4RNZA

Structure of helicobacter pylori csd3 from the hexagonal crystal
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
369
structure length
359
Chain Sequence
b'MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGFLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical secreted protein
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 100
structure length 359
sequence length 369
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnzA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnzA02
1AX3A 5B0HA 1F3GA 1O2FA 2GU1A 3CSQA 2HSIA 2F3GA 1QWYA 3NYYA 3SLUA 1F3ZA 1GLAF 1GPRA 4QPBA 1GLCF 2B13A 4RNZA 2B0PA 1GLBF 4RNYA 2GPRA 4BH5A 2B44A 1GGRA 3UZ0B 3IT5A 4ZYBA 4QP5A 3TUFB 1GLEF 3OURB 5KVPA 3IT7A 2MP0B 4LXCA 1GLDF 4JBWM
chains in the Genus database with same CATH superfamily
4MJDA 1Q7Y4 1RGGA 4FMCA 1E3RA 3NX0A 2F56A 1BRSA 2F3GA 3WA2X 5HOHA 5IG5A 1FA3A 1I3IA 2ML5A 1DMMA 1VQO3 1NJI4 4FCJA 1BNJA 3LTBA 3EBTA 4OK0A 1GPRA 3OW22 4BTXA 5CXOA 3FG3A 3EX9A 3VSYA 1X1UA 1A2VA 1BNFA 1U8CB 2F5WA 1B2MA 1DMNA 2M7OA 1RN4A 2C10A 5RNTA 1BNGA 2ML6A 9RNTA 1IT8A 1STFI 1U5OA 1JJ22 1JRQA 1YI23 2OTL3 1KQS2 2JDIH 3IT7A 5IEOA 3FF2A 1JZDA 3OURB 1MGRA 2OOVC 1Q7HA 3D5GA 4IT7A 5ELJA 1Q814 1VQ83 1J2BA 2OOVA 1RGKA 3GAXA 4O3VA 2HSIA 1G02A 1GMRA 1I0XA 4WWUC 1RN7A 3EN1B 1O7MB 1BSEA 1UCJA 2W6JH 3EB8A 3Q2PA 4N6UA 2INXA 1WQLB 4XBXA 1AQZA 2XGLA 4XBYA 3X41A 3ER7A 1ISKA 1IT7A 1BRIA 4EV2A 1F8NA 2CWUA 2OQEC 4BH5A 1FGOA 1HYFA 2B44A 2B24B 5DREA 1JKGB 1RGFA 1ZX2A 3LZAA 2OQEA 5IERA 5AEUB 5IG0A 2HMLB 4MMZB 5EVHA 4N3VA 2BO9B 2OTJ3 1QALA 2STDA 1RGAA 3JVCA 3FZWA 5EQLA 3UL6A 5IENA 3CCQ3 1A90A 3HIGA 1RRLA 1W01A 4CCVA 1X1YA 2LQVA 4LXCA 2CFGA 2BT3A 2SBLA 5FGOA 1RJOA 1GLDF 1RSNA 1WMPA 5BVBA 1AX3A 1BVIA 1YNVX 5IF6A 1UGIA 1N5HA 3N9HA 1STDA 4OUQA 1QWYA 1RRHA 3PS8A 2LYXA 1GY5A 2R4IA 2RGQA 2CWVA 3KN4A 4JRFA 4XDVA 1D6ZA 5JPPA 3CNXA 3JUMA 1K28A 4WYKB 4EW5A 2Z7AA 3U97A 3NQYA 1A2KA 3GZRA 1VQ93 1KD14 3D79A 4I4KA 4TX4A 4MEIA 1RKYA 1VQ43 5IW9A 1T3BA 3LT8A 1QJGA 1AY7A 4HOHA 1B2XA 2PZVA 1GOVA 4QWTA 3SX1A 5AYRB 1VQN3 3DGNA 1I2GA 1G96A 3NV0A 1YJN3 1FGRA 5AIGA 2JQ5A 4EYCA 5GSPA 2BMRB 4BL2A 3LOYA 1JN5B 4HZ9B 6RNTA 1DMQA 4JF8A 3ECFA 1N9JA 3Q3FA 4FMDA 1LVNA 4FMAA 1N8R4 1W6YA 3DGYA 2XFSA 1NDOB 3DZLA 3CC43 2Y73A 2YFLB 2MC8A 4U13A 3DH2A 3PCRA 1GD3A 2H0HA 2UGIA 3D4AA 2XSHB 3GWRA 3KZTA 4L8OA 1B20A 3WDGB 3IJEB 1BNSA 4LEHA 4WP5A 1N5PA 3K7CA 4ORLA 3WR2A 2CC3A 3IPTA 1VQP3 3TUFB 1FGMA 5EEOA 1RLSA 3S5CA 1Q864 1BIRA 1CYVA 3CCE3 5KVPA 2FXTA 1N9EA 3ALAA 1O7NB 4JBWM 4AKYA 3B4OA 1YHQ3 1SIIA 1MOLA 2RSXA 3CU3A 1K41A 3PGBA 3OXAA 1PU4A 3RDEA 1LNHA 4GSPA 2CK3H 1MWRA 3GRDA 1QAFA 4L8PA 3K9MC 3X42A 1NNVA 3GZYB 1BRGA 2V1LA 2GBWB 1MWUA 2CG0A 2I9WA 4GB5A 4HM7B 2WGQA 5BU4A 3MHEA 1YGEA 4J8TA 2BIRA 2QIYA 5DRVA 4R9KA 3NM7A 1RGHA 8RNTA 1V58A 1W2B2 1R4CA 1O7GB 3DXOA 5IG4A 1RGEA 1BANA 1NB3I 2YFJB 1B2SA 3KSED 3BIRA 1A67A 1T5YA 3FKAA 1BAOA 1Y4KA 3GZXB 4NREA 3ZFZA 3WMDA 3AHWA 2RBIA 1IU7A 1LRAA 2F99A 1AV4A 1IVVA 3X3YA 2GU1A 5D82A 3L0RA 2WO0A 1VQK3 2OCTA 1IQXA 1W00A 1YVBI 3MG1A 5STDA 3WA3A 2Z6BA 1WMOA 1Q40A 2ZHXB 3NQZA 3PYJA 1BGSA 4HM0B 2A15A 4I5QA 3JUPA 3BNCA 4HM4B 1QAKA 4N6OB 5M18A 1FW7A 1UI8A 2AADA 4N6NB 2B13A 1BOXA 1LOYA 3IMAB 4GHOA 3WOFB 5KP4A 3CCR3 3EE1A 2CX0A 2WGOA 5D81A 3J7Yd 1JB2A 2BNGA 1GOYA 1GMPA 2CWTA 3I553 1IVUA 1UI7A 1UCIA 3KE7A 4HAAA 1UW1A 1LXEA 3F40A 2MP0B 1GOUA 2GSPA 3MPHA 5AIHA 4RBNA 3CC23 2W03A 1B2UA 1ASKA 2HMKB 3AMOA 3N8BA 1ULIB 4BL3A 1RTUA 3X3XA 1RN1A 2XFTA 1LNIA 1F3GA 2BU4A 2E2TA 3FF0A 3NBRA 1QVF2 5KP3A 4FR9A 1YJW3 1DYUA 1L5GB 3RNTA 3SOYA 3G713 4IIAA 3CCS3 1LQGC 2O3OA 3DM8A 2L1SA 1RNBA 4QPBA 1IDPA 3E99A 1GLCF 2XEPA 4K1UA 4X2HA 2W9QA 3NBBA 2YX9A 4IPBA 3EJVA 2ZA4A 5JPUA 1K9M4 3JUQA 4CPKA 3UZ0B 1IV9A 1RHLA 1W2ZA 4EXRA 2F4YA 4WFOA 6STDA 3HI7A 3D5IA 1AVKA 2P38A 2RCDA 3DY5A 