGTA 4HYZA 5IG0A 1BANA 4O3VA 1LQGC 2KF5A 2CFDA 5CXOA 5AEWB 2CX0A 3O8YA 1IVWA 2D1WA 3HK4A 5A0OB 4O2HA 4L8PA 3MYTA 1BSCA 1ZGXA 2AADA 3BB9A 3VGNA 1VQP3 1I8VA 1Q7Y4 3CPW2 4I5QA 1GSPA 4WFOA 2F5WA 5JPUA 2IUJA 1A2PA 1C7HA 1O7HB 1AVLA 2Y74A 2ZHXB 1V58A 3LT9A 2SBLA 3EC9A 1UGIA 4HM4B 3CC43 4FR9A 1YI23 3FF2A 2BT3A 2M7OA 6GSPA 3CSQA 2B44A 2E2TA 5G2GA 4KFEA 1G96A 1W4NA 1IT8A 1LOXA 1VQ63 3I0YA 3J7Yd 3NQZA 1NWWA 7RNTA 4KT3B 5FW5A 4HZ9B 1JJ22 2K3DA 3EBTA 1B27A 3EJVA 4LZIA 4RNZA 3G4S3 5AEUB 8RNTA 5IEOA 3KZTA 5BVBA 2WO0A 3DGYA 3KKGA 1JB5A 2ML5A 1SIHA 2XR8B 4N3VA 4KVHA 4HM3B 2OTL3 1LRAA 3NUVA 3X42A 1B21A 5IERA 1JKGA 2CFWA 4L8OA 3OX9A 2BMOB 1IYYA 1FGTA 1IQ8A 1DE3A 2B24B 2XFSA 3PZWA 1EKMA 3RGRA 4WP5A 5BXQA 1RGHA 1I0VA 1UUWB 3PYJA 1SIIA 3VSYA 1NJI4 4KZ1A 6STDA 1IDPA 4HM1B 2CWUA 9RNTA 1VQ43 4I4KA 5RNTA 1GYBA 2F98A 3DH2A 2GU1A 4NHFA 1BAOA 3OXAA 2JDIH 1QVF2 1F3GA 1YGEA 1VQO3 1TP6A 1HU9A 1EQKA 1RGEA 1V74A 3IT7A 3G713 1BSEA 2GBXB 3MSOA 4XB5A 5AYRB 1GPRA 2YFJB 3SEDA 3F7SA 1JRQA 1D6YA 3MPHA 1UI7A 1Q864 3Q1CA 1GD3A 2CFGA 2WGQA 3QRDA 4HKVB 1RLSA 4CJNA 2CWVA 1YVBI 3D5IA 4X2HA 2KF3A 4BU4A 1T2IA 3BLZA 1PY3A 3UL6A 3IPTA 4TX4A 1OHSA 1B20A 2I9WA 3D4AA 3Q90A 3ZG0A 2OTJ3 1JV2B 3OWSA 2HMNB 3AMOA 4K1UA 2IMJA 3K0ZA 4L7KA 2KRTA 1AVKA 1Q9EA 1GMRA 4J9AA 1FUWA 1R4YA 4HM8B 1SQWA 1GLBF 4RNYA 3DXOA 1MWTA 2CKFB 1A2VA 3TDGA 5IF6A 1Q40A 3X3YA 3SXXA 1IU7A 5AIGA 2BU4A 2KCDA 3EN1B 1YIT3 2PZVA 5EVHA 1Q824 2QIYA 3HI7A 2ZL8A 1VQ83 1FGQA 2XRXB 1FA3A 3PS8A 1UCLA 2W04A 3PCSA 3U97A 1YIJ3 4JRFA 3RDEA 4HM7B 2BIRA 1JBSA 3UL5A 3KSPA 2HMKB 1Y4KA 2UX0A 3E99A 1AX3A 3SYUA 2Z6BA 1RGFA 1W5ZA 3WODG 3NV0B 4J5GA 1TFOA 3D3LA 1RMSA 4JF8A 1STDA 1DMQA 3BNDA 4AEQA 1MGWA 1GS3A 1BNSA 2Z7AA 2K0MA 3LMLA 3PXMA 1E97A 1RRLA 1DVCA 1DYUA 5BU4A 1RCKA 3K63A 1MOLA 1BNFA 4WYKA 4QP5A 1JB4A 1BRKA 1AV4A 3I553 1KSIA 2YFLB 4O02B 4XBTA 2YFIB 3GZYB 2ZDJA 3AGNA 3CCR3 1DVDA 4HM6B 1UGHI 1J2BA 3FSDA 4XBXA 5BIRA 4MEIA 3UB1A 1S5AA 1N5PA 4G1MB 4EV5A 1BUQA 1MWRA 4BTYA 4N6MA 1LOVA 1BU4A 2A15A 3B7CA 1GMQA 3NM7A 4N6UA 2C4BA 2O3OA 3ER7A 1QVG2 4AKZA 2RSXA 1AR0A 1EA2A 4R80A 2CHCA 3EB8A 3N54B 1PYLA 1IVUA 3FKAA 1FGRA 3JUNA 1N8QA 1TIJA 2XSOB 3STDA 3FG1A 3FLJA 1I0XA 2RCDA 3MG3A 3K5TA 4KFDA 2MC8A 3GZXB 2W2CA 1GOVA 4ORLA 2W9PA 5IG5A 1M9GA 3V99A 1IQYA 1RNTA 3DMCA 2SARA 1BNEA 1BRJA 2W9QA 1Q7HA 2MF7A 3G16A 5CF1A 5G1KA 1Q42A 3GZBA 4MMXB 1GLEF 2H0IA 4HJLB 1STFI 3ZG5A 3CCV3 4CDLA 1BRGA 2R4IA 4CCVA 2F5MA 3BNBA 1IVXA 2MP0B 1JZOA 3PGBA 4FMDA 1LOWA 2GEXA 3U1WA 1DETA 4J8TA 3UJMA 4CPKA 4R4KA 2D42A 4QPBA 1D6ZA 2P38A 4FMAA 5DRVA 3HIIA 1RJOA 3FCSB 1GLDF 2B13A 2XH9A 4BL2A 1JN5B 1OGZA 3FZWA 4HZBB 4EBGA 1A90A 2CH9A 1GY6A 5M18A 3NXJA 4LXCA 2WOFA 3CCJ3 2UGIA 3BNEA 4XM4A 5KP1A 1RN1A 1CH0A 2KF4A 1K8A4 2KF6A 3CD63 5AYSC 4IIAA 3S28A 1OHPA 3V98A 1X1YA 3G0KA 2W56A 3KIIA 4GHOA 2Y73A 4LSOA 3X3ZA 3CCS3 1SJWA 1JN5A 2XEPA 3FG3A 1VQ53 1QAFA 1UUGB 3WHOA 3H3HA 3Q3FA 2P05A 3NX0A 2HMOB 2WOHA 3T8UA 1ZX2A 1SPUA 3CC23 3GWRA 1E3RA 1GY5A 2P0MA 1NNVA 4OVMA 2GU3A 5IENA 1VQN3 1SARA 2GPRA 4AKYA 2L1SA 1RSNA 2XGNA 1QWYA 2J8XB 3WOEB 2C10A 2W03A 3OWYA 3URPA 1M1XB 1W02A 5CK6A 3A5EA 1O7MB 1RGLA 1US1A 3VF1A 7STDA 1IVVA 1BSBA 3FF0A 1I70A 2IYJA 4R9KA 1O2FA 1FZUA 2W6JH 1O7GB 3D5GA 3NQYA 5CLKA 2BMQB 1W6CA 1VZZA 2HSIA 1I3IA 1YGWA 2O9UX 4HAAA 4N6TA 3DY5A 1ULIB 1BVIA 1X1UA 1N9JA 4RZMA 1GLAF 5B0HA 1RHLA 1RTUA 4EYCA 1GLCF 3AGOA 2HMLB 5LC6A 1QJGA 3HX8A 3DZLA 3JUOA 4OK0A 1OH0A 1GMPA 3DGOA 1EEJA 3K9MC 1I2FA 4PEJA 3CC73 1R4CA 1BRHA 4XDVA 3SOAA 1CQSA 2Q07A 2LQVA 1MWSA 2RGQA 4ILFA 3LOYA 5KP4A 1K734 1UCIA 1G0TA 1W2B2 1RN7A 3AMOB 1JB2A 1D6UA 5KP3A 2QA43 1QALA 3X40A 1G02A 4GL6A 4HVNA 5TGNA 4ZM8A 1UW1A 2BHMA 3N9HA 1ASKA 1ROVA 3ALAA 1UCJA 