4RNZA

Structure of helicobacter pylori csd3 from the hexagonal crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
369
structure length
359
Chain Sequence
MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGFLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Conserved hypothetical secreted protein
total genus 100
structure length 359
sequence length 369
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnzA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnzA02
2HSIA 5B0HA 4RNYA 3IT5A 3IT7A 1GLCF 2B0PA 1QWYA 3SLUA 3CSQA 4QP5A 3OURB 2B44A 3NYYA 2GU1A 1F3GA 1GLAF 1AX3A 4RNZA 5KVPA 1O2FA 1GLEF 4LXCA 2MP0B 1GLDF 4ZYBA 3UZ0B 1GPRA 2GPRA 1GGRA 4QPBA 1GLBF 1F3ZA 4JBWM 4BH5A 2B13A 2F3GA 3TUFB
chains in the Genus database with same CATH superfamily
2Y74A 3BNDA 5BXQA 1W4NA 4IIAA 3DGLA 5IG5A 1GLCF 1PFPA 2CFDA 3OWUA 4BTXA 4QP5A 2XR8B 3DY5A 3GAXA 2PNCA 4RNTA 2W56B 1RGGA 1V58A 2IUJA 3V92A 1JZOA 1GOVA 2CW9A 3BNEA 3EBTA 1W01A 1Q814 3NM2A 3S27A 3FH1A 2KXGA 1GY5A 2Z77A 1TRQA 1OF5B 4U13A 3CCL3 3IPTA 4CCVA 1FGTA 1RGEA 3X3XA 1WMOA 4N6NB 3D5IA 2YFIB 3HK4A 3KIIA 4HM7B 2KRTA 1OGZA 1GMPA 1OH0A 1I0VA 1A67A 1HU9A 1TRPA 1DMQA 2IYJA 2QEX3 3DGMA 1WTHA 4OUQA 2D1WA 4HM1B 4GL6A 3D5GA 1YJ93 3FLJA 4K1VA 1LOYA 2BHMA 3FG3A 1RGCA 1I2GA 3NYYA 2W03A 3BNCA 1U5OA 1W7CA 4G1MB 3DM8A 4IT7A 1Q7Y4 4RNZA 1RHLA 1GY7A 2I9WA 3Q2PA 1SIIA 4J5KA 1QVG2 1BIRA 2MP0B 4R4KA 5FGOA 3S67A 1S5AA 3F8HA 1ISKA 4BIRA 3N9HA 1IQ8A 2CX1A 2CFLA 1I2FA 3NUVA 2A15A 2AADA 3MHEA 3MG2A 5BU4A 3AHWA 2M7OA 1TP6A 1JKGB 1NB3I 4FMDA 5KP4A 1A90A 2RSXA 1T5YA 8RNTA 3NHXA 3HOHA 3QK9A 1BAOA 4HM5B 3GRDA 5STDA 1WMNA 4RNYA 5KP3A 1O7NB 1OHPA 1HYFA 3G4S3 1W6CA 3JVCA 3KSPA 3LTDA 5G1LA 1A2VA 3EJVA 1BANA 5IEOA 2C11A 1OACA 4XBTA 3CCQ3 1DMNA 1G96A 3EN1B 3CCM3 3G8ZA 1VQN3 2RFRA 2KCDA 1X1YA 2BMQB 2R4IA 3JUOA 4HKVB 5FW5A 1GPRA 2Z76A 4GSPA 2K54A 3ECFA 3NQYA 4X2HA 1ZGXA 1CEWI 4GHOA 1F3ZA 1UW1A 2E2TA 3SOYA 3GWRA 2GBXB 2XFSA 5JPPA 1QVF2 1YGEA 1PYLA 1UCKA 5JPUA 5GSPA 2BIRA 1N8R4 3DGNA 1E3VA 5M1AA 4X2OA 3EE1A 4FCMA 2GEYA 3EHCA 2B0PA 1IDPA 1Q40A 2YX9A 4CDLA 3F7SA 3CSQA 1M9GA 3CC73 3X3ZA 3K9MC 2CC3A 1MOLA 1KSIA 1Q9EA 2CFGA 2IA7A 1VZZA 3CPW2 4LXCA 1BRGA 1BRKA 1NNVA 4HM4B 4WHAA 3AMOA 3LH4A 3G0KA 1AVLA 2GEXA 2XSOB 3FG1A 3X41A 3RGRA 3JUNA 1BNRA 4QPBA 1I3FA 1O7MB 4HZBB 2F4YA 4I4KA 3WOFB 2W2CA 4WYKA 5AIFA 1RN7A 3CCV3 3CNXA 3ZG0A 1YGWA 1OGXA 2CX0A 3X42A 2IMJA 1ZO2A 2L1SA 1AR0A 2CKFB 5D81A 4FR9A 4HM3B 4WP5A 5M18A 1N9EA 4EV5A 3HIGA 4XDVA 3MYTA 4O3VA 5CF2A 3JUMA 2F56A 1MGWA 3DUKA 1IK3A 3U97A 2HMNB 2B44A 3G713 1BUQA 1DVCA 1FUTA 3N54B 3PZWA 2W9QA 1NJI4 4BL3A 3CXC2 4RZMA 2CWUA 1GLDF 1AV4A 2E2UA 1KWIA 1BSEA 2LQVA 3B4OA 4Q53A 1R4YA 1GGRA 1YNVX 3LTCA 3K0ZA 2E2VA 1HKXA 2INXA 1M1XB 1U8CB 2ZHXB 4N6LA 1BRJA 3PGBA 2FGTA 5IW9A 2OWPA 2W0QA 3NV0A 3FKAA 2PZVA 4MJDA 2BT3A 5CXOA 3U1WA 1FA3A 3DGYA 3LMLA 4FMAA 1BNEA 1LRAA 1IVVA 2HMKB 3FGYA 1OF5A 4NHFA 3MG3A 4KT3B 3ROBA 1RKYA 1UGIA 2QA43 1JBRA 4ZM8A 3UB1A 1IQXA 1EG9B 1GOUA 3FZWA 3V99A 1K8A4 1BNFA 4N6MA 1G02A 1FUSA 3CCU3 1EEJA 1W00A 4FMCA 1RCKA 2F99A 5CK6A 5I97A 4KFEA 2CG0A 3T8UA 1GD4A 3K63A 2K3DA 2Z7AA 3KFQC 1RGKA 1I70A 2WO0A 4L8OA 1S723 5KP1A 1VQQA 1N5PA 1EKMA 1RNTA 4NREA 3CME3 3CMA3 1W6GA 4HAAA 1W2B2 2GSPA 2AAEA 1W02A 4XM4A 1O7PB 2H0IA 3IT5A 3IT7A 3FCSB 2F98A 3SXXA 3CC23 5G2GA 2O9UX 3NM7A 1IVWA 4XB5A 3CPOA 3JUQA 1B3SA 2O3OA 4KVHA 4OVMA 1RTUA 1UCLA 5AEWB 3LXUX 4EXRA 1LQMB 2H0HA 3I0YA 4HM8B 2H0GA 9RNTA 5IENA 1IYYA 1VQ83 1F8NA 2RGQA 1RRHA 1STDA 2RNTA 3RDEA 4LGQA 3NBJA 2OQEC 1ULIB 2Q07A 4ILFA 1YI23 3UJMA 5M19A 3OW22 1J2BA 1DMMA 1A2PA 3WHOA 1GOYA 1R4CA 1STFI 4BTYA 3F8XA 1ULJB 3NV0B 4LMIA 4LSOA 2OTL3 4CPKA 3KZTA 1X1XA 3DMCA 5D83A 2WOFA 3T8NA 3BNBA 2BO9B 3OURB 2GU3A 2OQEA 3VGNA 7RNTA 3B7CA 5AIIA 1LXEA 4K1UA 4AEQA 1LOXA 4XBYA 1FGOA 1VQM3 1AQZA 1UGHI 4ORLA 2KAAA 