3OWUA 4FMBA 3A76A 3B4PA 4MMYB 1BSBA 5KP1A 2YFIB 3S29A 2CHCA 1YVSA 3LXUX 1W02A 3K63A 4K90B 3UNLA 5A0OB 3CXC2 3JUOA 3F7SA 3LT9A 3OWYA 2SARA 4KT3B 2C4BA 2E2VA 2QGUA 1OACA 2KF6A 2W56B 3F9SA 3QRDA 4BTWA 5AEWB 1VQL3 1BRHA 2CH9A 1ULJB 4KVHA 1B2ZA 1T2HA 2F86B 4RNYA 3DGLA 3F14A 1E97A 2XH9A 1JV2B 3LTAA 3CCU3 3QK9A 2C11A 1CH0A 1B21A 3NHXA 1RCLA 5IEPA 3CC73 3CCJ3 4EV5A 3RGRA 2OWPA 1OF5B 3F7XA 2PNCA 1AVLA 1OHOA 3URPA 4CDLA 3OX9A 5HGRA 1YIJ3 1JBRA 5B0HA 2CX1A 3MYTA 1NO3A 2HMNB 1QVG2 3UL5A 1BNEA 3EBYA 1EUIC 1GD4A 3ZG0A 1ROAA 2ZDJA 1YJ93 3O8YA 4J9AA 2H0GA 3TDGA 3FSDA 1O7HB 3ZG5A 2CKFB 3A5EA 1SPUA 3RGAA 1JKGA 1OHSA 4ZYBA 1A2PA 1OPYA 2W04A 1GLEF 1I0VA 3G6E3 3HIIA 3NXJA 1DVCA 2IUKA 4HVNA 2L4VA 1FUTA 2CIUA 2FNQA 1ZO2A 5FW5A 3ROBA 4HBRA 5I97A 3G8ZA 3NBJA 3VGNA 5G2GA 1JBTA 3SOAA 1VQM3 1JB5A 4R1KA 1TFOA 3X40A 3EF8A 1SJWA 3FGYA 2Y74A 1T2IA 1TJDA 1ROVA 1O2FA 1I70A 2D42A 2QA43 1EEJA 2F98A 3BNDA 2IUJA 3UJMA 3WHOA 1AR0A 2P0MA 2Z76A 4O02B 2W56A 1I2FA 1DVDA 3BU4A 2P09A 4WYKA 1IQYA 1M9GA 3PCSA 3EHCA 2HMJB 3BNEA 1WMNA 1GLBF 2KAAA 2O9UX 4LZIA 4LGQA 1IV7A 4LSOA 3KKGA 2IYJA 3B7CA 3D3LA 2H0IA 1UUWB 3JUNA 1S5AA 3GSPA 1IVWA 4XM4A 3SEDA 3KIIA 3T8NA 2BHMA 3F8XA 2RNTA 1PY3A 3G4S3 4O2HA 3BB9A 7STDA 2UX0A 1GY7A 1JN5A 1KSIA 1LOXA 1RDSA 2K54A 1ZS7A 1MGWA 3WOEB 3CMA3 1VQQA 2WOFA 2CG1A 1MNLA 1UCLA 1NU3A 1W4NA 1C7HA 1UDII 1WTHA 4NPBA 1TRQA 3F8HA 3S28A 2E2UA 5BXQA 1TFKA 3CPOA 3SXXA 5CF2A 5BIRA 5AI1A 1PFPA 3PZWA 8CHOA 1IYYA 1ZGXA 3HX8A 7RNTA 2W9PA 4HM3B 1X1XA 3VF1A 1JBSA 3OWSA 2AAEA 3DGOA 1BUJA 2HMOB 4K61A 1JZOA 4HYZA 4J5KA 1RCKA 2BMOB 3STDA 1TUHA 3NUVA 5CLKA 5LC7A 3CPW2 3HOHA 1V57A 1GYBA 2KRTA 3CSQA 3KFQC 1LOWA 1GS3A 2W2CA 4HM1B 3Q1CA 2K3DA 2Z77A 1SIHA 4GL6A 3SLUA 1V74A 1WNHA 4FCMA 1BRJA 2GXFA 3DUKA 4XB5A 5M19A 3LYGA 3S67A 1FGQA 1TU5A 4FCZA 5CF1A 2KF4A 4N6TA 2BMQB 4KFFA 1GGRA 1O7WB 3IT5A 1D6YA 1W5ZA 2Q07A 1UGHI 3I0YA 3NV0B 2HMMB 2KCDA 3NM2A 3FLJA 1I2EA 4XDWA 1YIT3 4EBGA 3CCV3 1M1K4 1UUVB 2GU3A 1HKXA 1M1XB 2P0XA 3HZPA 1Z1SA 4HJLB 1R4YA 4RZMA 1SQWA 5TGNA 3LTCA 2D1WA 3S27A 1EA2A 3MKIA 1G0TA 1D6UA 1OGXA 1SARA 3MG3A 4KFDA 4CJNA 1YGWA 1F3ZA 4KFEA 1GLAF 3HK4A 3LH4A 1UCKA 4BIRA 1FUWA 1Q9EA 3T0UA 1UUGB 1EQKA 1OUNA 1BRKA 1JB4A 1KWIA 3BLZA 3CME3 3WODG 1FYSA 2ZL8A 2GPRA 1I3FA 4G1MB 1W6CA 4H61A 3DGMA 1FZUA 2GBXB 2B1XB 3V98A 4AEQA 4L7KA 1JNQA 4N6MA 4HM2B 1N8QA 4HM6B 4Q53A 2WOHA 2CFKA 3FCSB 5JBSA 3MG2A 1CEWI 3U1WA 3FG1A 3NYYA 1GMQA 2MF7A 4R80A 1BRNL 2IY2A 5D83A 1VQ53 2J8XB 3G0KA 4O8SA 1VQ63 2CW9A 2P05A 3AGNA 3K0ZA 1BSCA 1BSAA 3T8UA 1TRPA 4HM5B 4XBTA 3UB1A 1IQ8A 5G1KA 3SVAA 2B0PA 3D9RA 1DE3A 4DKIA 2F5MA 1OCVA 3EQQB 3I563 4QP5A 1E3VA 3DMCA 2KF3A 3FH1A 3SYUA 3H3HA 1KC84 4STDA 5LC6A 4H3UA 1VZZA 1GY6A 4MMXB 1CQSA 3FG4A 1IK3A 3CCM3 1M904 1BSDA 6GSPA 1S723 1RNTA 1LQMB 2KF5A 1FGTA 2W0QA 4OVMA 1K8A4 1W7CA 1BUQA 4EC6A 3PXMA 2QEX3 2HOHA 3BNBA 5ELUA 2CFWA 4N6V0 1I8VA 1Q40B 1EG9B 1TTOA 1Q42A 2GEXA 3M8CA 5G1LA 5AYSC 3V99A 1BU4A 2R41A 3AHSA 3CNMA 3MWZA 2CFDA 4R4KA 4WHAA 1DETA 2K0MA 7GSPA 1NWWA 3KSPA 3B8LA 1GSPA 1OH0A 1X1WA 3EN8A 1EKMA 1TP6A 3GZBA 4NHFA 2FGTA 3G16A 1HU9A 5M1AA 1CYUA 1MWSA 2XR8B 3MSOA 1OHPA 5IG3A 3Q90A 4PEJA 1OF5A 5CK6A 1VQ73 3AMOB 2IMJA 3N54B 2GEYA 2UUGC 4ILFA 2KXGA 1IVXA 1C54A 1BNRA 3EC9A 4K1VA 5AIIA 4HKVB 4N6LA 1O7PB 3X3ZA 3OV4A 4HM8B 3KCHA 1BNIA 5AIFA 4J5GA 1RGCA 2CFLA 4LMIA 4RNZA 1NB5I 4LYLB 4R9LA 4ZM8A 1HZ1A 4X2OA 3K5TA 1RMSA 1RGLA 1OGZA 1LOVA 1US1A 1B27A 3LMLA 1MWTA 4BTYA 3CCL3 2XRXB 4AKZA 4BU4A 3V92A 1K734 3CD63 1FUSA 1TIJA 2XGNA 4KZ1A 3AGOA 3LTDA 4RNTA 1Q824 2RFRA 1QMAA 1PYLA 1W6GA 2XSOB 4HZBB 2IA7A 3H51A 1B3SA 2XF3A
chains in the Genus database with same CATH topology