1BRSA 1I2EA 2CWTA 1W01A 3G8ZA 4KFFA 1T2HA 1ZO2A 2XGLA 2PNCA 4XBYA 3RGAA 5DREA 3NHXA 3M8CA 1OHOA 3LT8A 3HOHA 1CYVA 1T3BA 3DUKA 1VQQA 3SX1A 3CCM3 3Q2PA 1WMOA 3CCU3 3HIGA 2H0GA 2F3GA 3OW22 1LNIA 1TTOA 2XF3A 2XFTA 3NBRA 2HMJB 3TUFB 1LOYA 1IV9A 1RN4A 3NM2A 3UNLA 1C54A 5EEOA 8CHOA 2WGOA 3KN4A 3QK9A 5HOHA 1OF5A 1NO3A 1BNRA 3DM8A 2RFRA 1NB3I 1AQZA 3CPOA 3SOYA 3NYYA 3JUMA 5KVPA 1YJW3 2OOVA 3LH4A 1UUVB 1S723 3CME3 1Q40B 1M1K4 1LQMB 2B0PA 1FUTA 4FCJA 3BNCA 1YVSA 1RNBA 2KAAA 3F8XA 2F4YA 1O7WB 1WQLB 3A76A 4O8SA 2B1XB 2OQEA 4JBWM 3MKIA 1I2GA 4FCMA 4FCZA 5AIIA 1A2KA 2V1LA 3PCRA 1UCKA 2P0XA 3DGLA 1VQM3 2OOVC 1QMAA 3KFQC 1BSDA 3ROBA 1BRIA 1F8NA 1RGCA 3B4PA 1B2UA 5AI1A 3EHCA 1UDII 3I563 1LXEA 2CFLA 3NV0A 1IT7A 3CU3A 3FH1A 3EBYA 4HBRA 2CG0A 1VQL3 3OWUA 2Z76A 1W00A 5G1LA 1TU5A 1JBRA 1CYUA 3ECFA 4WYKB 5ELUA 4EV2A 3CCL3 1OPYA 1NU3A 1IK3A 4N6NB 1O7NB 3AHSA 3F40A 2E2VA 5IEPA 4K61A 4RBNA 3G6E3 1MWUA 3H51A 2ZA4A 3LZAA 1YJN3 1VQ73 1T5YA 3KCHA 1ROAA 2GBWB 3FG4A 2QGUA 1OCVA 4FMBA 2CFKA 3EX9A 3MG1A 1M904 4NREA 3X3XA 2IUKA 4IT7A 6RNTA 1B2MA 3V92A 1V57A 1JZDA 2F86B 4MMZB 1WMNA 3S29A 1BOXA 1WNHA 2FNQA 2BO9B 3UZ0B 1OUNA 3IT5A 3D79A 5AIFA 3SLUA 1QAKA 5IG4A 4X2OA 1TUHA 3B4OA 4H61A 1BRNL 3RNTA 1U5OA 1RKYA 3B8LA 2INXA 3BIRA 1RDSA 5JBSA 3MWZA 3WA3A 3GRDA 1HZ1A 3T8NA 1W6GA 2KXGA 3AHWA 4ZYBA 1B2SA 3JUPA 1DMMA 1RCLA 2OWPA 1OACA 3WOFB 1BNJA 1CEWI 4BIRA 2YX9A 4GSPA 1WTHA 1Q814 1B3SA 1A67A 3OURB 4EXRA 4K90B 1TRPA 1BNGA 4U13A 5M1AA 3K7CA 4H3UA 3ZFZA 5HGRA 3EN8A 4BL3A 1K28A 4FMCA 4LEHA 4OUQA 1AY7A 3JVCA 4MMYB 1IV7A 1GD4A 3DGNA 5STDA 3EF8A 1ZS7A 1PFPA 4HM5B 3CCQ3 2GEYA 4N6V0 3T0UA 3WDGB 1FGOA 3OV4A 1FUSA 3S27A 3F8HA 1ULJB 1IQXA 2BNGA 3LYGA 1L5GB 2LYXA 1BNIA 1RRHA 3IMAB 1I3FA 3WA2X 2K54A 3NBJA 5IG3A 2W56B 2QEX3 1NDOB 1HKXA 5AIHA 5D82A 1K9M4 1X1WA 3F7XA 1JBTA 1YNVX 3IJEB 4R9LA 3EQQB 1U8CB 3F14A 3F9SA 3NBBA 4LYLB 1N9EA 2OCTA 3BU4A 4WHAA 2CK3H 2GSPA 3LXUX 1Z1SA 3S67A 4STDA 2H0HA 4RNTA 2HMMB 1TRQA 3GZRA 1NB5I 1FGMA 4BTWA 1KWIA 1W6YA 1VQK3 2FXTA 3CXC2 3JUQA 2HOHA 3CNMA 5FGOA 1KC84 7GSPA 2F99A 3L0RA 2RNTA 1GOUA 1BIRA 1F3ZA 4EC6A 2JQ5A 2W0QA 3KSED 1OF5B 2AAEA 3LTAA 1MNLA 2XSHB 5ELJA 1B2ZA 3MHEA 4Q53A 2IA7A 4HM0B 1HYFA 1OGXA 5GSPA 1TFKA 2ML6A 1GOYA 4WWUC 5IW9A 2RBIA 1EUIC 1LVNA 1MGRA 3LTBA 3GAXA 2R41A 3GSPA 1W2ZA 1BSAA 2P09A 4IPBA 1KD14 2Z77A 2F56A 3WMDA 1GGRA 1W7CA 2E2UA 2CX1A 4DKIA 4EW5A 1FW7A 3CNXA 3KE7A 2C11A 3LTCA 4XDWA 1LNHA 2CC3A 2UUGC 3DGMA 1FYSA 1E3VA 1DMNA 2CIUA 5M19A 1JKGB 1TJDA 3CMA3 4GB5A 4HOHA 3WR2A 1YJ93 4K1VA 1RGAA 1BUJA 1O7PB 1BGSA 4LMIA 3CCE3 2IY2A
chains in the Genus database with same CATH topology
4BTXA 5JPPA 1JNQA 3S5CA 5CF2A 2CW9A 5EQLA 1YHQ3 4HM2B 1N8R4 1KQS2 4R1KA 3SVAA 3EE1A 2BMRB 2CG1A 4N6LA 3X41A 4BH5A 1N5HA 2GXFA 2L4VA 3N8BA 4LGQA 2OQEC 4MJDA 1PU4A 1ISKA 3D9RA 5LC7A 3FGYA 5I97A 1K41A 3MG2A 4QWTA 5D83A 1VQ93 1EG9B 3HZPA 3LTDA 5D81A 4N6OB 1WMPA 1GY7A 2STDA 1UI8A 2FGTA 4HYZA 5IG0A 4O3VA 5CXOA 2CFDA 5AEWB 3O8YA 1IVWA 2D1WA 3HK4A 5A0OB 4O2HA 4L8PA 3MYTA 1VQP3 3BB9A 3VGNA 1Q7Y4 3CPW2 4WFOA 5JPUA 2IUJA 1O7HB 1C7HA 1AVLA 2Y74A 3LT9A 2SBLA 3EC9A 4HM4B 3CC43 4FR9A 1YI23 3FF2A 2BT3A 2M7OA 3CSQA 2B44A 2E2TA 5G2GA 4KFEA 1G96A 1W4NA 1IT8A 1LOXA 1VQ63 3I0YA 3J7Yd 3NQZA 1NWWA 1JJ22 5FW5A 4HZ9B 3EBTA 4LZIA 3EJVA 4RNZA 3G4S3 5AEUB 5IEOA 3KZTA 5BVBA 2WO0A 3KKGA 1JB5A 2ML5A 1SIHA 2XR8B 4N3VA 4KVHA 4HM3B 2OTL3 3NUVA 3X42A 5IERA 1JKGA 2CFWA 4L8OA 3OX9A 2BMOB 1FGTA 1IQ8A 2B24B 2XFSA 3PZWA 1EKMA 3RGRA 4WP5A 5BXQA 3PYJA 1UUWB 3VSYA 1SIIA 1NJI4 4KZ1A 6STDA 1IDPA 4HM1B 2CWUA 1VQ43 4I4KA 1GYBA 2F98A 2GU1A 4NHFA 3OXAA 2JDIH 1QVF2 1F3GA 1YGEA 1VQO3 1TP6A 1HU9A 1EQKA 1V74A 3IT7A 3G713 2GBXB 3MSOA 4XB5A 5AYRB 1GPRA 