1YVBI 2XFTA 3T0UA 4AKYA 1B2UA 1JB5A 1LQGC 2JQ5A 5CLKA 3STDA 1IVXA 1ZS7A 2KF4A 2B24B 3WA2X 1B20A 1NU3A 1RN1A 2R41A 3GZBA 5AEUB 1Q7HA 1GLBF 2ZL8A 3FF0A 3WODG 2B13A 4J9AA 3LZAA 1X1WA 1KC84 4O2HA 1WMPA 6STDA 5ELUA 1UI8A 1K28A 1I0XA 1N5HA 4J5GA 4R9LA 4K90B 1O7WB 1FW7A 4H3UA 2XRXB 1L5GB 4BTWA 1BRHA 2K0MA 4AKZA 3GZRA 3VSYA 1O7HB 1BU4A 1BNGA 1QJGA 1IV9A 2CK3H 2YFJB 4HM2B 1VQK3 3A76A 2BMOB 2ZDJA 2ML6A 1VQL3 1EUIC 1SJWA 2HMLB 1M1K4 3LTBA 4HM6B 1GMRA 1K734 3D4AA 1RJOA 3Q3FA 8CHOA 1FYSA 3KSED 5IG4A 2ML5A 5RNTA 1ROAA 6GSPA 2P0MA 1B2SA 3AGNA 1TFKA 4EV2A 1BNJA 2QIYA 3TUFB 1UCJA 1UUGB 4EW5A 1M904 4IPBA 2BU4A 1FGRA 3NBRA 1EQKA 1Y4KA 4L8PA 1C7HA 2WGOA 1CYUA 4HJLB 1N8QA 1JV2B 1NDOB 1YIJ3 3AHSA 1TU5A 4N6V0 3B8LA 2KF6A 1FZUA 2P05A 1W5ZA 3ER7A 4TX4A 2CFKA 3BU4A 3G16A 1B2ZA 3S29A 3Q90A 3SOAA 4N3VA 1RRLA 2L4VA 2C4BA 1GLEF 3UL6A 3LT9A 3QRDA 3SX1A 1IQYA 1JNQA 4XDWA 1VQ73 3UZ0B 3EN8A 3Q1CA 1WQLB 3TDGA 4EBGA 5EQLA 1RLSA 4HBRA 3GSPA 3J7Yd 2XH9A 1E97A 2D42A 4WFOA 1AX3A 4JF8A 1FUWA 3X40A 1SPUA 3K7CA 3RNTA 2Y73A 3PCSA 1SARA 3URPA 2MF7A 2SBLA 2W04A 3WMDA 3WA3A 4HM0B 4O8SA 3LT8A 4STDA 4BL2A 1IT8A 1RGHA 5BIRA 3I553 2XSHB 1MWRA 3BIRA 4DKIA 1JKGA 3CNMA 2CH9A 3NQZA 4H61A 4RBNA 5G1KA 2RCDA 2XGNA 4MMXB 2P09A 5AIGA 1UDII 3KE7A 2XF3A 1Q864 2W9PA 4HVNA 1QAFA 5HOHA 3SVAA 1RSNA 1RGLA 3B4PA 1Q824 2ZA4A 3PS8A 2UGIA 2GPRA 1FGQA 3CC43 1BOXA 1FGMA 3FG4A 3N8BA 1MNLA 2Z6BA 1NB5I 1BNIA 2KF3A 3CCE3 1LNIA 4JBWM 1JJ22 1RDSA 2F3GA 2F5WA 1NO3A 3NXJA 3UL5A 2B1XB 5DREA 3WR2A 2KF5A 1TUHA 3HIIA 1PU4A 4N6TA 2HMMB 3IJEB 1BVIA 4HYZA 4K61A 1GMQA 1SQWA 1IVUA 1B21A 1DVDA 1GD3A 1US1A 5JBSA 1GLAF 2IUKA 4LZIA 5BVBA 5KVPA 1YJN3 1VQ43 4R80A 1O2FA 1IT7A 4KFFA 4PEJA 3KKGA 1LOWA 3DXOA 1CQSA 2C10A 2OCTA 3SYUA 2IY2A 5IG0A 1K9M4 3CCS3 1UUWB 3EF8A 1OCVA 1Q40B 1GY6A 2WGQA 4MMYB 1X1UA 2V1LA 4FCZA 2MC8A 1DYUA 3X3YA 3EX9A 1OPYA 2CFWA 3K5TA 3ZG5A 1VQ63 5AYRB 1OUNA 1UUVB 3PCRA 4L7KA 4OK0A 4N6UA 5HGRA 3OX9A 5B0HA 2FNQA 2W6JH 3HX8A 1JN5B 3PYJA 2P38A 3FF2A 4WWUC 3KCHA 4BU4A 3G6E3 3CU3A 3H51A 7STDA 1BSBA 1JN5A 3DH2A 4LEHA 3OWSA 5D82A 3O8YA 1MWTA 1QAKA 3HZPA 1Z1SA 3I563 5CF1A 3LYGA 1LNHA 1RCLA 3E99A 3L0RA 1QMAA 3OV4A 1ASKA 4KZ1A 4R9KA 3F9SA 5IERA 3BLZA 3CD63 1W6YA 3BB9A 1OHSA 3NX0A 3OXAA 5A0OB 1IU7A 1BNSA 3S5CA 1VQ53 3M8CA 5EEOA 1Q42A 1LOVA 1PY3A 2UX0A 2SARA 2HSIA 1CH0A 4XBXA 2P0XA 1DE3A 3F14A 1GYBA 1BRIA 1GSPA 3MSOA 1VQP3 1T3BA 2YFLB 1ZX2A 3F40A 2F5MA 4MEIA 2RBIA 1B27A 4I5QA 5IF6A 2GU1A 1QALA 2BMRB 1RGAA 4HOHA 1KQS2 1RNBA 1A2KA 1K41A 2GXFA 1RGFA 3AMOB 5DRVA 1YHQ3 3A5EA 1CYVA 4O02B 5AYSC 1TJDA 4ZYBA 3D9RA 2UUGC 3S28A 1TFOA 3EC9A 2CIUA 4NPBA 1AVKA 2XGLA 3EQQB 3MG1A 1JBTA 1IV7A 1OHOA 4GB5A 1W2ZA 1D6UA 1JB4A 3CCR3 5IEPA 1V57A 1BGSA 3HI7A 5AI1A 1KD14 3V98A 1VQO3 1BSAA 3LOYA 4R1KA 6RNTA 5AIHA 3EB8A 5TGNA 1D6ZA 3ZFZA 4FCJA 3MWZA 1T2HA 2CG1A 2OTJ3 4MMZB 3EBYA 3FSDA 1QWYA 1B2XA 3WDGB 1BUJA 3CCJ3 1MGRA 4FMBA 1I8VA 2CWVA 3GZXB 3MKIA 2OOVC 3OWYA 1GS3A 1EA2A 2HOHA 3H3HA 4EC6A 1MWSA 1BSCA 1V74A 3LTAA 2HMJB 1HZ1A 1MWUA 2W56A 5LC6A 1JZDA 2QGUA 1YJW3 3D79A 3JUPA 1DETA 2CWTA 1AY7A 4WYKB 4HZ9B 3AGOA 5LC7A 2XEPA 4EYCA 4CJNA 3SLUA 1BSDA 7GSPA 1NWWA 3RGAA 1E3RA 1TIJA 3WOEB 3KN4A 1JBSA 2JDIH 2STDA 2OOVA 1YIT3 2BNGA 1G0TA 2F86B 3IMAB 2CHCA 1LVNA 3MPHA 1T2IA 3PXMA 1B2MA 4JRFA 1RMSA 1WNHA 1N9JA 4N6OB 1ROVA 1JRQA 1F3GA 4QWTA 5ELJA 2WOHA 1D6YA 1SIHA 3ALAA 3F7XA 2FXTA 3D3LA 1BRSA 1UCIA 2LYXA 3UNLA 1VQ93 1C54A 1YVSA 4KFDA 4LYLB 5EVHA 3VF1A 5IG3A 1I2EA 3NBBA 2GBWB 3DZLA 3SEDA 1JB2A 1O7GB 1RN4A 1TTOA 2HMOB 4J8TA 1UI7A 3GZYB 4BH5A 2J8XB 3DGOA 1I3IA 1BRNL
chains in the Genus database with same CATH topology