4MJDA 1Q7Y4 4FMCA 1E3RA 3NX0A 2F3GA 3WA2X 2ML5A 1VQO3 1DMMA 1NJI4 4FCJA 3LTBA 3EBTA 4OK0A 1GPRA 3OW22 4BTXA 5CXOA 3FG3A 3EX9A 3VSYA 1A2VA 1U8CB 1DMNA 2M7OA 2C10A 2ML6A 1IT8A 1STFI 1U5OA 1JJ22 1JRQA 1YI23 2OTL3 1KQS2 2JDIH 3IT7A 5IEOA 3FF2A 3OURB 2OOVC 5ELJA 1VQ83 1Q814 4IT7A 1J2BA 2OOVA 3GAXA 4O3VA 2HSIA 4WWUC 1RN7A 3EN1B 1O7MB 2W6JH 3Q2PA 3EB8A 4N6UA 2INXA 1WQLB 4XBXA 2XGLA 4XBYA 3X41A 3ER7A 1ISKA 1IT7A 4EV2A 1F8NA 2CWUA 2OQEC 4BH5A 1FGOA 2B24B 2B44A 2OQEA 5DREA 1JKGB 1ZX2A 3LZAA 5IERA 5AEUB 5IG0A 2HMLB 4MMZB 5EVHA 4N3VA 2BO9B 2OTJ3 1QALA 2STDA 3JVCA 5EQLA 3FZWA 3UL6A 5IENA 3CCQ3 1A90A 3HIGA 1RRLA 1W01A 4CCVA 2LQVA 4LXCA 2CFGA 2BT3A 2SBLA 5FGOA 1RJOA 1GLDF 1WMPA 5BVBA 1AX3A 5IF6A 1N5HA 3N9HA 1STDA 4OUQA 1QWYA 1RRHA 3PS8A 2LYXA 1GY5A 2R4IA 2RGQA 2CWVA 3KN4A 4JRFA 4XDVA 1D6ZA 5JPPA 3CNXA 3JUMA 1K28A 4WYKB 2Z7AA 3U97A 3NQYA 1A2KA 3GZRA 1VQ93 1KD14 4I4KA 4TX4A 1RKYA 4MEIA 1VQ43 5IW9A 3LT8A 1QJGA 3SX1A 2PZVA 4QWTA 5AYRB 1VQN3 3DGNA 1YJN3 1G96A 3NV0A 1FGRA 5AIGA 2JQ5A 4EYCA 2BMRB 3LOYA 1JN5B 4HZ9B 1DMQA 4JF8A 3ECFA 1N9JA 4FMDA 4FMAA 1LVNA 1N8R4 1W6YA 2XFSA 1NDOB 3DZLA 3CC43 2Y73A 2YFLB 2MC8A 4U13A 3PCRA 1GD3A 2XSHB 3GWRA 3KZTA 4L8OA 3WDGB 3IJEB 4LEHA 4WP5A 1N5PA 3K7CA 4ORLA 1VQP3 2CC3A 3IPTA 3TUFB 1FGMA 5EEOA 1Q864 3S5CA 1CYVA 3CCE3 5KVPA 2FXTA 1N9EA 3ALAA 1O7NB 4JBWM 4AKYA 3B4OA 1YHQ3 1SIIA 1MOLA 2RSXA 3CU3A 1K41A 3PGBA 3OXAA 1PU4A 3RDEA 1LNHA 2CK3H 3GRDA 4L8PA 1QAFA 3K9MC 3X42A 3GZYB 2V1LA 2GBWB 2CG0A 2I9WA 4GB5A 4HM7B 2WGQA 3MHEA 1YGEA 4J8TA 5DRVA 2QIYA 4R9KA 3NM7A 1W2B2 1R4CA 1O7GB 3DXOA 5IG4A 1NB3I 2YFJB 3KSED 1A67A 1T5YA 3FKAA 1Y4KA 3GZXB 4NREA 3WMDA 1IU7A 2F99A 1AV4A 1IVVA 3X3YA 2GU1A 5D82A 3L0RA 2WO0A 1VQK3 2OCTA 1IQXA 1W00A 1YVBI 3MG1A 5STDA 3WA3A 2Z6BA 1WMOA 1Q40A 3NQZA 3PYJA 4HM0B 1K8A4 2A15A 3JUPA 3BNCA 4HM4B 1QAKA 4N6OB 1UI8A 4N6NB 2B13A 3IMAB 3WOFB 5KP4A 3CCR3 1FA3A 3EE1A 5D81A 2WGOA 3J7Yd 1JB2A 2BNGA 2CWTA 3I553 1IVUA 1UI7A 3KE7A 1UW1A 1LXEA 3F40A 2MP0B 3MPHA 5AIHA 3CC23 4RBNA 2W03A 3AMOA 1ASKA 2HMKB 3N8BA 1ULIB 3X3XA 2XFTA 1F3GA 2E2TA 3FF0A 3NBRA 1QVF2 5KP3A 4FR9A 1YJW3 1DYUA 1L5GB 3SOYA 3G713 4IIAA 3CCS3 2O3OA 3DM8A 4QPBA 1IDPA 3E99A 1GLCF 2XEPA 4K1UA 4X2HA 2W9QA 3NBBA 2YX9A 4IPBA 3EJVA 5JPUA 1K9M4 3JUQA 3UZ0B 1IV9A 1W2ZA 4EXRA 4WFOA 6STDA 3HI7A 1AVKA 2P38A 2RCDA 3DY5A 3OWUA 4FMBA 3A76A 3B4PA 4MMYB 5KP1A 2YFIB 3S29A 2CHCA 3UNLA 3LXUX 1W02A 3K63A 4K90B 3CXC2 3JUOA 3F7SA 3LT9A 3OWYA 2E2VA 2QGUA 1OACA 2W56B 3F9SA 3QRDA 4BTWA 5AEWB 1VQL3 2CH9A 1ULJB 4KVHA 2F86B 4RNYA 3DGLA 3F14A 1E97A 2XH9A 1JV2B 3LTAA 3CCU3 3QK9A 2C11A 3NHXA 5IEPA 3CC73 3CCJ3 4EV5A 3RGRA 2OWPA 1OF5B 3F7XA 2PNCA 1AVLA 1OHOA 4CDLA 1YIJ3 3OX9A 5HGRA 5B0HA 3MYTA 1NO3A 2HMNB 1QVG2 3UL5A 3EBYA 1GD4A 1ROAA 2ZDJA 1YJ93 3O8YA 4J9AA 3TDGA 3FSDA 1O7HB 2CKFB 1SPUA 3RGAA 1JKGA 1OHSA 4ZYBA 1OPYA 2W04A 1GLEF 3G6E3 3HIIA 3NXJA 1DVCA 2IUKA 4HVNA 2L4VA 5FW5A 2CIUA 2FNQA 1ZO2A 3ROBA 5I97A 4HBRA 3G8ZA 3NBJA 3VGNA 5G2GA 3SOAA 1VQM3 1JB5A 4R1KA 1TFOA 3X40A 3EF8A 1SJWA 3FGYA 2Y74A 1ROVA 1O2FA 2D42A 2QA43 2F98A 3BNDA 2IUJA 3UJMA 1AR0A 2P0MA 2Z76A 4O02B 2W56A 1DVDA 2P09A 4WYKA 1IQYA 1M9GA 3PCSA 3EHCA 2HMJB 3BNEA 1WMNA 1GLBF 4LZIA 2O9UX 4LGQA 1IV7A 4LSOA 3KKGA 3B7CA 3D3LA 1UUWB 3JUNA 1S5AA 4XM4A 1IVWA 3SEDA 3T8NA 3KIIA 2BHMA 3F8XA 3G4S3 4O2HA 3BB9A 7STDA 2UX0A 1GY7A 1JN5A 1KSIA 1LOXA 2K54A 3CMA3 3WOEB 2WOFA 2CG1A 1MNLA 1NU3A 1W4NA 1C7HA 1WTHA 5CF2A 3F8HA 3S28A 5BXQA 2E2UA 5JBSA 1TFKA 3CPOA 3SXXA 8CHOA 5AI1A 1PFPA 3PZWA 3HX8A 2W9PA 4HM3B 3VF1A 3OWSA 3DGOA 2HMOB 4K61A 4HYZA 2BMOB 3STDA 1TUHA 3NUVA 5CLKA 5LC7A 3CPW2 1GYBA 2KRTA 3CSQA 3KFQC 1GS3A 2W2CA 4HM1B 3Q1CA 2Z77A 1SIHA 4GL6A 3SLUA 1V74A 1WNHA 4FCMA 2GXFA 3DUKA 4XB5A 3LYGA 3S67A 1FGQA 1TU5A 4FCZA 5CF1A 4N6TA 2BMQB 4KFFA 1GGRA 1O7WB 3IT5A 1D6YA 1W5ZA 2Q07A 3I0YA 3NV0B 2HMMB 2KCDA 3NM2A 3FLJA 4XDWA 1YIT3 4EBGA 3CCV3 1M1K4 1UUVB 2GU3A 1HKXA 1M1XB 2P0XA 3HZPA 1Z1SA 4HJLB 4RZMA 1SQWA 5TGNA 3LTCA 2D1WA 3S27A 1EA2A 3MKIA 1OGXA 1D6UA 4KFDA 3MG3A 1F3ZA 4KFEA 1GLAF 3HK4A 