2YFJB 3SEDA 3F7SA 1JRQA 1D6YA 3MPHA 1UI7A 1Q864 3Q1CA 1GD3A 2CFGA 2WGQA 3QRDA 4HKVB 2CWVA 1YVBI 4X2HA 3BLZA 3UL6A 3IPTA 4TX4A 1OHSA 2I9WA 3Q90A 2OTJ3 1JV2B 3OWSA 2HMNB 3AMOA 4K1UA 2IMJA 3K0ZA 4L7KA 2KRTA 1AVKA 4J9AA 1FUWA 4HM8B 1SQWA 1GLBF 4RNYA 3DXOA 2CKFB 1A2VA 3TDGA 5IF6A 1Q40A 3X3YA 3SXXA 1IU7A 5AIGA 2KCDA 3EN1B 1YIT3 2PZVA 5EVHA 1Q824 2QIYA 3HI7A 2ZL8A 1VQ83 1FGQA 2XRXB 1FA3A 3PS8A 1YIJ3 2W04A 3PCSA 3U97A 4JRFA 3RDEA 4HM7B 3UL5A 3KSPA 2HMKB 1Y4KA 2UX0A 3E99A 1AX3A 2Z6BA 1W5ZA 3WODG 3NV0B 1TFOA 3D3LA 4JF8A 1STDA 1DMQA 3BNDA 4AEQA 1GS3A 2Z7AA 2K0MA 3LMLA 3PXMA 1E97A 1RRLA 1DVCA 1DYUA 3K63A 1MOLA 4WYKA 4QP5A 1JB4A 1AV4A 3I553 1KSIA 2YFLB 4O02B 4XBTA 2YFIB 3GZYB 2ZDJA 3CCR3 1DVDA 4HM6B 1J2BA 3FSDA 4XBXA 4MEIA 3UB1A 1S5AA 1N5PA 4G1MB 4EV5A 1BUQA 4BTYA 4N6MA 2A15A 3B7CA 3NM7A 4N6UA 2O3OA 3ER7A 1QVG2 4AKZA 2RSXA 1AR0A 1EA2A 4R80A 2CHCA 3EB8A 3N54B 3JUNA 1IVUA 3FKAA 1FGRA 4FCMA 1N8QA 1TIJA 2XSOB 3STDA 3FG1A 3FLJA 2RCDA 3MG3A 3K5TA 4KFDA 2MC8A 3GZXB 2W2CA 4ORLA 2W9PA 5IG5A 1M9GA 3V99A 1IQYA 3DMCA 2W9QA 2MF7A 3G16A 5CF1A 1Q42A 3GZBA 4MMXB 1GLEF 4HJLB 3CCV3 1STFI 4CDLA 2R4IA 4CCVA 3BNBA 1IVXA 2MP0B 3PGBA 4FMDA 2GEXA 3U1WA 3UJMA 4J8TA 4R4KA 2D42A 4QPBA 1D6ZA 2P38A 4FMAA 5DRVA 3HIIA 1RJOA 3FCSB 1GLDF 2B13A 2XH9A 1JN5B 1OGZA 3FZWA 4HZBB 4EBGA 1A90A 2CH9A 1GY6A 3NXJA 4LXCA 2WOFA 3CCJ3 3BNEA 4XM4A 5KP1A 1K8A4 3CD63 5AYSC 4IIAA 3S28A 1OHPA 3V98A 3G0KA 4LSOA 2W56A 3KIIA 3X3ZA 2Y73A 3CCS3 1SJWA 1JN5A 2XEPA 3FG3A 1VQ53 1QAFA 3H3HA 2P05A 3NX0A 2HMOB 2WOHA 3T8UA 1ZX2A 1SPUA 3CC23 3GWRA 1E3RA 1GY5A 2P0MA 4OVMA 2GU3A 5IENA 1VQN3 2GPRA 4AKYA 2XGNA 1QWYA 3WOEB 2C10A 2W03A 3OWYA 1M1XB 1W02A 5CK6A 3VF1A 1O7MB 1US1A 7STDA 1IVVA 3FF0A 4R9KA 1O2FA 2W6JH 1O7GB 3NQYA 5CLKA 2BMQB 1W6CA 1VZZA 2HSIA 4N6TA 2O9UX 3DY5A 1ULIB 1N9JA 4RZMA 1GLAF 5B0HA 4EYCA 1GLCF 5LC6A 2HMLB 1QJGA 3HX8A 3DZLA 3JUOA 4OK0A 1OH0A 3DGOA 3K9MC 4PEJA 3CC73 1R4CA 4XDVA 3SOAA 1CQSA 2Q07A 2LQVA 2RGQA 3LOYA 5KP4A 1K734 1W2B2 1RN7A 3AMOB 1JB2A 1D6UA 5KP3A 2QA43 1QALA 3X40A 4GL6A 4HVNA 5TGNA 4ZM8A 1UW1A 2BHMA 3N9HA 1ASKA 1ROVA 3ALAA 2CWTA 1W01A 3G8ZA 4KFFA 1ZO2A 2XGLA 4XBYA 2PNCA 3RGAA 5DREA 3NHXA 3M8CA 1OHOA 3LT8A 1CYVA 3DUKA 3SX1A 3CCM3 3Q2PA 1WMOA 3CCU3 3HIGA 2F3GA 3OW22 2XF3A 2XFTA 3NBRA 2HMJB 3TUFB 3NM2A 1IV9A 3UNLA 5EEOA 8CHOA 2WGOA 3KN4A 3QK9A 1OF5A 1NO3A 3DM8A 2RFRA 1NB3I 3CPOA 3SOYA 3NYYA 3JUMA 5KVPA 1YJW3 2OOVA 3LH4A 1UUVB 1S723 3CME3 1Q40B 1M1K4 2B0PA 4FCJA 3BNCA 3F8XA 1O7WB 1WQLB 3A76A 4O8SA 2B1XB 2OQEA 4JBWM 3MKIA 4FCZA 5AIIA 1A2KA 2V1LA 3PCRA 2P0XA 3DGLA 1VQM3 2OOVC 1QMAA 3KFQC 3ROBA 1F8NA 3B4PA 5AI1A 3EHCA 3I563 1LXEA 2CFLA 3NV0A 1IT7A 3CU3A 3FH1A 3EBYA 4HBRA 2CG0A 1VQL3 3OWUA 2Z76A 1W00A 1TU5A 1CYUA 3ECFA 4WYKB 5ELUA 4EV2A 3CCL3 1OPYA 1NU3A 1IK3A 4N6NB 1O7NB 3F40A 2E2VA 5IEPA 4K61A 4RBNA 3G6E3 3H51A 3LZAA 1YJN3 1VQ73 1T5YA 1ROAA 2GBWB 3FG4A 2QGUA 1OCVA 4FMBA 2CFKA 3EX9A 3MG1A 1M904 4NREA 3X3XA 2IUKA 4IT7A 3V92A 2F86B 4MMZB 1WMNA 3S29A 1WNHA 2FNQA 2BO9B 3UZ0B 1OUNA 3IT5A 5AIFA 3SLUA 1QAKA 5IG4A 4X2OA 1TUHA 3B4OA 4H61A 1U5OA 1RKYA 3B8LA 2INXA 5JBSA 3MWZA 3WA3A 3GRDA 3T8NA 1W6GA 2KXGA 4ZYBA 3JUPA 1DMMA 2OWPA 1OACA 3WOFB 1CEWI 2YX9A 1WTHA 1Q814 1A67A 3OURB 4EXRA 4K90B 4U13A 3K7CA 4H3UA 5HGRA 3EN8A 1K28A 4FMCA 4LEHA 4OUQA 3JVCA 4MMYB 1IV7A 1GD4A 3DGNA 5STDA 3EF8A 1PFPA 4HM5B 3CCQ3 2GEYA 4N6V0 3T0UA 3WDGB 1FGOA 3OV4A 3S27A 3F8HA 1ULJB 1IQXA 2BNGA 3LYGA 1L5GB 2LYXA 1RRHA 3IMAB 3WA2X 2K54A 3NBJA 5IG3A 2W56B 2QEX3 1NDOB 1HKXA 5AIHA 5D82A 1K9M4 3F7XA 3IJEB 4R9LA 3EQQB 1U8CB 3F14A 3F9SA 3NBBA 1N9EA 2OCTA 4WHAA 2CK3H 3LXUX 1Z1SA 3S67A 4STDA 2HMMB 1NB5I 3GZRA 1FGMA 4BTWA 1KWIA 1W6YA 1VQK3 2FXTA 3CXC2 3JUQA 5FGOA 