2Y74A 3BNDA 5BXQA 1W4NA 4IIAA 3DGLA 5IG5A 1GLCF 1PFPA 2CFDA 3OWUA 4BTXA 4QP5A 2XR8B 3DY5A 3GAXA 2PNCA 2W56B 2IUJA 3V92A 2CW9A 3BNEA 3EBTA 1W01A 1Q814 3NM2A 3S27A 3FH1A 2KXGA 1GY5A 2Z77A 1OF5B 4U13A 3CCL3 3IPTA 4CCVA 1FGTA 3X3XA 1WMOA 4N6NB 2YFIB 3HK4A 3KIIA 4HM7B 2KRTA 1OGZA 1OH0A 1A67A 1HU9A 1DMQA 2QEX3 3DGMA 1WTHA 4OUQA 2D1WA 4HM1B 4GL6A 1YJ93 3FLJA 4K1VA 2BHMA 3NYYA 2W03A 3BNCA 1U5OA 1W7CA 4G1MB 3DM8A 4IT7A 1Q7Y4 4RNZA 1GY7A 2I9WA 3Q2PA 1SIIA 1QVG2 2MP0B 4R4KA 5FGOA 3S67A 1S5AA 3F8HA 1ISKA 3N9HA 1IQ8A 2CFLA 3NUVA 2A15A 3MHEA 3MG2A 2M7OA 1TP6A 1JKGB 1NB3I 4FMDA 5KP4A 1A90A 2RSXA 1T5YA 3NHXA 3QK9A 4HM5B 3GRDA 5STDA 1WMNA 4RNYA 5KP3A 1O7NB 1OHPA 3G4S3 1W6CA 3JVCA 3KSPA 3LTDA 1A2VA 3EJVA 5IEOA 3CCQ3 2C11A 1OACA 4XBTA 1DMNA 1G96A 3EN1B 3CCM3 3G8ZA 1VQN3 2RFRA 2KCDA 3JUOA 2BMQB 2R4IA 4HKVB 5FW5A 1GPRA 2Z76A 2K54A 3ECFA 3NQYA 4X2HA 1CEWI 1F3ZA 1UW1A 2E2TA 3SOYA 3GWRA 2GBXB 2XFSA 5JPPA 1QVF2 1YGEA 5JPUA 1N8R4 3DGNA 1E3VA 4X2OA 3EE1A 4FCMA 2GEYA 3EHCA 2B0PA 2YX9A 1IDPA 1Q40A 4CDLA 3F7SA 3CSQA 1M9GA 3CC73 3X3ZA 3K9MC 2CC3A 1MOLA 1KSIA 2CFGA 2IA7A 3CPW2 1VZZA 4LXCA 4WHAA 4HM4B 3AMOA 3LH4A 3G0KA 1AVLA 2GEXA 2XSOB 3FG1A 3X41A 3RGRA 3JUNA 4QPBA 1O7MB 4HZBB 4I4KA 3WOFB 2W2CA 4WYKA 5AIFA 1RN7A 3CCV3 3CNXA 1OGXA 3X42A 2IMJA 1ZO2A 1AR0A 2CKFB 5D81A 4FR9A 4HM3B 4WP5A 1N9EA 4EV5A 3HIGA 4XDVA 3MYTA 4O3VA 5CF2A 3JUMA 3DUKA 1IK3A 3U97A 2HMNB 2B44A 3G713 1BUQA 1DVCA 3PZWA 3N54B 2W9QA 1NJI4 3CXC2 4RZMA 2CWUA 1GLDF 1AV4A 2E2UA 1KWIA 4Q53A 2LQVA 3B4OA 1GGRA 3LTCA 3K0ZA 2E2VA 1HKXA 2INXA 1M1XB 1U8CB 4N6LA 3PGBA 2FGTA 5IW9A 2OWPA 2W0QA 3NV0A 3FKAA 2PZVA 4MJDA 2BT3A 5CXOA 3U1WA 1FA3A 3LMLA 4FMAA 1IVVA 2HMKB 3FGYA 1OF5A 4NHFA 3MG3A 2QA43 3ROBA 1RKYA 4ZM8A 3UB1A 1IQXA 1EG9B 3FZWA 3V99A 1K8A4 4N6MA 3CCU3 1W00A 4FMCA 2F99A 5CK6A 5I97A 4KFEA 2CG0A 3T8UA 1GD4A 3K63A 2Z7AA 3KFQC 2WO0A 4L8OA 1S723 5KP1A 1N5PA 1EKMA 4NREA 3CME3 3CMA3 1W6GA 1W2B2 4XM4A 1W02A 1O7PB 3SXXA 3IT5A 3IT7A 3FCSB 2F98A 3CC23 5G2GA 2O9UX 3NM7A 1IVWA 4XB5A 3CPOA 3JUQA 2O3OA 4KVHA 4OVMA 5AEWB 3LXUX 4EXRA 3I0YA 4HM8B 5IENA 1VQ83 1F8NA 2RGQA 1RRHA 1STDA 3RDEA 4LGQA 3NBJA 2OQEC 1ULIB 2Q07A 1YI23 3UJMA 3OW22 1J2BA 1DMMA 1R4CA 1STFI 4BTYA 3F8XA 1ULJB 3NV0B 4LMIA 4LSOA 2OTL3 3KZTA 5D83A 3DMCA 2WOFA 3T8NA 3BNBA 2BO9B 3OURB 2GU3A 2OQEA 3VGNA 3B7CA 5AIIA 1LXEA 4K1UA 4AEQA 1LOXA 4XBYA 1FGOA 1VQM3 4ORLA 1YVBI 2XFTA 3T0UA 4AKYA 5CLKA 1JB5A 2JQ5A 3STDA 1IVXA 2B24B 3WA2X 1NU3A 3GZBA 5AEUB 1GLBF 2ZL8A 3FF0A 3WODG 2B13A 4J9AA 3LZAA 1KC84 4O2HA 1WMPA 6STDA 5ELUA 1UI8A 1K28A 1N5HA 4R9LA 4K90B 1O7WB 4H3UA 2XRXB 1L5GB 4BTWA 2K0MA 4AKZA 3GZRA 3VSYA 1O7HB 1QJGA 2YFJB 1IV9A 2CK3H 4HM2B 1VQK3 3A76A 2BMOB 2ZDJA 2ML6A 1VQL3 1SJWA 2HMLB 1M1K4 3LTBA 4HM6B 1K734 1RJOA 8CHOA 3KSED 5IG4A 2ML5A 1ROAA 2P0MA 1TFKA 4EV2A 2QIYA 3TUFB 1M904 4IPBA 1FGRA 3NBRA 1EQKA 1Y4KA 4L8PA 1C7HA 2WGOA 1CYUA 4HJLB 1N8QA 1JV2B 1NDOB 1YIJ3 1TU5A 4N6V0 3B8LA 2P05A 3ER7A 1W5ZA 4TX4A 2CFKA 3G16A 3S29A 3Q90A 3SOAA 4N3VA 1RRLA 2L4VA 3UL6A 1GLEF 3LT9A 3QRDA 3SX1A 1IQYA 1JNQA 4XDWA 1VQ73 3UZ0B 3EN8A 3Q1CA 1WQLB 3TDGA 4EBGA 5EQLA 4HBRA 3J7Yd 2XH9A 1E97A 2D42A 4WFOA 1AX3A 4JF8A 1FUWA 3X40A 1SPUA 3K7CA 2Y73A 3PCSA 2MF7A 2SBLA 2W04A 3WMDA 3WA3A 4HM0B 4O8SA 3LT8A 4STDA 1IT8A 3I553 2XSHB 1JKGA 3CNMA 2CH9A 3NQZA 4H61A 4RBNA 2RCDA 2XGNA 4MMXB 2P09A 5AIGA 3KE7A 2XF3A 1Q864 2W9PA 4HVNA 1QAFA 3SVAA 1Q824 3B4PA 3PS8A 2GPRA 1FGQA 3CC43 3FG4A 1FGMA 3N8BA 1MNLA 2Z6BA 1NB5I 3CCE3 4JBWM 1JJ22 2F3GA 1NO3A 3NXJA 3UL5A 2B1XB 5DREA 1TUHA 3HIIA 1PU4A 4N6TA 2HMMB 3IJEB 4HYZA 4K61A 1SQWA 1IVUA 1DVDA 1GD3A 1US1A 5JBSA 1GLAF 2IUKA 4LZIA 5BVBA 5KVPA 1YJN3 1VQ43 4R80A 1O2FA 1IT7A 4KFFA 4PEJA 3KKGA 3DXOA 1CQSA 2C10A 2OCTA 5IG0A 1K9M4 3CCS3 1UUWB 3EF8A 1OCVA 1Q40B 1GY6A 2WGQA 4MMYB 2V1LA 4FCZA 2MC8A 1DYUA 3X3YA 3EX9A 2CFWA 1OPYA 3K5TA 1VQ63 5AYRB 1OUNA 1UUVB 3PCRA 4L7KA 4OK0A 4N6UA 5HGRA 3OX9A 5B0HA 2FNQA 2W6JH 3HX8A 1JN5B 3PYJA 2P38A 3FF2A 4WWUC 3G6E3 3CU3A 3H51A 7STDA 1JN5A 4LEHA 5D82A 3OWSA 3O8YA 1QAKA 3HZPA 1Z1SA 3I563 5CF1A 3LYGA 