3LH4A 1FUWA 3T0UA 1EQKA 1OUNA 1JB4A 1KWIA 3BLZA 3CME3 3WODG 2ZL8A 2GPRA 4G1MB 1W6CA 4H61A 3DGMA 2GBXB 2B1XB 3V98A 4AEQA 4L7KA 1JNQA 4N6MA 4HM2B 1N8QA 4HM6B 4Q53A 2WOHA 2CFKA 3FCSB 3MG2A 1CEWI 3U1WA 3FG1A 3NYYA 2MF7A 4R80A 5D83A 1VQ53 3G0KA 4O8SA 1VQ63 2CW9A 2P05A 3K0ZA 3T8UA 4HM5B 4XBTA 3UB1A 1IQ8A 3SVAA 2B0PA 3D9RA 1OCVA 3EQQB 3I563 4QP5A 1E3VA 3DMCA 3FH1A 1KC84 3H3HA 4STDA 5LC6A 4H3UA 1VZZA 1GY6A 4MMXB 1CQSA 3FG4A 1IK3A 3CCM3 1M904 1S723 2W0QA 1FGTA 4OVMA 1W7CA 1BUQA 4EC6A 3PXMA 2QEX3 3BNBA 5ELUA 2CFWA 4N6V0 1Q40B 1EG9B 2GEXA 1Q42A 3M8CA 5AYSC 3V99A 3CNMA 3MWZA 2CFDA 4R4KA 4WHAA 2K0MA 1NWWA 3KSPA 3B8LA 1OH0A 3EN8A 1EKMA 1TP6A 3GZBA 4NHFA 2FGTA 3G16A 1HU9A 1CYUA 2XR8B 3MSOA 1OHPA 5IG3A 3Q90A 4PEJA 1OF5A 5CK6A 1VQ73 3AMOB 2IMJA 3N54B 2GEYA 2KXGA 1IVXA 3EC9A 4K1VA 5AIIA 4HKVB 4N6LA 1O7PB 3X3ZA 3OV4A 4HM8B 1NB5I 5AIFA 4LMIA 2CFLA 4RNZA 4R9LA 4ZM8A 5A0OB 4X2OA 3K5TA 1OGZA 5IG5A 1US1A 3LMLA 4BTYA 3CCL3 2XRXB 4AKZA 1K734 3V92A 3CD63 1TIJA 2XGNA 4KZ1A 3LTDA 1Q824 2RFRA 1QMAA 1W6GA 2XSOB 4HZBB 2IA7A 3H51A 2XF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AX3 A;  5B0H A;  1F3G A;  1O2F A;  2GU1 A;  3CSQ A;  2HSI A;  2F3G A;  1QWY A;  3NYY A;  3SLU A;  1F3Z A;  1GLA F;  1GPR A;  4QPB A;  1GLC F;  2B13 A;  4RNZ A;  2B0P A;  1GLB F;  4RNY A;  2GPR A;  4BH5 A;  2B44 A;  1GGR A;  3UZ0 B;  3IT5 A;  4ZYB A;  4QP5 A;  3TUF B;  1GLE F;  3OUR B;  5KVP A;  3IT7 A;  2MP0 B;  4LXC A;  1GLD F;  4JBW M; 
#chains in the Genus database with same CATH topology
 4MJD A;  1Q7Y 4;  1RGG A;  4FMC A;  1E3R A;  3NX0 A;  2F56 A;  1BRS A;  2F3G A;  3WA2 X;  5HOH A;  5IG5 A;  1FA3 A;  1I3I A;  2ML5 A;  1DMM A;  1VQO 3;  1NJI 4;  4FCJ A;  1BNJ A;  3LTB A;  3EBT A;  4OK0 A;  1GPR A;  3OW2 2;  4BTX A;  5CXO A;  3FG3 A;  3EX9 A;  3VSY A;  1X1U A;  1A2V A;  1BNF A;  1U8C B;  2F5W A;  1B2M A;  1DMN A;  2M7O A;  1RN4 A;  2C10 A;  5RNT A;  1BNG A;  2ML6 A;  9RNT A;  1IT8 A;  1STF I;  1U5O A;  1JJ2 2;  1JRQ A;  1YI2 3;  2OTL 3;  1KQS 2;  2JDI H;  3IT7 A;  5IEO A;  3FF2 A;  1JZD A;  3OUR B;  1MGR A;  2OOV C;  1Q7H A;  3D5G A;  4IT7 A;  5ELJ A;  1Q81 4;  1VQ8 3;  1J2B A;  2OOV A;  1RGK A;  3GAX A;  4O3V A;  2HSI A;  1G02 A;  1GMR A;  1I0X A;  4WWU C;  1RN7 A;  3EN1 B;  1O7M B;  1BSE A;  1UCJ A;  2W6J H;  3EB8 A;  3Q2P A;  4N6U A;  2INX A;  1WQL B;  4XBX A;  1AQZ A;  2XGL A;  4XBY A;  3X41 A;  3ER7 A;  1ISK A;  1IT7 A;  1BRI A;  4EV2 A;  1F8N A;  2CWU A;  2OQE C;  4BH5 A;  1FGO A;  1HYF A;  2B44 A;  2B24 B;  5DRE A;  1JKG B;  1RGF A;  1ZX2 A;  3LZA A;  2OQE A;  5IER A;  5AEU B;  5IG0 A;  2HML B;  4MMZ B;  5EVH A;  4N3V A;  2BO9 B;  2OTJ 3;  1QAL A;  2STD A;  1RGA A;  3JVC A;  3FZW A;  5EQL A;  3UL6 A;  5IEN A;  3CCQ 3;  1A90 A;  3HIG A;  1RRL A;  1W01 A;  4CCV A;  1X1Y A;  2LQV A;  4LXC A;  2CFG A;  2BT3 A;  2SBL A;  5FGO A;  1RJO A;  1GLD F;  1RSN A;  1WMP A;  5BVB A;  1AX3 A;  1BVI A;  1YNV X;  5IF6 A;  1UGI A;  1N5H A;  3N9H A;  1STD A;  4OUQ A;  1QWY A;  1RRH A;  3PS8 A;  2LYX A;  1GY5 A;  2R4I A;  2RGQ A;  2CWV A;  3KN4 A;  4JRF A;  4XDV A;  1D6Z A;  5JPP A;  3CNX A;  3JUM A;  1K28 A;  4WYK B;  4EW5 A;  2Z7A A;  3U97 A;  3NQY A;  1A2K A;  3GZR A;  1VQ9 3;  1KD1 4;  3D79 A;  4I4K A;  4TX4 A;  4MEI A;  1RKY A;  1VQ4 3;  5IW9 A;  1T3B A;  3LT8 A;  1QJG A;  1AY7 A;  4HOH A;  1B2X A;  2PZV A;  1GOV A;  4QWT A;  3SX1 A;  5AYR B;  1VQN 3;  3DGN A;  1I2G A;  1G96 A;  3NV0 A;  1YJN 3;  1FGR A;  5AIG A;  2JQ5 A;  4EYC A;  5GSP A;  2BMR B;  4BL2 A;  3LOY A;  1JN5 B;  4HZ9 B;  6RNT A;  1DMQ A;  4JF8 A;  3ECF A;  1N9J A;  3Q3F A;  4FMD A;  1LVN A;  4FMA A;  1N8R 4;  1W6Y A;  3DGY A;  2XFS A;  1NDO B;  3DZL A;  3CC4 3;  2Y73 A;  2YFL B;  2MC8 A;  4U13 A;  3DH2 A;  3PCR A;  1GD3 A;  2H0H A;  2UGI A;  3D4A A;  2XSH B;  3GWR A;  3KZT A;  