3CNMA 1KC84 2F99A 3L0RA 1F3ZA 4EC6A 2JQ5A 2W0QA 3KSED 1OF5B 3LTAA 1MNLA 2XSHB 5ELJA 3MHEA 4Q53A 2IA7A 4HM0B 1OGXA 1TFKA 2ML6A 4WWUC 5IW9A 1LVNA 3LTBA 3GAXA 1W2ZA 2P09A 4IPBA 1KD14 2Z77A 3WMDA 1GGRA 1W7CA 2E2UA 3CNXA 3KE7A 2C11A 3LTCA 4XDWA 1LNHA 2CC3A 3DGMA 1E3VA 1DMNA 2CIUA 1JKGB 3CMA3 4GB5A 1YJ93 4K1VA 1O7PB 4LMIA 3CCE3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GPR A;  1GPR A;  3OUR B;  4LXC A;  1QWY A;  3TUF B;  4QP5 A;  3UZ0 B;  3IT5 A;  3SLU A;  3NYY A;  4BH5 A;  1GGR A;  5KVP A;  1O2F A;  1GLE F;  3CSQ A;  2B44 A;  2HSI A;  2B0P A;  1AX3 A;  2GU1 A;  2MP0 B;  1F3Z A;  4RNZ A;  1GLA F;  5B0H A;  1GLC F;  1GLB F;  4QPB A;  4ZYB A;  1F3G A;  4RNY A;  4JBW M;  1GLD F;  2B13 A;  3IT7 A;  2F3G A; 
#chains in the Genus database with same CATH topology
 4BTX A;  5JPP A;  1JNQ A;  3S5C A;  5CF2 A;  1X1X A;  2CW9 A;  5EQL A;  1YHQ 3;  4HM2 B;  1N8R 4;  1KQS 2;  4R1K A;  3SVA A;  3EE1 A;  2BMR B;  2CG1 A;  4N6L A;  3X41 A;  4BH5 A;  1N5H A;  1RGK A;  2GXF A;  2L4V A;  3N8B A;  2OQE C;  4LGQ A;  4MJD A;  4NPB A;  3D9R A;  5LC7 A;  1B2X A;  1PU4 A;  3FGY A;  5I97 A;  1K41 A;  4J5K A;  1ISK A;  3MG2 A;  4QWT A;  5D83 A;  1VQ9 3;  1EG9 B;  3HZP A;  3LTD A;  5D81 A;  4N6O B;  1WMP A;  1GY7 A;  2STD A;  1RGG A;  1UI8 A;  2FGT A;  4HYZ A;  5IG0 A;  1BAN A;  4O3V A;  1LQG C;  2KF5 A;  2CFD A;  5CXO A;  5AEW B;  2CX0 A;  3O8Y A;  1IVW A;  2D1W A;  3HK4 A;  5A0O B;  4O2H A;  4L8P A;  3MYT A;  1BSC A;  1ZGX A;  2AAD A;  3BB9 A;  3VGN A;  1VQP 3;  1I8V A;  1Q7Y 4;  3CPW 2;  4I5Q A;  1GSP A;  4WFO A;  2F5W A;  5JPU A;  2IUJ A;  1A2P A;  1C7H A;  1O7H B;  1AVL A;  2Y74 A;  2ZHX B;  1V58 A;  3LT9 A;  2SBL A;  3EC9 A;  1UGI A;  4HM4 B;  3CC4 3;  4FR9 A;  1YI2 3;  3FF2 A;  2BT3 A;  2M7O A;  6GSP A;  3CSQ A;  2B44 A;  2E2T A;  5G2G A;  4KFE A;  1G96 A;  1W4N A;  1IT8 A;  1LOX A;  1VQ6 3;  3I0Y A;  3J7Y d;  3NQZ A;  1NWW A;  7RNT A;  4KT3 B;  5FW5 A;  4HZ9 B;  1JJ2 2;  2K3D A;  3EBT A;  1B27 A;  3EJV A;  4LZI A;  4RNZ A;  3G4S 3;  5AEU B;  8RNT A;  5IEO A;  3KZT A;  5BVB A;  2WO0 A;  3DGY A;  3KKG A;  1JB5 A;  2ML5 A;  1SIH A;  2XR8 B;  4N3V A;  4KVH A;  4HM3 B;  2OTL 3;  1LRA A;  3NUV A;  3X42 A;  1B21 A;  5IER A;  1JKG A;  2CFW A;  4L8O A;  3OX9 A;  2BMO B;  1IYY A;  1FGT A;  1IQ8 A;  1DE3 A;  2B24 B;  2XFS A;  3PZW A;  1EKM A;  3RGR A;  4WP5 A;  5BXQ A;  1RGH A;  1I0V A;  1UUW B;  3PYJ A;  1SII A;  3VSY A;  1NJI 4;  4KZ1 A;  6STD A;  1IDP A;  4HM1 B;  2CWU A;  9RNT A;  1VQ4 3;  4I4K A;  5RNT A;  1GYB A;  2F98 A;  3DH2 A;  2GU1 A;  4NHF A;  1BAO A;  3OXA A;  2JDI H;  1QVF 2;  1F3G A;  1YGE A;  1VQO 3;  1TP6 A;  1HU9 A;  1EQK A;  1RGE A;  1V74 A;  3IT7 A;  3G71 3;  1BSE A;  2GBX B;  3MSO A;  4XB5 A;  5AYR B;  1GPR A;  2YFJ B;  3SED A;  3F7S A;  1JRQ A;  1D6Y A;  3MPH A;  1UI7 A;  1Q86 4;  3Q1C A;  1GD3 A;  2CFG A;  2WGQ A;  3QRD A;  4HKV B;  1RLS A;  4CJN A;  2CWV A;  1YVB I;  3D5I A;  4X2H A;  2KF3 A;  4BU4 A;  1T2I A;  3BLZ A;  1PY3 A;  3UL6 A;  3IPT A;  4TX4 A;  1OHS A;  1B20 A;  2I9W A;  3D4A A;  3Q90 A;  3ZG0 A;  2OTJ 3;  1JV2 B;  3OWS A;  2HMN B;  3AMO A;  4K1U A;  2IMJ A;  3K0Z A;  4L7K A;  2KRT A;  1AVK A;  1Q9E A;  1GMR A;  4J9A A;  1FUW A;  1R4Y A;  4HM8 B;  1SQW A;  1GLB F;  4RNY A;  3DXO A;  1MWT A;  2CKF B;  1A2V A;  3TDG A;  5IF6 A;  1Q40 A;  3X3Y A;  3SXX A;  1IU7 A;  5AIG A;  2BU4 A;  2KCD A;  3EN1 B;  1YIT 3;  2PZV A;  5EVH A;  1Q82 4;  2QIY A;  3HI7 A;  2ZL8 A;  1VQ8 3;  1FGQ A;  2XRX B;  1FA3 A;  3PS8 A;  1UCL A;  2W04 A;  3PCS A;  3U97 A;  1YIJ 3;  4JRF A;  3RDE A;  4HM7 B;  2BIR A;  1JBS A;  3UL5 A;  3KSP A;  2HMK B;  1Y4K A;  2UX0 A;  3E99 A;  