1LNHA 3E99A 3L0RA 1QMAA 3OV4A 1ASKA 4KZ1A 4R9KA 3F9SA 5IERA 3BLZA 3CD63 1W6YA 3BB9A 1OHSA 3NX0A 3OXAA 5A0OB 1IU7A 3S5CA 1VQ53 3M8CA 5EEOA 1Q42A 2UX0A 2HSIA 4XBXA 2P0XA 3F14A 1GYBA 3MSOA 1VQP3 2YFLB 3F40A 1ZX2A 4MEIA 5IF6A 2GU1A 1QALA 2BMRB 1KQS2 1A2KA 1K41A 2GXFA 3AMOB 5DRVA 1YHQ3 1CYVA 4O02B 5AYSC 4ZYBA 3D9RA 3S28A 1TFOA 3EC9A 2CIUA 1AVKA 2XGLA 3EQQB 3MG1A 1IV7A 1OHOA 4GB5A 1W2ZA 1D6UA 1JB4A 3CCR3 5IEPA 3HI7A 5AI1A 1KD14 3V98A 1VQO3 3LOYA 4R1KA 5AIHA 3EB8A 5TGNA 1D6ZA 4FCJA 3MWZA 2CG1A 2OTJ3 4MMZB 3EBYA 3FSDA 1QWYA 3WDGB 3CCJ3 4FMBA 2CWVA 3GZXB 3MKIA 2OOVC 3OWYA 1GS3A 1EA2A 3H3HA 4EC6A 1V74A 3LTAA 2HMJB 2W56A 5LC6A 2QGUA 1YJW3 3JUPA 2CWTA 4WYKB 4HZ9B 5LC7A 4EYCA 2XEPA 3SLUA 1NWWA 3RGAA 1E3RA 1TIJA 3WOEB 3KN4A 2JDIH 2STDA 2OOVA 1YIT3 2BNGA 2F86B 3IMAB 2CHCA 1LVNA 3MPHA 3PXMA 4JRFA 1WNHA 1N9JA 4N6OB 1ROVA 1JRQA 1F3GA 4QWTA 5ELJA 2WOHA 1D6YA 3ALAA 1SIHA 3F7XA 2FXTA 3D3LA 3UNLA 2LYXA 1VQ93 4KFDA 3VF1A 5EVHA 5IG3A 3NBBA 2GBWB 3DZLA 3SEDA 1JB2A 1O7GB 2HMOB 4J8TA 1UI7A 3GZYB 4BH5A 3DGOA 3FG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSI A;  5B0H A;  4RNY A;  3IT5 A;  3IT7 A;  1GLC F;  2B0P A;  1QWY A;  3SLU A;  3CSQ A;  4QP5 A;  3OUR B;  2B44 A;  3NYY A;  2GU1 A;  1F3G A;  1GLA F;  1AX3 A;  4RNZ A;  5KVP A;  1O2F A;  1GLE F;  4LXC A;  2MP0 B;  1GLD F;  4ZYB A;  3UZ0 B;  1GPR A;  2GPR A;  1GGR A;  4QPB A;  1GLB F;  1F3Z A;  4JBW M;  4BH5 A;  2B13 A;  2F3G A;  3TUF B; 
#chains in the Genus database with same CATH topology
 2Y74 A;  3BND A;  5BXQ A;  1W4N A;  4IIA A;  3DGL A;  5IG5 A;  1GLC F;  1PFP A;  2CFD A;  3OWU A;  4BTX A;  4QP5 A;  2XR8 B;  3DY5 A;  3GAX A;  2PNC A;  4RNT A;  2W56 B;  1RGG A;  1V58 A;  2IUJ A;  3V92 A;  1JZO A;  1GOV A;  2CW9 A;  3BNE A;  3EBT A;  1W01 A;  1Q81 4;  3NM2 A;  3S27 A;  3FH1 A;  2KXG A;  1GY5 A;  2Z77 A;  1TRQ A;  1OF5 B;  4U13 A;  3CCL 3;  3IPT A;  4CCV A;  1FGT A;  1RGE A;  3X3X A;  1WMO A;  4N6N B;  3D5I A;  2YFI B;  3HK4 A;  3KII A;  4HM7 B;  2KRT A;  1OGZ A;  1GMP A;  1OH0 A;  1I0V A;  1A67 A;  1HU9 A;  1TRP A;  1DMQ A;  2IYJ A;  2QEX 3;  3DGM A;  1WTH A;  4OUQ A;  2D1W A;  4HM1 B;  4GL6 A;  3D5G A;  1YJ9 3;  3FLJ A;  4K1V A;  1LOY A;  2BHM A;  3FG3 A;  1RGC A;  1I2G A;  3NYY A;  2W03 A;  3BNC A;  1U5O A;  1W7C A;  4G1M B;  3DM8 A;  4IT7 A;  1Q7Y 4;  4RNZ A;  1RHL A;  1GY7 A;  2I9W A;  3Q2P A;  1SII A;  4J5K A;  1QVG 2;  1BIR A;  2MP0 B;  4R4K A;  5FGO A;  3S67 A;  1S5A A;  3F8H A;  1ISK A;  4BIR A;  3N9H A;  1IQ8 A;  2CX1 A;  2CFL A;  1I2F A;  3NUV A;  2A15 A;  2AAD A;  3MHE A;  3MG2 A;  5BU4 A;  3AHW A;  2M7O A;  1TP6 A;  1JKG B;  1NB3 I;  4FMD A;  5KP4 A;  1A90 A;  2RSX A;  1T5Y A;  8RNT A;  3NHX A;  3HOH A;  3QK9 A;  1BAO A;  4HM5 B;  3GRD A;  5STD A;  1WMN A;  4RNY A;  5KP3 A;  1O7N B;  1OHP A;  1HYF A;  3G4S 3;  1W6C A;  3JVC A;  3KSP A;  3LTD A;  5G1L A;  1A2V A;  3EJV A;  1BAN A;  5IEO A;  2C11 A;  1OAC A;  4XBT A;  3CCQ 3;  1DMN A;  1G96 A;  3EN1 B;  3CCM 3;  3G8Z A;  1VQN 3;  2RFR A;  2KCD A;  1X1Y A;  2BMQ B;  2R4I A;  3JUO A;  4HKV B;  5FW5 A;  1GPR A;  2Z76 A;  4GSP A;  2K54 A;  3ECF A;  3NQY A;  4X2H A;  1ZGX A;  1CEW I;  4GHO A;  1F3Z A;  1UW1 A;  2E2T A;  3SOY A;  3GWR A;  2GBX B;  2XFS A;  5JPP A;  1QVF 2;  1YGE A;  1PYL A;  1UCK A;  5JPU A;  5GSP A;  2BIR A;  1N8R 4;  3DGN A;  1E3V A;  5M1A A;  4X2O A;  3EE1 A;  4FCM A;  2GEY A;  3EHC A;  2B0P A;  1IDP A;  1Q40 A;  2YX9 A;  4CDL A;  3F7S A;  3CSQ A;  1M9G A;  3CC7 3;  3X3Z A;  3K9M C;  2CC3 A;  1MOL A;  1KSI A;  1Q9E A;  2CFG A;  2IA7 A;  1VZZ A;  3CPW 2;  4LXC A;  1BRG A;  1BRK A;  1NNV A;  4HM4 B;  4WHA A;  3AMO A;  3LH4 A;  3G0K A;  1AVL A;  2GEX A;  2XSO B;  3FG1 A;  3X41 A;  3RGR A;  3JUN A;  1BNR A;  4QPB A;  1I3F A;  1O7M B;  4HZB B;  2F4Y A;  4I4K A;  3WOF B;  2W2C A;  