4L8O A;  1B20 A;  3WDG B;  3IJE B;  1BNS A;  4LEH A;  4WP5 A;  1N5P A;  3K7C A;  4ORL A;  3WR2 A;  2CC3 A;  3IPT A;  1VQP 3;  3TUF B;  1FGM A;  5EEO A;  1RLS A;  3S5C A;  1Q86 4;  1BIR A;  1CYV A;  3CCE 3;  5KVP A;  2FXT A;  1N9E A;  3ALA A;  1O7N B;  4JBW M;  4AKY A;  3B4O A;  1YHQ 3;  1SII A;  1MOL A;  2RSX A;  3CU3 A;  1K41 A;  3PGB A;  3OXA A;  1PU4 A;  3RDE A;  1LNH A;  4GSP A;  2CK3 H;  1MWR A;  3GRD A;  1QAF A;  4L8P A;  3K9M C;  3X42 A;  1NNV A;  3GZY B;  1BRG A;  2V1L A;  2GBW B;  1MWU A;  2CG0 A;  2I9W A;  4GB5 A;  4HM7 B;  2WGQ A;  5BU4 A;  3MHE A;  1YGE A;  4J8T A;  2BIR A;  2QIY A;  5DRV A;  4R9K A;  3NM7 A;  1RGH A;  8RNT A;  1V58 A;  1W2B 2;  1R4C A;  1O7G B;  3DXO A;  5IG4 A;  1RGE A;  1BAN A;  1NB3 I;  2YFJ B;  1B2S A;  3KSE D;  3BIR A;  1A67 A;  1T5Y A;  3FKA A;  1BAO A;  1Y4K A;  3GZX B;  4NRE A;  3ZFZ A;  3WMD A;  3AHW A;  2RBI A;  1IU7 A;  1LRA A;  2F99 A;  1AV4 A;  1IVV A;  3X3Y A;  2GU1 A;  5D82 A;  3L0R A;  2WO0 A;  1VQK 3;  2OCT A;  1IQX A;  1W00 A;  1YVB I;  3MG1 A;  5STD A;  3WA3 A;  2Z6B A;  1WMO A;  1Q40 A;  2ZHX B;  3NQZ A;  3PYJ A;  1BGS A;  4HM0 B;  2A15 A;  4I5Q A;  3JUP A;  3BNC A;  4HM4 B;  1QAK A;  4N6O B;  5M18 A;  1FW7 A;  1UI8 A;  2AAD A;  4N6N B;  2B13 A;  1BOX A;  1LOY A;  3IMA B;  4GHO A;  3WOF B;  5KP4 A;  3CCR 3;  3EE1 A;  2CX0 A;  2WGO A;  5D81 A;  3J7Y d;  1JB2 A;  2BNG A;  1GOY A;  1GMP A;  2CWT A;  3I55 3;  1IVU A;  1UI7 A;  1UCI A;  3KE7 A;  4HAA A;  1UW1 A;  1LXE A;  3F40 A;  2MP0 B;  1GOU A;  2GSP A;  3MPH A;  5AIH A;  4RBN A;  3CC2 3;  2W03 A;  1B2U A;  1ASK A;  2HMK B;  3AMO A;  3N8B A;  1ULI B;  4BL3 A;  1RTU A;  3X3X A;  1RN1 A;  2XFT A;  1LNI A;  1F3G A;  2BU4 A;  2E2T A;  3FF0 A;  3NBR A;  1QVF 2;  5KP3 A;  4FR9 A;  1YJW 3;  1DYU A;  1L5G B;  3RNT A;  3SOY A;  3G71 3;  4IIA A;  3CCS 3;  1LQG C;  2O3O A;  3DM8 A;  2L1S A;  1RNB A;  4QPB A;  1IDP A;  3E99 A;  1GLC F;  2XEP A;  4K1U A;  4X2H A;  2W9Q A;  3NBB A;  2YX9 A;  4IPB A;  3EJV A;  2ZA4 A;  5JPU A;  1K9M 4;  3JUQ A;  4CPK A;  3UZ0 B;  1IV9 A;  1RHL A;  1W2Z A;  4EXR A;  2F4Y A;  4WFO A;  6STD A;  3HI7 A;  3D5I A;  1AVK A;  2P38 A;  2RCD A;  3DY5 A;  3OWU A;  4FMB A;  3A76 A;  3B4P A;  4MMY B;  1BSB A;  5KP1 A;  2YFI B;  3S29 A;  2CHC A;  1YVS A;  3LXU X;  1W02 A;  3K63 A;  4K90 B;  3UNL A;  5A0O B;  3CXC 2;  3JUO A;  3F7S A;  3LT9 A;  3OWY A;  2SAR A;  4KT3 B;  2C4B A;  2E2V A;  2QGU A;  1OAC A;  2KF6 A;  2W56 B;  3F9S A;  3QRD A;  4BTW A;  5AEW B;  1VQL 3;  1BRH A;  2CH9 A;  1ULJ B;  4KVH A;  1B2Z A;  1T2H A;  2F86 B;  4RNY A;  3DGL A;  3F14 A;  1E97 A;  2XH9 A;  1JV2 B;  3LTA A;  3CCU 3;  3QK9 A;  2C11 A;  1CH0 A;  1B21 A;  3NHX A;  1RCL A;  5IEP A;  3CC7 3;  3CCJ 3;  4EV5 A;  3RGR A;  2OWP A;  1OF5 B;  3F7X A;  2PNC A;  1AVL A;  1OHO A;  3URP A;  4CDL A;  3OX9 A;  5HGR A;  1YIJ 3;  1JBR A;  5B0H A;  2CX1 A;  3MYT A;  1NO3 A;  2HMN B;  1QVG 2;  3UL5 A;  1BNE A;  3EBY A;  1EUI C;  1GD4 A;  3ZG0 A;  1ROA A;  2ZDJ A;  1YJ9 3;  3O8Y A;  4J9A A;  2H0G A;  3TDG A;  3FSD A;  1O7H B;  3ZG5 A;  2CKF B;  3A5E A;  1SPU A;  3RGA A;  1JKG A;  1OHS A;  4ZYB A;  1A2P A;  1OPY A;  2W04 A;  1GLE F;  1I0V A;  3G6E 3;  3HII A;  3NXJ A;  1DVC A;  2IUK A;  4HVN A;  2L4V A;  1FUT A;  2CIU A;  2FNQ A;  1ZO2 A;  5FW5 A;  3ROB A;  4HBR A;  5I97 A;  3G8Z A;  3NBJ A;  3VGN A;  5G2G A;  1JBT A;  3SOA A;  1VQM 3;  1JB5 A;  4R1K A;  1TFO A;  3X40 A;  3EF8 A;  1SJW A;  3FGY A;  2Y74 A;  1T2I A;  1TJD A;  1ROV A;  1O2F A;  1I70 A;  2D42 A;  2QA4 3;  1EEJ A;  2F98 A;  3BND A;  2IUJ A;  3UJM A;  3WHO A;  1AR0 A;  2P0M A;  2Z76 A;  4O02 B;  2W56 A;  1I2F A;  1DVD A;  3BU4 A;  2P09 A;  4WYK A;  1IQY A;  1M9G A;  3PCS A;  3EHC A;  2HMJ B;  3BNE A;  1WMN A;  1GLB F;  2KAA A;  2O9U X;  4LZI A;  4LGQ A;  1IV7 A;  