1AX3 A;  3SYU A;  2Z6B A;  1RGF A;  1W5Z A;  3WOD G;  3NV0 B;  4J5G A;  1TFO A;  3D3L A;  1RMS A;  4JF8 A;  1STD A;  1DMQ A;  3BND A;  4AEQ A;  1MGW A;  1GS3 A;  1BNS A;  2Z7A A;  2K0M A;  3LML A;  3PXM A;  1E97 A;  1RRL A;  1DVC A;  1DYU A;  5BU4 A;  1RCK A;  3K63 A;  1MOL A;  1BNF A;  4WYK A;  4QP5 A;  1JB4 A;  1BRK A;  1AV4 A;  3I55 3;  1KSI A;  2YFL B;  4O02 B;  4XBT A;  2YFI B;  3GZY B;  2ZDJ A;  3AGN A;  3CCR 3;  1DVD A;  4HM6 B;  1UGH I;  1J2B A;  3FSD A;  4XBX A;  5BIR A;  4MEI A;  3UB1 A;  1S5A A;  1N5P A;  4G1M B;  4EV5 A;  1BUQ A;  1MWR A;  4BTY A;  4N6M A;  1LOV A;  1BU4 A;  2A15 A;  3B7C A;  1GMQ A;  3NM7 A;  4N6U A;  2C4B A;  2O3O A;  3ER7 A;  1QVG 2;  4AKZ A;  2RSX A;  1AR0 A;  1EA2 A;  4R80 A;  2CHC A;  3EB8 A;  3N54 B;  1PYL A;  1IVU A;  3FKA A;  1FGR A;  3JUN A;  1N8Q A;  1TIJ A;  2XSO B;  3STD A;  3FG1 A;  3FLJ A;  1I0X A;  2RCD A;  3MG3 A;  3K5T A;  4KFD A;  2MC8 A;  3GZX B;  2W2C A;  1GOV A;  4ORL A;  2W9P A;  5IG5 A;  1M9G A;  3V99 A;  1IQY A;  1RNT A;  3DMC A;  2SAR A;  1BNE A;  1BRJ A;  2W9Q A;  1Q7H A;  2MF7 A;  3G16 A;  5CF1 A;  5G1K A;  1Q42 A;  3GZB A;  4MMX B;  1GLE F;  2H0I A;  4HJL B;  1STF I;  3ZG5 A;  3CCV 3;  4CDL A;  1BRG A;  2R4I A;  4CCV A;  2F5M A;  3BNB A;  1IVX A;  2MP0 B;  1JZO A;  3PGB A;  4FMD A;  1LOW A;  2GEX A;  3U1W A;  1DET A;  4J8T A;  3UJM A;  4CPK A;  4R4K A;  2D42 A;  4QPB A;  1D6Z A;  2P38 A;  4FMA A;  5DRV A;  3HII A;  1RJO A;  3FCS B;  1GLD F;  2B13 A;  2XH9 A;  4BL2 A;  1JN5 B;  1OGZ A;  3FZW A;  4HZB B;  4EBG A;  1A90 A;  2CH9 A;  1GY6 A;  5M18 A;  3NXJ A;  4LXC A;  2WOF A;  3CCJ 3;  2UGI A;  3BNE A;  4XM4 A;  5KP1 A;  1RN1 A;  1CH0 A;  2KF4 A;  1K8A 4;  2KF6 A;  3CD6 3;  5AYS C;  4IIA A;  3S28 A;  1OHP A;  3V98 A;  1X1Y A;  3G0K A;  2W56 A;  3KII A;  4GHO A;  2Y73 A;  4LSO A;  3X3Z A;  3CCS 3;  1SJW A;  1JN5 A;  2XEP A;  3FG3 A;  1VQ5 3;  1QAF A;  1UUG B;  3WHO A;  3H3H A;  3Q3F A;  2P05 A;  3NX0 A;  2HMO B;  2WOH A;  3T8U A;  1ZX2 A;  1SPU A;  3CC2 3;  3GWR A;  1E3R A;  1GY5 A;  2P0M A;  1NNV A;  4OVM A;  2GU3 A;  5IEN A;  1VQN 3;  1SAR A;  2GPR A;  4AKY A;  2L1S A;  1RSN A;  2XGN A;  1QWY A;  2J8X B;  3WOE B;  2C10 A;  2W03 A;  3OWY A;  3URP A;  1M1X B;  1W02 A;  5CK6 A;  3A5E A;  1O7M B;  1RGL A;  1US1 A;  3VF1 A;  7STD A;  1IVV A;  1BSB A;  3FF0 A;  1I70 A;  2IYJ A;  4R9K A;  1O2F A;  1FZU A;  2W6J H;  1O7G B;  3D5G A;  3NQY A;  5CLK A;  2BMQ B;  1W6C A;  1VZZ A;  2HSI A;  1I3I A;  1YGW A;  2O9U X;  4HAA A;  4N6T A;  3DY5 A;  1ULI B;  1BVI A;  1X1U A;  1N9J A;  4RZM A;  1GLA F;  5B0H A;  1RHL A;  1RTU A;  4EYC A;  1GLC F;  3AGO A;  2HML B;  5LC6 A;  1QJG A;  3HX8 A;  3DZL A;  3JUO A;  4OK0 A;  1OH0 A;  1GMP A;  3DGO A;  1EEJ A;  3K9M C;  1I2F A;  4PEJ A;  3CC7 3;  1R4C A;  1BRH A;  4XDV A;  3SOA A;  1CQS A;  2Q07 A;  2LQV A;  1MWS A;  2RGQ A;  4ILF A;  3LOY A;  5KP4 A;  1K73 4;  1UCI A;  1G0T A;  1W2B 2;  1RN7 A;  3AMO B;  1JB2 A;  1D6U A;  5KP3 A;  2QA4 3;  1QAL A;  3X40 A;  1G02 A;  4GL6 A;  4HVN A;  5TGN A;  4ZM8 A;  1UW1 A;  2BHM A;  3N9H A;  1ASK A;  1ROV A;  3ALA A;  1UCJ A;  1BRS A;  1I2E A;  2CWT A;  1W01 A;  3G8Z A;  4KFF A;  1T2H A;  1ZO2 A;  2XGL A;  2PNC A;  4XBY A;  3RGA A;  5DRE A;  3NHX A;  3M8C A;  1OHO A;  3LT8 A;  3HOH A;  1CYV A;  1T3B A;  3DUK A;  1VQQ A;  3SX1 A;  3CCM 3;  3Q2P A;  1WMO A;  3CCU 3;  3HIG A;  2H0G A;  2F3G A;  3OW2 2;  1LNI A;  1TTO A;  2XF3 A;  2XFT A;  3NBR A;  2HMJ B;  3TUF B;  1LOY A;  1IV9 A;  1RN4 A;  3NM2 A;  3UNL A;  1C54 A;  5EEO A;  8CHO A;  2WGO A;  3KN4 A;  3QK9 A;  5HOH A;  1OF5 A;  1NO3 A;  1BNR A;  3DM8 A;  2RFR A;  1NB3 I;  1AQZ A;  3CPO