4WYK A;  5AIF A;  1RN7 A;  3CCV 3;  3CNX A;  3ZG0 A;  1YGW A;  1OGX A;  2CX0 A;  3X42 A;  2IMJ A;  1ZO2 A;  2L1S A;  1AR0 A;  2CKF B;  5D81 A;  4FR9 A;  4HM3 B;  4WP5 A;  5M18 A;  1N9E A;  4EV5 A;  3HIG A;  4XDV A;  3MYT A;  4O3V A;  5CF2 A;  3JUM A;  2F56 A;  1MGW A;  3DUK A;  1IK3 A;  3U97 A;  2HMN B;  2B44 A;  3G71 3;  1BUQ A;  1DVC A;  1FUT A;  3N54 B;  3PZW A;  2W9Q A;  1NJI 4;  4BL3 A;  3CXC 2;  4RZM A;  2CWU A;  1GLD F;  1AV4 A;  2E2U A;  1KWI A;  1BSE A;  2LQV A;  3B4O A;  4Q53 A;  1R4Y A;  1GGR A;  1YNV X;  3LTC A;  3K0Z A;  2E2V A;  1HKX A;  2INX A;  1M1X B;  1U8C B;  2ZHX B;  4N6L A;  1BRJ A;  3PGB A;  2FGT A;  5IW9 A;  2OWP A;  2W0Q A;  3NV0 A;  3FKA A;  2PZV A;  4MJD A;  2BT3 A;  5CXO A;  3U1W A;  1FA3 A;  3DGY A;  3LML A;  4FMA A;  1BNE A;  1LRA A;  1IVV A;  2HMK B;  3FGY A;  1OF5 A;  4NHF A;  3MG3 A;  4KT3 B;  3ROB A;  1RKY A;  1UGI A;  2QA4 3;  1JBR A;  4ZM8 A;  3UB1 A;  1IQX A;  1EG9 B;  1GOU A;  3FZW A;  3V99 A;  1K8A 4;  1BNF A;  4N6M A;  1G02 A;  1FUS A;  3CCU 3;  1EEJ A;  1W00 A;  4FMC A;  1RCK A;  2F99 A;  5CK6 A;  5I97 A;  4KFE A;  2CG0 A;  3T8U A;  1GD4 A;  3K63 A;  2K3D A;  2Z7A A;  3KFQ C;  1RGK A;  1I70 A;  2WO0 A;  4L8O A;  1S72 3;  5KP1 A;  1VQQ A;  1N5P A;  1EKM A;  1RNT A;  4NRE A;  3CME 3;  3CMA 3;  1W6G A;  4HAA A;  1W2B 2;  2GSP A;  2AAE A;  1W02 A;  4XM4 A;  1O7P B;  2H0I A;  3IT5 A;  3IT7 A;  3FCS B;  2F98 A;  3SXX A;  3CC2 3;  5G2G A;  2O9U X;  3NM7 A;  1IVW A;  4XB5 A;  3CPO A;  3JUQ A;  1B3S A;  2O3O A;  4KVH A;  4OVM A;  1RTU A;  1UCL A;  5AEW B;  3LXU X;  4EXR A;  1LQM B;  2H0H A;  3I0Y A;  4HM8 B;  2H0G A;  9RNT A;  5IEN A;  1IYY A;  1VQ8 3;  1F8N A;  2RGQ A;  1RRH A;  1STD A;  2RNT A;  3RDE A;  4LGQ A;  3NBJ A;  2OQE C;  1ULI B;  2Q07 A;  4ILF A;  1YI2 3;  3UJM A;  5M19 A;  3OW2 2;  1J2B A;  1DMM A;  1A2P A;  3WHO A;  1GOY A;  1R4C A;  1STF I;  4BTY A;  3F8X A;  1ULJ B;  3NV0 B;  4LMI A;  4LSO A;  2OTL 3;  4CPK A;  3KZT A;  1X1X A;  3DMC A;  5D83 A;  2WOF A;  3T8N A;  3BNB A;  2BO9 B;  3OUR B;  2GU3 A;  2OQE A;  3VGN A;  7RNT A;  3B7C A;  5AII A;  1LXE A;  4K1U A;  4AEQ A;  1LOX A;  4XBY A;  1FGO A;  1VQM 3;  1AQZ A;  1UGH I;  4ORL A;  2KAA A;  1YVB I;  2XFT A;  3T0U A;  4AKY A;  1B2U A;  1JB5 A;  1LQG C;  2JQ5 A;  5CLK A;  3STD A;  1IVX A;  1ZS7 A;  2KF4 A;  2B24 B;  3WA2 X;  1B20 A;  1NU3 A;  1RN1 A;  2R41 A;  3GZB A;  5AEU B;  1Q7H A;  1GLB F;  2ZL8 A;  3FF0 A;  3WOD G;  2B13 A;  4J9A A;  3LZA A;  1X1W A;  1KC8 4;  4O2H A;  1WMP A;  6STD A;  5ELU A;  1UI8 A;  1K28 A;  1I0X A;  1N5H A;  4J5G A;  4R9L A;  4K90 B;  1O7W B;  1FW7 A;  4H3U A;  2XRX B;  1L5G B;  4BTW A;  1BRH A;  2K0M A;  4AKZ A;  3GZR A;  3VSY A;  1O7H B;  1BU4 A;  1BNG A;  1QJG A;  1IV9 A;  2CK3 H;  2YFJ B;  4HM2 B;  1VQK 3;  3A76 A;  2BMO B;  2ZDJ A;  2ML6 A;  1VQL 3;  1EUI C;  1SJW A;  2HML B;  1M1K 4;  3LTB A;  4HM6 B;  1GMR A;  1K73 4;  3D4A A;  1RJO A;  3Q3F A;  8CHO A;  1FYS A;  3KSE D;  5IG4 A;  2ML5 A;  5RNT A;  1ROA A;  6GSP A;  2P0M A;  1B2S A;  3AGN A;  1TFK A;  4EV2 A;  1BNJ A;  2QIY A;  3TUF B;  1UCJ A;  1UUG B;  4EW5 A;  1M90 4;  4IPB A;  2BU4 A;  1FGR A;  3NBR A;  1EQK A;  1Y4K A;  4L8P A;  1C7H A;  2WGO A;  1CYU A;  4HJL B;  1N8Q A;  1JV2 B;  1NDO B;  1YIJ 3;  3AHS A;  1TU5 A;  4N6V 0;  3B8L A;  2KF6 A;  1FZU A;  2P05 A;  1W5Z A;  3ER7 A;  4TX4 A;  2CFK A;  3BU4 A;  3G16 A;  1B2Z A;  3S29 A;  3Q90 A;  3SOA A;  4N3V A;  1RRL A;  2L4V A;  2C4B A;  1GLE F;  3UL6 A;  3LT9 A;  3QRD A;  3SX1 A;  1IQY A;  1JNQ A;  4XDW A;  1VQ7 3;  3UZ0 B;  3EN8 A;  3Q1C A;  1WQL B;  3TDG A;  4EBG A;  5EQL A;  1RLS A;  4HBR A;  3GSP A;  3J7Y d;  2XH9 A;  1E97 A;  2D42 A;  4WFO A;  1AX3 A;  4JF8 A;  1FUW A;  3X40 A;  1SPU A;  3K7C A;  3RNT A;  2Y73 A;  3PCS A;  1SAR A;  3URP A;  2MF7 