4LSO A;  3KKG A;  2IYJ A;  3B7C A;  3D3L A;  2H0I A;  1UUW B;  3JUN A;  1S5A A;  3GSP A;  1IVW A;  4XM4 A;  3SED A;  3KII A;  3T8N A;  2BHM A;  3F8X A;  2RNT A;  1PY3 A;  3G4S 3;  4O2H A;  3BB9 A;  7STD A;  2UX0 A;  1GY7 A;  1JN5 A;  1KSI A;  1LOX A;  1RDS A;  2K54 A;  1ZS7 A;  1MGW A;  3WOE B;  3CMA 3;  1VQQ A;  2WOF A;  2CG1 A;  1MNL A;  1UCL A;  1NU3 A;  1W4N A;  1C7H A;  1UDI I;  1WTH A;  4NPB A;  1TRQ A;  3F8H A;  3S28 A;  2E2U A;  5BXQ A;  1TFK A;  3CPO A;  3SXX A;  5CF2 A;  5BIR A;  5AI1 A;  1PFP A;  3PZW A;  8CHO A;  1IYY A;  1ZGX A;  3HX8 A;  7RNT A;  2W9P A;  4HM3 B;  1X1X A;  3VF1 A;  1JBS A;  3OWS A;  2AAE A;  3DGO A;  1BUJ A;  2HMO B;  4K61 A;  1JZO A;  4HYZ A;  4J5K A;  1RCK A;  2BMO B;  3STD A;  1TUH A;  3NUV A;  5CLK A;  5LC7 A;  3CPW 2;  3HOH A;  1V57 A;  1GYB A;  2KRT A;  3CSQ A;  3KFQ C;  1LOW A;  1GS3 A;  2W2C A;  4HM1 B;  3Q1C A;  2K3D A;  2Z77 A;  1SIH A;  4GL6 A;  3SLU A;  1V74 A;  1WNH A;  4FCM A;  1BRJ A;  2GXF A;  3DUK A;  4XB5 A;  5M19 A;  3LYG A;  3S67 A;  1FGQ A;  1TU5 A;  4FCZ A;  5CF1 A;  2KF4 A;  4N6T A;  2BMQ B;  4KFF A;  1GGR A;  1O7W B;  3IT5 A;  1D6Y A;  1W5Z A;  2Q07 A;  1UGH I;  3I0Y A;  3NV0 B;  2HMM B;  2KCD A;  3NM2 A;  3FLJ A;  1I2E A;  4XDW A;  1YIT 3;  4EBG A;  3CCV 3;  1M1K 4;  1UUV B;  2GU3 A;  1HKX A;  1M1X B;  2P0X A;  3HZP A;  1Z1S A;  4HJL B;  1R4Y A;  4RZM A;  1SQW A;  5TGN A;  3LTC A;  2D1W A;  3S27 A;  1EA2 A;  3MKI A;  1G0T A;  1D6U A;  1OGX A;  1SAR A;  3MG3 A;  4KFD A;  4CJN A;  1YGW A;  1F3Z A;  4KFE A;  1GLA F;  3HK4 A;  3LH4 A;  1UCK A;  4BIR A;  1FUW A;  1Q9E A;  3T0U A;  1UUG B;  1EQK A;  1OUN A;  1BRK A;  1JB4 A;  1KWI A;  3BLZ A;  3CME 3;  3WOD G;  1FYS A;  2ZL8 A;  2GPR A;  1I3F A;  4G1M B;  1W6C A;  4H61 A;  3DGM A;  1FZU A;  2GBX B;  2B1X B;  3V98 A;  4AEQ A;  4L7K A;  1JNQ A;  4N6M A;  4HM2 B;  1N8Q A;  4HM6 B;  4Q53 A;  2WOH A;  2CFK A;  3FCS B;  5JBS A;  3MG2 A;  1CEW I;  3U1W A;  3FG1 A;  3NYY A;  1GMQ A;  2MF7 A;  4R80 A;  1BRN L;  2IY2 A;  5D83 A;  1VQ5 3;  2J8X B;  3G0K A;  4O8S A;  1VQ6 3;  2CW9 A;  2P05 A;  3AGN A;  3K0Z A;  1BSC A;  1BSA A;  3T8U A;  1TRP A;  4HM5 B;  4XBT A;  3UB1 A;  1IQ8 A;  5G1K A;  3SVA A;  2B0P A;  3D9R A;  1DE3 A;  4DKI A;  2F5M A;  1OCV A;  3EQQ B;  3I56 3;  4QP5 A;  1E3V A;  3DMC A;  2KF3 A;  3FH1 A;  3SYU A;  3H3H A;  1KC8 4;  4STD A;  5LC6 A;  4H3U A;  1VZZ A;  1GY6 A;  4MMX B;  1CQS A;  3FG4 A;  1IK3 A;  3CCM 3;  1M90 4;  1BSD A;  6GSP A;  1S72 3;  1RNT A;  1LQM B;  2KF5 A;  1FGT A;  2W0Q A;  4OVM A;  1K8A 4;  1W7C A;  1BUQ A;  4EC6 A;  3PXM A;  2QEX 3;  2HOH A;  3BNB A;  5ELU A;  2CFW A;  4N6V 0;  1I8V A;  1Q40 B;  1EG9 B;  1TTO A;  1Q42 A;  2GEX A;  3M8C A;  5G1L A;  5AYS C;  3V99 A;  1BU4 A;  2R41 A;  3AHS A;  3CNM A;  3MWZ A;  2CFD A;  4R4K A;  4WHA A;  1DET A;  2K0M A;  7GSP A;  1NWW A;  3KSP A;  3B8L A;  1GSP A;  1OH0 A;  1X1W A;  3EN8 A;  1EKM A;  1TP6 A;  3GZB A;  4NHF A;  2FGT A;  3G16 A;  1HU9 A;  5M1A A;  1CYU A;  1MWS A;  2XR8 B;  3MSO A;  1OHP A;  5IG3 A;  3Q90 A;  4PEJ A;  1OF5 A;  5CK6 A;  1VQ7 3;  3AMO B;  2IMJ A;  3N54 B;  2GEY A;  2UUG C;  4ILF A;  2KXG A;  1IVX A;  1C54 A;  1BNR A;  3EC9 A;  4K1V A;  5AII A;  4HKV B;  4N6L A;  1O7P B;  3X3Z A;  3OV4 A;  4HM8 B;  3KCH A;  1BNI A;  5AIF A;  4J5G A;  1RGC A;  2CFL A;  4LMI A;  4RNZ A;  1NB5 I;  4LYL B;  4R9L A;  4ZM8 A;  1HZ1 A;  4X2O A;  3K5T A;  1RMS A;  1RGL A;  1OGZ A;  1LOV A;  1US1 A;  1B27 A;  3LML A;  1MWT A;  4BTY A;  3CCL 3;  2XRX B;  4AKZ A;  4BU4 A;  3V92 A;  1K73 4;  3CD6 3;  1FUS A;  1TIJ A;  2XGN A;  4KZ1 A;  3AGO A;  3LTD A;  4RNT A;  1Q82 4;  2RFR A;  1QMA A;  1PYL A;  1W6G A;  2XSO B;  4HZB B;  2IA7 A;  3H51 A;  1B3S A;  2XF3 A; 
#chains in the Genus database with same CATH homology