A;  3SOY A;  3NYY A;  3JUM A;  5KVP A;  1YJW 3;  2OOV A;  3LH4 A;  1UUV B;  1S72 3;  3CME 3;  1Q40 B;  1M1K 4;  1LQM B;  2B0P A;  1FUT A;  4FCJ A;  3BNC A;  1YVS A;  1RNB A;  2KAA A;  3F8X A;  2F4Y A;  1O7W B;  1WQL B;  3A76 A;  4O8S A;  2B1X B;  2OQE A;  4JBW M;  3MKI A;  1I2G A;  4FCM A;  4FCZ A;  5AII A;  1A2K A;  2V1L A;  3PCR A;  1UCK A;  2P0X A;  3DGL A;  1VQM 3;  2OOV C;  1QMA A;  3KFQ C;  1BSD A;  3ROB A;  1BRI A;  1F8N A;  1RGC A;  3B4P A;  1B2U A;  5AI1 A;  3EHC A;  1UDI I;  3I56 3;  1LXE A;  2CFL A;  3NV0 A;  1IT7 A;  3CU3 A;  3FH1 A;  3EBY A;  4HBR A;  2CG0 A;  1VQL 3;  3OWU A;  2Z76 A;  1W00 A;  5G1L A;  1TU5 A;  1JBR A;  1CYU A;  3ECF A;  4WYK B;  5ELU A;  4EV2 A;  3CCL 3;  1OPY A;  1NU3 A;  1IK3 A;  4N6N B;  1O7N B;  3AHS A;  3F40 A;  2E2V A;  5IEP A;  4K61 A;  4RBN A;  3G6E 3;  1MWU A;  3H51 A;  2ZA4 A;  3LZA A;  1YJN 3;  1VQ7 3;  1T5Y A;  3KCH A;  1ROA A;  2GBW B;  3FG4 A;  2QGU A;  1OCV A;  4FMB A;  2CFK A;  3EX9 A;  3MG1 A;  1M90 4;  4NRE A;  3X3X A;  2IUK A;  4IT7 A;  6RNT A;  1B2M A;  3V92 A;  1V57 A;  1JZD A;  2F86 B;  4MMZ B;  1WMN A;  3S29 A;  1BOX A;  1WNH A;  2FNQ A;  2BO9 B;  3UZ0 B;  1OUN A;  3IT5 A;  3D79 A;  5AIF A;  3SLU A;  1QAK A;  5IG4 A;  4X2O A;  1TUH A;  3B4O A;  4H61 A;  1BRN L;  3RNT A;  1U5O A;  1RKY A;  3B8L A;  2INX A;  3BIR A;  1RDS A;  5JBS A;  3MWZ A;  3WA3 A;  3GRD A;  1HZ1 A;  3T8N A;  1W6G A;  2KXG A;  3AHW A;  4ZYB A;  1B2S A;  3JUP A;  1DMM A;  1RCL A;  2OWP A;  1OAC A;  3WOF B;  1BNJ A;  1CEW I;  4BIR A;  2YX9 A;  4GSP A;  1WTH A;  1Q81 4;  1B3S A;  1A67 A;  3OUR B;  4EXR A;  4K90 B;  1TRP A;  1BNG A;  4U13 A;  5M1A A;  3K7C A;  4H3U A;  3ZFZ A;  5HGR A;  3EN8 A;  4BL3 A;  1K28 A;  4FMC A;  4LEH A;  4OUQ A;  1AY7 A;  3JVC A;  4MMY B;  1IV7 A;  1GD4 A;  3DGN A;  5STD A;  3EF8 A;  1ZS7 A;  1PFP A;  4HM5 B;  3CCQ 3;  2GEY A;  4N6V 0;  3T0U A;  3WDG B;  1FGO A;  3OV4 A;  1FUS A;  3S27 A;  3F8H A;  1ULJ B;  1IQX A;  2BNG A;  3LYG A;  1L5G B;  2LYX A;  1BNI A;  1RRH A;  3IMA B;  1I3F A;  3WA2 X;  2K54 A;  3NBJ A;  5IG3 A;  2W56 B;  2QEX 3;  1NDO B;  1HKX A;  5AIH A;  5D82 A;  1K9M 4;  1X1W A;  3F7X A;  1JBT A;  1YNV X;  3IJE B;  4R9L A;  3EQQ B;  1U8C B;  3F14 A;  3F9S A;  3NBB A;  4LYL B;  1N9E A;  2OCT A;  3BU4 A;  4WHA A;  2CK3 H;  2GSP A;  3LXU X;  1Z1S A;  3S67 A;  4STD A;  2H0H A;  4RNT A;  2HMM B;  1TRQ A;  3GZR A;  1NB5 I;  1FGM A;  4BTW A;  1KWI A;  1W6Y A;  1VQK 3;  2FXT A;  3CXC 2;  3JUQ A;  2HOH A;  3CNM A;  5FGO A;  1KC8 4;  7GSP A;  2F99 A;  3L0R A;  2RNT A;  1GOU A;  1BIR A;  1F3Z A;  4EC6 A;  2JQ5 A;  2W0Q A;  3KSE D;  1OF5 B;  2AAE A;  3LTA A;  1MNL A;  2XSH B;  5ELJ A;  1B2Z A;  3MHE A;  4Q53 A;  2IA7 A;  4HM0 B;  1HYF A;  1OGX A;  5GSP A;  1TFK A;  2ML6 A;  1GOY A;  4WWU C;  5IW9 A;  2RBI A;  1EUI C;  1LVN A;  1MGR A;  3LTB A;  3GAX A;  2R41 A;  3GSP A;  1W2Z A;  1BSA A;  2P09 A;  4IPB A;  1KD1 4;  2Z77 A;  2F56 A;  3WMD A;  1GGR A;  1W7C A;  2E2U A;  2CX1 A;  4DKI A;  4EW5 A;  1FW7 A;  3CNX A;  3KE7 A;  2C11 A;  3LTC A;  4XDW A;  1LNH A;  2CC3 A;  2UUG C;  3DGM A;  1FYS A;  1E3V A;  1DMN A;  2CIU A;  5M19 A;  1JKG B;  1TJD A;  3CMA 3;  4GB5 A;  4HOH A;  3WR2 A;  1YJ9 3;  4K1V A;  1RGA A;  1BUJ A;  1O7P B;  1BGS A;  4LMI A;  3CCE 3;  2IY2 A; 
#chains in the Genus database with same CATH homology