A;  2SBL A;  2W04 A;  3WMD A;  3WA3 A;  4HM0 B;  4O8S A;  3LT8 A;  4STD A;  4BL2 A;  1IT8 A;  1RGH A;  5BIR A;  3I55 3;  2XSH B;  1MWR A;  3BIR A;  4DKI A;  1JKG A;  3CNM A;  2CH9 A;  3NQZ A;  4H61 A;  4RBN A;  5G1K A;  2RCD A;  2XGN A;  4MMX B;  2P09 A;  5AIG A;  1UDI I;  3KE7 A;  2XF3 A;  1Q86 4;  2W9P A;  4HVN A;  1QAF A;  5HOH A;  3SVA A;  1RSN A;  1RGL A;  3B4P A;  1Q82 4;  2ZA4 A;  3PS8 A;  2UGI A;  2GPR A;  1FGQ A;  3CC4 3;  1BOX A;  1FGM A;  3FG4 A;  3N8B A;  1MNL A;  2Z6B A;  1NB5 I;  1BNI A;  2KF3 A;  3CCE 3;  1LNI A;  4JBW M;  1JJ2 2;  1RDS A;  2F3G A;  2F5W A;  1NO3 A;  3NXJ A;  3UL5 A;  2B1X B;  5DRE A;  3WR2 A;  2KF5 A;  1TUH A;  3HII A;  1PU4 A;  4N6T A;  2HMM B;  3IJE B;  1BVI A;  4HYZ A;  4K61 A;  1GMQ A;  1SQW A;  1IVU A;  1B21 A;  1DVD A;  1GD3 A;  1US1 A;  5JBS A;  1GLA F;  2IUK A;  4LZI A;  5BVB A;  5KVP A;  1YJN 3;  1VQ4 3;  4R80 A;  1O2F A;  1IT7 A;  4KFF A;  4PEJ A;  3KKG A;  1LOW A;  3DXO A;  1CQS A;  2C10 A;  2OCT A;  3SYU A;  2IY2 A;  5IG0 A;  1K9M 4;  3CCS 3;  1UUW B;  3EF8 A;  1OCV A;  1Q40 B;  1GY6 A;  2WGQ A;  4MMY B;  1X1U A;  2V1L A;  4FCZ A;  2MC8 A;  1DYU A;  3X3Y A;  3EX9 A;  1OPY A;  2CFW A;  3K5T A;  3ZG5 A;  1VQ6 3;  5AYR B;  1OUN A;  1UUV B;  3PCR A;  4L7K A;  4OK0 A;  4N6U A;  5HGR A;  3OX9 A;  5B0H A;  2FNQ A;  2W6J H;  3HX8 A;  1JN5 B;  3PYJ A;  2P38 A;  3FF2 A;  4WWU C;  3KCH A;  4BU4 A;  3G6E 3;  3CU3 A;  3H51 A;  7STD A;  1BSB A;  1JN5 A;  3DH2 A;  4LEH A;  3OWS A;  5D82 A;  3O8Y A;  1MWT A;  1QAK A;  3HZP A;  1Z1S A;  3I56 3;  5CF1 A;  3LYG A;  1LNH A;  1RCL A;  3E99 A;  3L0R A;  1QMA A;  3OV4 A;  1ASK A;  4KZ1 A;  4R9K A;  3F9S A;  5IER A;  3BLZ A;  3CD6 3;  1W6Y A;  3BB9 A;  1OHS A;  3NX0 A;  3OXA A;  5A0O B;  1IU7 A;  1BNS A;  3S5C A;  1VQ5 3;  3M8C A;  5EEO A;  1Q42 A;  1LOV A;  1PY3 A;  2UX0 A;  2SAR A;  2HSI A;  1CH0 A;  4XBX A;  2P0X A;  1DE3 A;  3F14 A;  1GYB A;  1BRI A;  1GSP A;  3MSO A;  1VQP 3;  1T3B A;  2YFL B;  1ZX2 A;  3F40 A;  2F5M A;  4MEI A;  2RBI A;  1B27 A;  4I5Q A;  5IF6 A;  2GU1 A;  1QAL A;  2BMR B;  1RGA A;  4HOH A;  1KQS 2;  1RNB A;  1A2K A;  1K41 A;  2GXF A;  1RGF A;  3AMO B;  5DRV A;  1YHQ 3;  3A5E A;  1CYV A;  4O02 B;  5AYS C;  1TJD A;  4ZYB A;  3D9R A;  2UUG C;  3S28 A;  1TFO A;  3EC9 A;  2CIU A;  4NPB A;  1AVK A;  2XGL A;  3EQQ B;  3MG1 A;  1JBT A;  1IV7 A;  1OHO A;  4GB5 A;  1W2Z A;  1D6U A;  1JB4 A;  3CCR 3;  5IEP A;  1V57 A;  1BGS A;  3HI7 A;  5AI1 A;  1KD1 4;  3V98 A;  1VQO 3;  1BSA A;  3LOY A;  4R1K A;  6RNT A;  5AIH A;  3EB8 A;  5TGN A;  1D6Z A;  3ZFZ A;  4FCJ A;  3MWZ A;  1T2H A;  2CG1 A;  2OTJ 3;  4MMZ B;  3EBY A;  3FSD A;  1QWY A;  1B2X A;  3WDG B;  1BUJ A;  3CCJ 3;  1MGR A;  4FMB A;  1I8V A;  2CWV A;  3GZX B;  3MKI A;  2OOV C;  3OWY A;  1GS3 A;  1EA2 A;  2HOH A;  3H3H A;  4EC6 A;  1MWS A;  1BSC A;  1V74 A;  3LTA A;  2HMJ B;  1HZ1 A;  1MWU A;  2W56 A;  5LC6 A;  1JZD A;  2QGU A;  1YJW 3;  3D79 A;  3JUP A;  1DET A;  2CWT A;  1AY7 A;  4WYK B;  4HZ9 B;  3AGO A;  5LC7 A;  2XEP A;  4EYC A;  4CJN A;  3SLU A;  1BSD A;  7GSP A;  1NWW A;  3RGA A;  1E3R A;  1TIJ A;  3WOE B;  3KN4 A;  1JBS A;  2JDI H;  2STD A;  2OOV A;  1YIT 3;  2BNG A;  1G0T A;  2F86 B;  3IMA B;  2CHC A;  1LVN A;  3MPH A;  1T2I A;  3PXM A;  1B2M A;  4JRF A;  1RMS A;  1WNH A;  1N9J A;  4N6O B;  1ROV A;  1JRQ A;  1F3G A;  4QWT A;  5ELJ A;  2WOH A;  1D6Y A;  1SIH A;  3ALA A;  3F7X A;  2FXT A;  3D3L A;  1BRS A;  1UCI A;  2LYX A;  3UNL A;  1VQ9 3;  1C54 A;  1YVS A;  4KFD A;  4LYL B;  5EVH A;  3VF1 A;  5IG3 A;  1I2E A;  3NBB A;  2GBW B;  3DZL A;  3SED A;  1JB2 A;  1O7G B;  1RN4 A;  1TTO A;  2HMO B;  4J8T A;  1UI7 A;  3GZY B;  4BH5 A;  2J8X B;  3DGO A;  1I3I A;  1BRN L; 
#chains in the Genus database with same CATH homology