 4MJD A;  1Q7Y 4;  4FMC A;  1E3R A;  3NX0 A;  2F3G A;  3WA2 X;  2ML5 A;  1VQO 3;  1DMM A;  1NJI 4;  4FCJ A;  3LTB A;  3EBT A;  4OK0 A;  1GPR A;  3OW2 2;  4BTX A;  5CXO A;  3FG3 A;  3EX9 A;  3VSY A;  1A2V A;  1U8C B;  1DMN A;  2M7O A;  2C10 A;  2ML6 A;  1IT8 A;  1STF I;  1U5O A;  1JJ2 2;  1JRQ A;  1YI2 3;  2OTL 3;  1KQS 2;  2JDI H;  3IT7 A;  5IEO A;  3FF2 A;  3OUR B;  2OOV C;  5ELJ A;  1VQ8 3;  1Q81 4;  4IT7 A;  1J2B A;  2OOV A;  3GAX A;  4O3V A;  2HSI A;  4WWU C;  1RN7 A;  3EN1 B;  1O7M B;  2W6J H;  3Q2P A;  3EB8 A;  4N6U A;  2INX A;  1WQL B;  4XBX A;  2XGL A;  4XBY A;  3X41 A;  3ER7 A;  1ISK A;  1IT7 A;  4EV2 A;  1F8N A;  2CWU A;  2OQE C;  4BH5 A;  1FGO A;  2B24 B;  2B44 A;  2OQE A;  5DRE A;  1JKG B;  1ZX2 A;  3LZA A;  5IER A;  5AEU B;  5IG0 A;  2HML B;  4MMZ B;  5EVH A;  4N3V A;  2BO9 B;  2OTJ 3;  1QAL A;  2STD A;  3JVC A;  5EQL A;  3FZW A;  3UL6 A;  5IEN A;  3CCQ 3;  1A90 A;  3HIG A;  1RRL A;  1W01 A;  4CCV A;  2LQV A;  4LXC A;  2CFG A;  2BT3 A;  2SBL A;  5FGO A;  1RJO A;  1GLD F;  1WMP A;  5BVB A;  1AX3 A;  5IF6 A;  1N5H A;  3N9H A;  1STD A;  4OUQ A;  1QWY A;  1RRH A;  3PS8 A;  2LYX A;  1GY5 A;  2R4I A;  2RGQ A;  2CWV A;  3KN4 A;  4JRF A;  4XDV A;  1D6Z A;  5JPP A;  3CNX A;  3JUM A;  1K28 A;  4WYK B;  2Z7A A;  3U97 A;  3NQY A;  1A2K A;  3GZR A;  1VQ9 3;  1KD1 4;  4I4K A;  4TX4 A;  1RKY A;  4MEI A;  1VQ4 3;  5IW9 A;  3LT8 A;  1QJG A;  3SX1 A;  2PZV A;  4QWT A;  5AYR B;  1VQN 3;  3DGN A;  1YJN 3;  1G96 A;  3NV0 A;  1FGR A;  5AIG A;  2JQ5 A;  4EYC A;  2BMR B;  3LOY A;  1JN5 B;  4HZ9 B;  1DMQ A;  4JF8 A;  3ECF A;  1N9J A;  4FMD A;  4FMA A;  1LVN A;  1N8R 4;  1W6Y A;  2XFS A;  1NDO B;  3DZL A;  3CC4 3;  2Y73 A;  2YFL B;  2MC8 A;  4U13 A;  3PCR A;  1GD3 A;  2XSH B;  3GWR A;  3KZT A;  4L8O A;  3WDG B;  3IJE B;  4LEH A;  4WP5 A;  1N5P A;  3K7C A;  4ORL A;  1VQP 3;  2CC3 A;  3IPT A;  3TUF B;  1FGM A;  5EEO A;  1Q86 4;  3S5C A;  1CYV A;  3CCE 3;  5KVP A;  2FXT A;  1N9E A;  3ALA A;  1O7N B;  4JBW M;  4AKY A;  3B4O A;  1YHQ 3;  1SII A;  1MOL A;  2RSX A;  3CU3 A;  1K41 A;  3PGB A;  3OXA A;  1PU4 A;  3RDE A;  1LNH A;  2CK3 H;  3GRD A;  4L8P A;  1QAF A;  3K9M C;  3X42 A;  3GZY B;  2V1L A;  2GBW B;  2CG0 A;  2I9W A;  4GB5 A;  4HM7 B;  2WGQ A;  3MHE A;  1YGE A;  4J8T A;  5DRV A;  2QIY A;  4R9K A;  3NM7 A;  1W2B 2;  1R4C A;  1O7G B;  3DXO A;  5IG4 A;  1NB3 I;  2YFJ B;  3KSE D;  1A67 A;  1T5Y A;  3FKA A;  1Y4K A;  3GZX B;  4NRE A;  3WMD A;  1IU7 A;  2F99 A;  1AV4 A;  1IVV A;  3X3Y A;  2GU1 A;  5D82 A;  3L0R A;  2WO0 A;  1VQK 3;  2OCT A;  1IQX A;  1W00 A;  1YVB I;  3MG1 A;  5STD A;  3WA3 A;  2Z6B A;  1WMO A;  1Q40 A;  3NQZ A;  3PYJ A;  4HM0 B;  1K8A 4;  2A15 A;  3JUP A;  3BNC A;  4HM4 B;  1QAK A;  4N6O B;  1UI8 A;  4N6N B;  2B13 A;  3IMA B;  3WOF B;  5KP4 A;  3CCR 3;  1FA3 A;  3EE1 A;  5D81 A;  2WGO A;  3J7Y d;  1JB2 A;  2BNG A;  2CWT A;  3I55 3;  1IVU A;  1UI7 A;  3KE7 A;  1UW1 A;  1LXE A;  3F40 A;  2MP0 B;  3MPH A;  5AIH A;  3CC2 3;  4RBN A;  2W03 A;  3AMO A;  1ASK A;  2HMK B;  3N8B A;  1ULI B;  3X3X A;  2XFT A;  1F3G A;  2E2T A;  3FF0 A;  3NBR A;  1QVF 2;  5KP3 A;  4FR9 A;  1YJW 3;  1DYU A;  1L5G B;  3SOY A;  3G71 3;  4IIA A;  3CCS 3;  2O3O A;  3DM8 A;  4QPB A;  1IDP A;  3E99 A;  1GLC F;  2XEP A;  4K1U A;  4X2H A;  2W9Q A;  3NBB A;  2YX9 A;  4IPB A;  3EJV A;  5JPU A;  1K9M 4;  3JUQ A;  3UZ0 B;  1IV9 A;  1W2Z A;  4EXR A;  4WFO A;  6STD A;  3HI7 A;  1AVK A;  2P38 A;  2RCD A;  3DY5 A;  3OWU A;  4FMB A;  3A76 A;  3B4P A;  4MMY B;  5KP1 A;  2YFI B;  3S29 A;  2CHC A;  3UNL A;  3LXU X;  1W02 A;  3K63 A;  4K90 B;  3CXC 2;  3JUO A;  3F7S A;  3LT9 A;  3OWY A;  2E2V A;  2QGU A;  1OAC A;  2W56 B;  3F9S A;  3QRD A;  4BTW A;  5AEW B;  1VQL 3;  2CH9 A;  1ULJ B;  4KVH A;  2F86 B;  4RNY A;  3DGL A;  3F14 A;  1E97 A;  2XH9 A;  1JV2 B;  3LTA