 4BTX A;  5JPP A;  1JNQ A;  3S5C A;  5CF2 A;  2CW9 A;  5EQL A;  1YHQ 3;  4HM2 B;  1N8R 4;  1KQS 2;  4R1K A;  3SVA A;  3EE1 A;  2BMR B;  2CG1 A;  4N6L A;  3X41 A;  4BH5 A;  1N5H A;  2GXF A;  2L4V A;  3N8B A;  4LGQ A;  2OQE C;  4MJD A;  1PU4 A;  1ISK A;  3D9R A;  5LC7 A;  3FGY A;  5I97 A;  1K41 A;  3MG2 A;  4QWT A;  5D83 A;  1VQ9 3;  1EG9 B;  3HZP A;  3LTD A;  5D81 A;  4N6O B;  1WMP A;  1GY7 A;  2STD A;  1UI8 A;  2FGT A;  4HYZ A;  5IG0 A;  4O3V A;  5CXO A;  2CFD A;  5AEW B;  3O8Y A;  1IVW A;  2D1W A;  3HK4 A;  5A0O B;  4O2H A;  4L8P A;  3MYT A;  1VQP 3;  3BB9 A;  3VGN A;  1Q7Y 4;  3CPW 2;  4WFO A;  5JPU A;  2IUJ A;  1O7H B;  1C7H A;  1AVL A;  2Y74 A;  3LT9 A;  2SBL A;  3EC9 A;  4HM4 B;  3CC4 3;  4FR9 A;  1YI2 3;  3FF2 A;  2BT3 A;  2M7O A;  3CSQ A;  2B44 A;  2E2T A;  5G2G A;  4KFE A;  1G96 A;  1W4N A;  1IT8 A;  1LOX A;  1VQ6 3;  3I0Y A;  3J7Y d;  3NQZ A;  1NWW A;  1JJ2 2;  5FW5 A;  4HZ9 B;  3EBT A;  4LZI A;  3EJV A;  4RNZ A;  3G4S 3;  5AEU B;  5IEO A;  3KZT A;  5BVB A;  2WO0 A;  3KKG A;  1JB5 A;  2ML5 A;  1SIH A;  2XR8 B;  4N3V A;  4KVH A;  4HM3 B;  2OTL 3;  3NUV A;  3X42 A;  5IER A;  1JKG A;  2CFW A;  4L8O A;  3OX9 A;  2BMO B;  1FGT A;  1IQ8 A;  2B24 B;  2XFS A;  3PZW A;  1EKM A;  3RGR A;  4WP5 A;  5BXQ A;  3PYJ A;  1UUW B;  3VSY A;  1SII A;  1NJI 4;  4KZ1 A;  6STD A;  1IDP A;  4HM1 B;  2CWU A;  1VQ4 3;  4I4K A;  1GYB A;  2F98 A;  2GU1 A;  4NHF A;  3OXA A;  2JDI H;  1QVF 2;  1F3G A;  1YGE A;  1VQO 3;  1TP6 A;  1HU9 A;  1EQK A;  1V74 A;  3IT7 A;  3G71 3;  2GBX B;  3MSO A;  4XB5 A;  5AYR B;  1GPR A;  2YFJ B;  3SED A;  3F7S A;  1JRQ A;  1D6Y A;  3MPH A;  1UI7 A;  1Q86 4;  3Q1C A;  1GD3 A;  2CFG A;  2WGQ A;  3QRD A;  4HKV B;  2CWV A;  1YVB I;  4X2H A;  3BLZ A;  3UL6 A;  3IPT A;  4TX4 A;  1OHS A;  2I9W A;  3Q90 A;  2OTJ 3;  1JV2 B;  3OWS A;  2HMN B;  3AMO A;  4K1U A;  2IMJ A;  3K0Z A;  4L7K A;  2KRT A;  1AVK A;  4J9A A;  1FUW A;  4HM8 B;  1SQW A;  1GLB F;  4RNY A;  3DXO A;  2CKF B;  1A2V A;  3TDG A;  5IF6 A;  1Q40 A;  3X3Y A;  3SXX A;  1IU7 A;  5AIG A;  2KCD A;  3EN1 B;  1YIT 3;  2PZV A;  5EVH A;  1Q82 4;  2QIY A;  3HI7 A;  2ZL8 A;  1VQ8 3;  1FGQ A;  2XRX B;  1FA3 A;  3PS8 A;  1YIJ 3;  2W04 A;  3PCS A;  3U97 A;  4JRF A;  3RDE A;  4HM7 B;  3UL5 A;  3KSP A;  2HMK B;  1Y4K A;  2UX0 A;  3E99 A;  1AX3 A;  2Z6B A;  1W5Z A;  3WOD G;  3NV0 B;  1TFO A;  3D3L A;  4JF8 A;  1STD A;  1DMQ A;  3BND A;  4AEQ A;  1GS3 A;  2Z7A A;  2K0M A;  3LML A;  3PXM A;  1E97 A;  1RRL A;  1DVC A;  1DYU A;  3K63 A;  1MOL A;  4WYK A;  4QP5 A;  1JB4 A;  1AV4 A;  3I55 3;  1KSI A;  2YFL B;  4O02 B;  4XBT A;  2YFI B;  3GZY B;  2ZDJ A;  3CCR 3;  1DVD A;  4HM6 B;  1J2B A;  3FSD A;  4XBX A;  4MEI A;  3UB1 A;  1S5A A;  1N5P A;  4G1M B;  4EV5 A;  1BUQ A;  4BTY A;  4N6M A;  2A15 A;  3B7C A;  3NM7 A;  4N6U A;  2O3O A;  3ER7 A;  1QVG 2;  4AKZ A;  2RSX A;  1AR0 A;  1EA2 A;  4R80 A;  2CHC A;  3EB8 A;  3N54 B;  3JUN A;  1IVU A;  3FKA A;  1FGR A;  4FCM A;  1N8Q A;  1TIJ A;  2XSO B;  3STD A;  3FG1 A;  3FLJ A;  2RCD A;  3MG3 A;  3K5T A;  4KFD A;  2MC8 A;  3GZX B;  2W2C A;  4ORL A;  2W9P A;  5IG5 A;  1M9G A;  3V99 A;  1IQY A;  3DMC A;  2W9Q A;  2MF7 A;  3G16 A;  5CF1 A;  1Q42 A;  3GZB A;  4MMX B;  1GLE F;  4HJL B;  3CCV 3;  1STF I;  4CDL A;  2R4I A;  4CCV A;  3BNB A;  1IVX A;  2MP0 B;  3PGB A;  4FMD A;  2GEX A;  3U1W A;  3UJM A;  4J8T A;  4R4K A;  2D42 A;  4QPB A;  1D6Z A;  2P38 A;  4FMA A;  5DRV A;  3HII A;  1RJO A;  3FCS B;  1GLD F;  2B13 A;  2XH9 A;  1JN5 B;  1OGZ A;  3FZW A;  4HZB B;  4EBG A;  1A90 A;  2CH9 A;  1GY6 A;  3NXJ A;  4LXC A;  2WOF A;  3CCJ 3;  3BNE A;  4XM4 A;  5KP1 A;  1K8A 4;  3CD6 3;  5AYS C;  4IIA A;  3S28 A;  1OHP A;  3V98 A;  3G0K A;  4LSO A;  2W56 A;  3KII A;  3X3Z A;  2Y73 A;  3CCS 3;  1SJW A;  1JN5 A;  2XEP A;  3FG3 A;  1VQ5 3;  1QAF A;  3H3H A;  2P05 A;  3NX0 A;  2HMO B;  2WOH A;  3T8U A;  1ZX2 A;  1SPU A;  3CC2 3;  3GWR A;  1E3R A;  1GY5 A;  2P0M A;  4OVM A;  2GU3 A;  5IEN A;  