 2Y74 A;  3BND A;  5BXQ A;  1W4N A;  4IIA A;  3DGL A;  5IG5 A;  1GLC F;  1PFP A;  2CFD A;  3OWU A;  4BTX A;  4QP5 A;  2XR8 B;  3DY5 A;  3GAX A;  2PNC A;  2W56 B;  2IUJ A;  3V92 A;  2CW9 A;  3BNE A;  3EBT A;  1W01 A;  1Q81 4;  3NM2 A;  3S27 A;  3FH1 A;  2KXG A;  1GY5 A;  2Z77 A;  1OF5 B;  4U13 A;  3CCL 3;  3IPT A;  4CCV A;  1FGT A;  3X3X A;  1WMO A;  4N6N B;  2YFI B;  3HK4 A;  3KII A;  4HM7 B;  2KRT A;  1OGZ A;  1OH0 A;  1A67 A;  1HU9 A;  1DMQ A;  2QEX 3;  3DGM A;  1WTH A;  4OUQ A;  2D1W A;  4HM1 B;  4GL6 A;  1YJ9 3;  3FLJ A;  4K1V A;  2BHM A;  3NYY A;  2W03 A;  3BNC A;  1U5O A;  1W7C A;  4G1M B;  3DM8 A;  4IT7 A;  1Q7Y 4;  4RNZ A;  1GY7 A;  2I9W A;  3Q2P A;  1SII A;  1QVG 2;  2MP0 B;  4R4K A;  5FGO A;  3S67 A;  1S5A A;  3F8H A;  1ISK A;  3N9H A;  1IQ8 A;  2CFL A;  3NUV A;  2A15 A;  3MHE A;  3MG2 A;  2M7O A;  1TP6 A;  1JKG B;  1NB3 I;  4FMD A;  5KP4 A;  1A90 A;  2RSX A;  1T5Y A;  3NHX A;  3QK9 A;  4HM5 B;  3GRD A;  5STD A;  1WMN A;  4RNY A;  5KP3 A;  1O7N B;  1OHP A;  3G4S 3;  1W6C A;  3JVC A;  3KSP A;  3LTD A;  1A2V A;  3EJV A;  5IEO A;  3CCQ 3;  2C11 A;  1OAC A;  4XBT A;  1DMN A;  1G96 A;  3EN1 B;  3CCM 3;  3G8Z A;  1VQN 3;  2RFR A;  2KCD A;  3JUO A;  2BMQ B;  2R4I A;  4HKV B;  5FW5 A;  1GPR A;  2Z76 A;  2K54 A;  3ECF A;  3NQY A;  4X2H A;  1CEW I;  1F3Z A;  1UW1 A;  2E2T A;  3SOY A;  3GWR A;  2GBX B;  2XFS A;  5JPP A;  1QVF 2;  1YGE A;  5JPU A;  1N8R 4;  3DGN A;  1E3V A;  4X2O A;  3EE1 A;  4FCM A;  2GEY A;  3EHC A;  2B0P A;  2YX9 A;  1IDP A;  1Q40 A;  4CDL A;  3F7S A;  3CSQ A;  1M9G A;  3CC7 3;  3X3Z A;  3K9M C;  2CC3 A;  1MOL A;  1KSI A;  2CFG A;  2IA7 A;  3CPW 2;  1VZZ A;  4LXC A;  4WHA A;  4HM4 B;  3AMO A;  3LH4 A;  3G0K A;  1AVL A;  2GEX A;  2XSO B;  3FG1 A;  3X41 A;  3RGR A;  3JUN A;  4QPB A;  1O7M B;  4HZB B;  4I4K A;  3WOF B;  2W2C A;  4WYK A;  5AIF A;  1RN7 A;  3CCV 3;  3CNX A;  1OGX A;  3X42 A;  2IMJ A;  1ZO2 A;  1AR0 A;  2CKF B;  5D81 A;  4FR9 A;  4HM3 B;  4WP5 A;  1N9E A;  4EV5 A;  3HIG A;  4XDV A;  3MYT A;  4O3V A;  5CF2 A;  3JUM A;  3DUK A;  1IK3 A;  3U97 A;  2HMN B;  2B44 A;  3G71 3;  1BUQ A;  1DVC A;  3PZW A;  3N54 B;  2W9Q A;  1NJI 4;  3CXC 2;  4RZM A;  2CWU A;  1GLD F;  1AV4 A;  2E2U A;  1KWI A;  4Q53 A;  2LQV A;  3B4O A;  1GGR A;  3LTC A;  3K0Z A;  2E2V A;  1HKX A;  2INX A;  1M1X B;  1U8C B;  4N6L A;  3PGB A;  2FGT A;  5IW9 A;  2OWP A;  2W0Q A;  3NV0 A;  3FKA A;  2PZV A;  4MJD A;  2BT3 A;  5CXO A;  3U1W A;  1FA3 A;  3LML A;  4FMA A;  1IVV A;  2HMK B;  3FGY A;  1OF5 A;  4NHF A;  3MG3 A;  2QA4 3;  3ROB A;  1RKY A;  4ZM8 A;  3UB1 A;  1IQX A;  1EG9 B;  3FZW A;  3V99 A;  1K8A 4;  4N6M A;  3CCU 3;  1W00 A;  4FMC A;  2F99 A;  5CK6 A;  5I97 A;  4KFE A;  2CG0 A;  3T8U A;  1GD4 A;  3K63 A;  2Z7A A;  3KFQ C;  2WO0 A;  4L8O A;  1S72 3;  5KP1 A;  1N5P A;  1EKM A;  4NRE A;  3CME 3;  3CMA 3;  1W6G A;  1W2B 2;  4XM4 A;  1W02 A;  1O7P B;  3SXX A;  3IT5 A;  3IT7 A;  3FCS B;  2F98 A;  3CC2 3;  5G2G A;  2O9U X;  3NM7 A;  1IVW A;  4XB5 A;  3CPO A;  3JUQ A;  2O3O A;  4KVH A;  4OVM A;  5AEW B;  3LXU X;  4EXR A;  3I0Y A;  4HM8 B;  5IEN A;  1VQ8 3;  1F8N A;  2RGQ A;  1RRH A;  1STD A;  3RDE A;  4LGQ A;  3NBJ A;  2OQE C;  1ULI B;  2Q07 A;  1YI2 3;  3UJM A;  3OW2 2;  1J2B A;  1DMM A;  1R4C A;  1STF I;  4BTY A;  3F8X A;  1ULJ B;  3NV0 B;  4LMI A;  4LSO A;  2OTL 3;  3KZT A;  5D83 A;  3DMC A;  2WOF A;  3T8N A;  3BNB A;  2BO9 B;  3OUR B;  2GU3 A;  2OQE A;  3VGN A;  3B7C A;  5AII A;  1LXE A;  4K1U A;  4AEQ A;  1LOX A;  4XBY A;  1FGO A;  1VQM 3;  4ORL A;  1YVB I;  2XFT A;  3T0U A;  4AKY A;  5CLK A;  1JB5 A;  2JQ5 A;  3STD A;  1IVX A;  2B24 B;  3WA2 X;  1NU3 A;  3GZB A;  5AEU B;  1GLB F;  2ZL8 A;  3FF0 A;  3WOD G;  2B13 A;  4J9A A;  3LZA A;  1KC8 4;  4O2H A;  1WMP A;  6STD A;  5ELU A;  1UI8 A;  1K28 A;  1N5H A;  4R9L A;  4K90 B;  