A;  3CCU 3;  3QK9 A;  2C11 A;  3NHX A;  5IEP A;  3CC7 3;  3CCJ 3;  4EV5 A;  3RGR A;  2OWP A;  1OF5 B;  3F7X A;  2PNC A;  1AVL A;  1OHO A;  4CDL A;  1YIJ 3;  3OX9 A;  5HGR A;  5B0H A;  3MYT A;  1NO3 A;  2HMN B;  1QVG 2;  3UL5 A;  3EBY A;  1GD4 A;  1ROA A;  2ZDJ A;  1YJ9 3;  3O8Y A;  4J9A A;  3TDG A;  3FSD A;  1O7H B;  2CKF B;  1SPU A;  3RGA A;  1JKG A;  1OHS A;  4ZYB A;  1OPY A;  2W04 A;  1GLE F;  3G6E 3;  3HII A;  3NXJ A;  1DVC A;  2IUK A;  4HVN A;  2L4V A;  5FW5 A;  2CIU A;  2FNQ A;  1ZO2 A;  3ROB A;  5I97 A;  4HBR A;  3G8Z A;  3NBJ A;  3VGN A;  5G2G A;  3SOA A;  1VQM 3;  1JB5 A;  4R1K A;  1TFO A;  3X40 A;  3EF8 A;  1SJW A;  3FGY A;  2Y74 A;  1ROV A;  1O2F A;  2D42 A;  2QA4 3;  2F98 A;  3BND A;  2IUJ A;  3UJM A;  1AR0 A;  2P0M A;  2Z76 A;  4O02 B;  2W56 A;  1DVD A;  2P09 A;  4WYK A;  1IQY A;  1M9G A;  3PCS A;  3EHC A;  2HMJ B;  3BNE A;  1WMN A;  1GLB F;  4LZI A;  2O9U X;  4LGQ A;  1IV7 A;  4LSO A;  3KKG A;  3B7C A;  3D3L A;  1UUW B;  3JUN A;  1S5A A;  4XM4 A;  1IVW A;  3SED A;  3T8N A;  3KII A;  2BHM A;  3F8X A;  3G4S 3;  4O2H A;  3BB9 A;  7STD A;  2UX0 A;  1GY7 A;  1JN5 A;  1KSI A;  1LOX A;  2K54 A;  3CMA 3;  3WOE B;  2WOF A;  2CG1 A;  1MNL A;  1NU3 A;  1W4N A;  1C7H A;  1WTH A;  5CF2 A;  3F8H A;  3S28 A;  5BXQ A;  2E2U A;  5JBS A;  1TFK A;  3CPO A;  3SXX A;  8CHO A;  5AI1 A;  1PFP A;  3PZW A;  3HX8 A;  2W9P A;  4HM3 B;  3VF1 A;  3OWS A;  3DGO A;  2HMO B;  4K61 A;  4HYZ A;  2BMO B;  3STD A;  1TUH A;  3NUV A;  5CLK A;  5LC7 A;  3CPW 2;  1GYB A;  2KRT A;  3CSQ A;  3KFQ C;  1GS3 A;  2W2C A;  4HM1 B;  3Q1C A;  2Z77 A;  1SIH A;  4GL6 A;  3SLU A;  1V74 A;  1WNH A;  4FCM A;  2GXF A;  3DUK A;  4XB5 A;  3LYG A;  3S67 A;  1FGQ A;  1TU5 A;  4FCZ A;  5CF1 A;  4N6T A;  2BMQ B;  4KFF A;  1GGR A;  1O7W B;  3IT5 A;  1D6Y A;  1W5Z A;  2Q07 A;  3I0Y A;  3NV0 B;  2HMM B;  2KCD A;  3NM2 A;  3FLJ A;  4XDW A;  1YIT 3;  4EBG A;  3CCV 3;  1M1K 4;  1UUV B;  2GU3 A;  1HKX A;  1M1X B;  2P0X A;  3HZP A;  1Z1S A;  4HJL B;  4RZM A;  1SQW A;  5TGN A;  3LTC A;  2D1W A;  3S27 A;  1EA2 A;  3MKI A;  1OGX A;  1D6U A;  4KFD A;  3MG3 A;  1F3Z A;  4KFE A;  1GLA F;  3HK4 A;  3LH4 A;  1FUW A;  3T0U A;  1EQK A;  1OUN A;  1JB4 A;  1KWI A;  3BLZ A;  3CME 3;  3WOD G;  2ZL8 A;  2GPR A;  4G1M B;  1W6C A;  4H61 A;  3DGM A;  2GBX B;  2B1X B;  3V98 A;  4AEQ A;  4L7K A;  1JNQ A;  4N6M A;  4HM2 B;  1N8Q A;  4HM6 B;  4Q53 A;  2WOH A;  2CFK A;  3FCS B;  3MG2 A;  1CEW I;  3U1W A;  3FG1 A;  3NYY A;  2MF7 A;  4R80 A;  5D83 A;  1VQ5 3;  3G0K A;  4O8S A;  1VQ6 3;  2CW9 A;  2P05 A;  3K0Z A;  3T8U A;  4HM5 B;  4XBT A;  3UB1 A;  1IQ8 A;  3SVA A;  2B0P A;  3D9R A;  1OCV A;  3EQQ B;  3I56 3;  4QP5 A;  1E3V A;  3DMC A;  3FH1 A;  1KC8 4;  3H3H A;  4STD A;  5LC6 A;  4H3U A;  1VZZ A;  1GY6 A;  4MMX B;  1CQS A;  3FG4 A;  1IK3 A;  3CCM 3;  1M90 4;  1S72 3;  2W0Q A;  1FGT A;  4OVM A;  1W7C A;  1BUQ A;  4EC6 A;  3PXM A;  2QEX 3;  3BNB A;  5ELU A;  2CFW A;  4N6V 0;  1Q40 B;  1EG9 B;  2GEX A;  1Q42 A;  3M8C A;  5AYS C;  3V99 A;  3CNM A;  3MWZ A;  2CFD A;  4R4K A;  4WHA A;  2K0M A;  1NWW A;  3KSP A;  3B8L A;  1OH0 A;  3EN8 A;  1EKM A;  1TP6 A;  3GZB A;  4NHF A;  2FGT A;  3G16 A;  1HU9 A;  1CYU A;  2XR8 B;  3MSO A;  1OHP A;  5IG3 A;  3Q90 A;  4PEJ A;  1OF5 A;  5CK6 A;  1VQ7 3;  3AMO B;  2IMJ A;  3N54 B;  2GEY A;  2KXG A;  1IVX A;  3EC9 A;  4K1V A;  5AII A;  4HKV B;  4N6L A;  1O7P B;  3X3Z A;  3OV4 A;  4HM8 B;  1NB5 I;  5AIF A;  4LMI A;  2CFL A;  4RNZ A;  4R9L A;  4ZM8 A;  5A0O B;  4X2O A;  3K5T A;  1OGZ A;  5IG5 A;  1US1 A;  3LML A;  4BTY A;  3CCL 3;  2XRX B;  4AKZ A;  1K73 4;  3V92 A;  3CD6 3;  1TIJ A;  2XGN A;  4KZ1 A;  3LTD A;  1Q82 4;  2RFR A;  1QMA A;  1W6G A;  2XSO B;  4HZB B;  2IA7 A;  3H51 A;  2XF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...