1VQN 3;  2GPR A;  4AKY A;  2XGN A;  1QWY A;  3WOE B;  2C10 A;  2W03 A;  3OWY A;  1M1X B;  1W02 A;  5CK6 A;  3VF1 A;  1O7M B;  1US1 A;  7STD A;  1IVV A;  3FF0 A;  4R9K A;  1O2F A;  2W6J H;  1O7G B;  3NQY A;  5CLK A;  2BMQ B;  1W6C A;  1VZZ A;  2HSI A;  4N6T A;  2O9U X;  3DY5 A;  1ULI B;  1N9J A;  4RZM A;  1GLA F;  5B0H A;  4EYC A;  1GLC F;  5LC6 A;  2HML B;  1QJG A;  3HX8 A;  3DZL A;  3JUO A;  4OK0 A;  1OH0 A;  3DGO A;  3K9M C;  4PEJ A;  3CC7 3;  1R4C A;  4XDV A;  3SOA A;  1CQS A;  2Q07 A;  2LQV A;  2RGQ A;  3LOY A;  5KP4 A;  1K73 4;  1W2B 2;  1RN7 A;  3AMO B;  1JB2 A;  1D6U A;  5KP3 A;  2QA4 3;  1QAL A;  3X40 A;  4GL6 A;  4HVN A;  5TGN A;  4ZM8 A;  1UW1 A;  2BHM A;  3N9H A;  1ASK A;  1ROV A;  3ALA A;  2CWT A;  1W01 A;  3G8Z A;  4KFF A;  1ZO2 A;  2XGL A;  4XBY A;  2PNC A;  3RGA A;  5DRE A;  3NHX A;  3M8C A;  1OHO A;  3LT8 A;  1CYV A;  3DUK A;  3SX1 A;  3CCM 3;  3Q2P A;  1WMO A;  3CCU 3;  3HIG A;  2F3G A;  3OW2 2;  2XF3 A;  2XFT A;  3NBR A;  2HMJ B;  3TUF B;  3NM2 A;  1IV9 A;  3UNL A;  5EEO A;  8CHO A;  2WGO A;  3KN4 A;  3QK9 A;  1OF5 A;  1NO3 A;  3DM8 A;  2RFR A;  1NB3 I;  3CPO A;  3SOY A;  3NYY A;  3JUM A;  5KVP A;  1YJW 3;  2OOV A;  3LH4 A;  1UUV B;  1S72 3;  3CME 3;  1Q40 B;  1M1K 4;  2B0P A;  4FCJ A;  3BNC A;  3F8X A;  1O7W B;  1WQL B;  3A76 A;  4O8S A;  2B1X B;  2OQE A;  4JBW M;  3MKI A;  4FCZ A;  5AII A;  1A2K A;  2V1L A;  3PCR A;  2P0X A;  3DGL A;  1VQM 3;  2OOV C;  1QMA A;  3KFQ C;  3ROB A;  1F8N A;  3B4P A;  5AI1 A;  3EHC A;  3I56 3;  1LXE A;  2CFL A;  3NV0 A;  1IT7 A;  3CU3 A;  3FH1 A;  3EBY A;  4HBR A;  2CG0 A;  1VQL 3;  3OWU A;  2Z76 A;  1W00 A;  1TU5 A;  1CYU A;  3ECF A;  4WYK B;  5ELU A;  4EV2 A;  3CCL 3;  1OPY A;  1NU3 A;  1IK3 A;  4N6N B;  1O7N B;  3F40 A;  2E2V A;  5IEP A;  4K61 A;  4RBN A;  3G6E 3;  3H51 A;  3LZA A;  1YJN 3;  1VQ7 3;  1T5Y A;  1ROA A;  2GBW B;  3FG4 A;  2QGU A;  1OCV A;  4FMB A;  2CFK A;  3EX9 A;  3MG1 A;  1M90 4;  4NRE A;  3X3X A;  2IUK A;  4IT7 A;  3V92 A;  2F86 B;  4MMZ B;  1WMN A;  3S29 A;  1WNH A;  2FNQ A;  2BO9 B;  3UZ0 B;  1OUN A;  3IT5 A;  5AIF A;  3SLU A;  1QAK A;  5IG4 A;  4X2O A;  1TUH A;  3B4O A;  4H61 A;  1U5O A;  1RKY A;  3B8L A;  2INX A;  5JBS A;  3MWZ A;  3WA3 A;  3GRD A;  3T8N A;  1W6G A;  2KXG A;  4ZYB A;  3JUP A;  1DMM A;  2OWP A;  1OAC A;  3WOF B;  1CEW I;  2YX9 A;  1WTH A;  1Q81 4;  1A67 A;  3OUR B;  4EXR A;  4K90 B;  4U13 A;  3K7C A;  4H3U A;  5HGR A;  3EN8 A;  1K28 A;  4FMC A;  4LEH A;  4OUQ A;  3JVC A;  4MMY B;  1IV7 A;  1GD4 A;  3DGN A;  5STD A;  3EF8 A;  1PFP A;  4HM5 B;  3CCQ 3;  2GEY A;  4N6V 0;  3T0U A;  3WDG B;  1FGO A;  3OV4 A;  3S27 A;  3F8H A;  1ULJ B;  1IQX A;  2BNG A;  3LYG A;  1L5G B;  2LYX A;  1RRH A;  3IMA B;  3WA2 X;  2K54 A;  3NBJ A;  5IG3 A;  2W56 B;  2QEX 3;  1NDO B;  1HKX A;  5AIH A;  5D82 A;  1K9M 4;  3F7X A;  3IJE B;  4R9L A;  3EQQ B;  1U8C B;  3F14 A;  3F9S A;  3NBB A;  1N9E A;  2OCT A;  4WHA A;  2CK3 H;  3LXU X;  1Z1S A;  3S67 A;  4STD A;  2HMM B;  1NB5 I;  3GZR A;  1FGM A;  4BTW A;  1KWI A;  1W6Y A;  1VQK 3;  2FXT A;  3CXC 2;  3JUQ A;  5FGO A;  3CNM A;  1KC8 4;  2F99 A;  3L0R A;  1F3Z A;  4EC6 A;  2JQ5 A;  2W0Q A;  3KSE D;  1OF5 B;  3LTA A;  1MNL A;  2XSH B;  5ELJ A;  3MHE A;  4Q53 A;  2IA7 A;  4HM0 B;  1OGX A;  1TFK A;  2ML6 A;  4WWU C;  5IW9 A;  1LVN A;  3LTB A;  3GAX A;  1W2Z A;  2P09 A;  4IPB A;  1KD1 4;  2Z77 A;  3WMD A;  1GGR A;  1W7C A;  2E2U A;  3CNX A;  3KE7 A;  2C11 A;  3LTC A;  4XDW A;  1LNH A;  2CC3 A;  3DGM A;  1E3V A;  1DMN A;  2CIU A;  1JKG B;  3CMA 3;  4GB5 A;  1YJ9 3;  4K1V A;  1O7P B;  4LMI A;  3CCE 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...