1O7W B;  4H3U A;  2XRX B;  1L5G B;  4BTW A;  2K0M A;  4AKZ A;  3GZR A;  3VSY A;  1O7H B;  1QJG A;  2YFJ B;  1IV9 A;  2CK3 H;  4HM2 B;  1VQK 3;  3A76 A;  2BMO B;  2ZDJ A;  2ML6 A;  1VQL 3;  1SJW A;  2HML B;  1M1K 4;  3LTB A;  4HM6 B;  1K73 4;  1RJO A;  8CHO A;  3KSE D;  5IG4 A;  2ML5 A;  1ROA A;  2P0M A;  1TFK A;  4EV2 A;  2QIY A;  3TUF B;  1M90 4;  4IPB A;  1FGR A;  3NBR A;  1EQK A;  1Y4K A;  4L8P A;  1C7H A;  2WGO A;  1CYU A;  4HJL B;  1N8Q A;  1JV2 B;  1NDO B;  1YIJ 3;  1TU5 A;  4N6V 0;  3B8L A;  2P05 A;  3ER7 A;  1W5Z A;  4TX4 A;  2CFK A;  3G16 A;  3S29 A;  3Q90 A;  3SOA A;  4N3V A;  1RRL A;  2L4V A;  3UL6 A;  1GLE F;  3LT9 A;  3QRD A;  3SX1 A;  1IQY A;  1JNQ A;  4XDW A;  1VQ7 3;  3UZ0 B;  3EN8 A;  3Q1C A;  1WQL B;  3TDG A;  4EBG A;  5EQL A;  4HBR A;  3J7Y d;  2XH9 A;  1E97 A;  2D42 A;  4WFO A;  1AX3 A;  4JF8 A;  1FUW A;  3X40 A;  1SPU A;  3K7C A;  2Y73 A;  3PCS A;  2MF7 A;  2SBL A;  2W04 A;  3WMD A;  3WA3 A;  4HM0 B;  4O8S A;  3LT8 A;  4STD A;  1IT8 A;  3I55 3;  2XSH B;  1JKG A;  3CNM A;  2CH9 A;  3NQZ A;  4H61 A;  4RBN A;  2RCD A;  2XGN A;  4MMX B;  2P09 A;  5AIG A;  3KE7 A;  2XF3 A;  1Q86 4;  2W9P A;  4HVN A;  1QAF A;  3SVA A;  1Q82 4;  3B4P A;  3PS8 A;  2GPR A;  1FGQ A;  3CC4 3;  3FG4 A;  1FGM A;  3N8B A;  1MNL A;  2Z6B A;  1NB5 I;  3CCE 3;  4JBW M;  1JJ2 2;  2F3G A;  1NO3 A;  3NXJ A;  3UL5 A;  2B1X B;  5DRE A;  1TUH A;  3HII A;  1PU4 A;  4N6T A;  2HMM B;  3IJE B;  4HYZ A;  4K61 A;  1SQW A;  1IVU A;  1DVD A;  1GD3 A;  1US1 A;  5JBS A;  1GLA F;  2IUK A;  4LZI A;  5BVB A;  5KVP A;  1YJN 3;  1VQ4 3;  4R80 A;  1O2F A;  1IT7 A;  4KFF A;  4PEJ A;  3KKG A;  3DXO A;  1CQS A;  2C10 A;  2OCT A;  5IG0 A;  1K9M 4;  3CCS 3;  1UUW B;  3EF8 A;  1OCV A;  1Q40 B;  1GY6 A;  2WGQ A;  4MMY B;  2V1L A;  4FCZ A;  2MC8 A;  1DYU A;  3X3Y A;  3EX9 A;  2CFW A;  1OPY A;  3K5T A;  1VQ6 3;  5AYR B;  1OUN A;  1UUV B;  3PCR A;  4L7K A;  4OK0 A;  4N6U A;  5HGR A;  3OX9 A;  5B0H A;  2FNQ A;  2W6J H;  3HX8 A;  1JN5 B;  3PYJ A;  2P38 A;  3FF2 A;  4WWU C;  3G6E 3;  3CU3 A;  3H51 A;  7STD A;  1JN5 A;  4LEH A;  5D82 A;  3OWS A;  3O8Y A;  1QAK A;  3HZP A;  1Z1S A;  3I56 3;  5CF1 A;  3LYG A;  1LNH A;  3E99 A;  3L0R A;  1QMA A;  3OV4 A;  1ASK A;  4KZ1 A;  4R9K A;  3F9S A;  5IER A;  3BLZ A;  3CD6 3;  1W6Y A;  3BB9 A;  1OHS A;  3NX0 A;  3OXA A;  5A0O B;  1IU7 A;  3S5C A;  1VQ5 3;  3M8C A;  5EEO A;  1Q42 A;  2UX0 A;  2HSI A;  4XBX A;  2P0X A;  3F14 A;  1GYB A;  3MSO A;  1VQP 3;  2YFL B;  3F40 A;  1ZX2 A;  4MEI A;  5IF6 A;  2GU1 A;  1QAL A;  2BMR B;  1KQS 2;  1A2K A;  1K41 A;  2GXF A;  3AMO B;  5DRV A;  1YHQ 3;  1CYV A;  4O02 B;  5AYS C;  4ZYB A;  3D9R A;  3S28 A;  1TFO A;  3EC9 A;  2CIU A;  1AVK A;  2XGL A;  3EQQ B;  3MG1 A;  1IV7 A;  1OHO A;  4GB5 A;  1W2Z A;  1D6U A;  1JB4 A;  3CCR 3;  5IEP A;  3HI7 A;  5AI1 A;  1KD1 4;  3V98 A;  1VQO 3;  3LOY A;  4R1K A;  5AIH A;  3EB8 A;  5TGN A;  1D6Z A;  4FCJ A;  3MWZ A;  2CG1 A;  2OTJ 3;  4MMZ B;  3EBY A;  3FSD A;  1QWY A;  3WDG B;  3CCJ 3;  4FMB A;  2CWV A;  3GZX B;  3MKI A;  2OOV C;  3OWY A;  1GS3 A;  1EA2 A;  3H3H A;  4EC6 A;  1V74 A;  3LTA A;  2HMJ B;  2W56 A;  5LC6 A;  2QGU A;  1YJW 3;  3JUP A;  2CWT A;  4WYK B;  4HZ9 B;  5LC7 A;  4EYC A;  2XEP A;  3SLU A;  1NWW A;  3RGA A;  1E3R A;  1TIJ A;  3WOE B;  3KN4 A;  2JDI H;  2STD A;  2OOV A;  1YIT 3;  2BNG A;  2F86 B;  3IMA B;  2CHC A;  1LVN A;  3MPH A;  3PXM A;  4JRF A;  1WNH A;  1N9J A;  4N6O B;  1ROV A;  1JRQ A;  1F3G A;  4QWT A;  5ELJ A;  2WOH A;  1D6Y A;  3ALA A;  1SIH A;  3F7X A;  2FXT A;  3D3L A;  3UNL A;  2LYX A;  1VQ9 3;  4KFD A;  3VF1 A;  5EVH A;  5IG3 A;  3NBB A;  2GBW B;  3DZL A;  3SED A;  1JB2 A;  1O7G B;  2HMO B;  4J8T A;  1UI7 A;  3GZY B;  4BH5 A;  3DGO A;  3FG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...