4RNYA

Structure of helicobacter pylori csd3 from the orthorhombic crystal
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
363
structure length
359
Chain Sequence
MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHPVLKVRRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Conserved hypothetical secreted protein
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 94
structure length 359
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnyA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnyA02
4QP5A 4QPBA 1AX3A 3NYYA 2GPRA 1GPRA 1GLDF 1GLCF 4RNYA 4LXCA 3OURB 3IT5A 4BH5A 3SLUA 1F3GA 2MP0B 1O2FA 3UZ0B 2B13A 2HSIA 1GLAF 4JBWM 2GU1A 3CSQA 5B0HA 5KVPA 1QWYA 2F3GA 1GGRA 1GLBF 2B0PA 1GLEF 2B44A 3TUFB 4ZYBA 3IT7A 1F3ZA 4RNZA
chains in the Genus database with same CATH superfamily
2UGIA 3F7SA 4QPBA 2CFDA 5IENA 3PGBA 3NYYA 1ROAA 1O7HB 1OF5A 4HZ9B 9RNTA 3IJEB 5IEPA 5AIFA 3ZG0A 3I563 1IDPA 1TP6A 3UJMA 3EB8A 1LOWA 3FG3A 1AVLA 4N6UA 3IT5A 1GY7A 3S5CA 4BTXA 1IK3A 2BIRA 1F3GA 2CWVA 2KRTA 3BU4A 1O7MB 1WNHA 3WOFB 3PZWA 3Q3FA 3HIIA 4L7KA 4N6LA 3RNTA 1RGAA 1B21A 4KFEA 3BB9A 5G1KA 1EEJA 1VQM3 3SEDA 3KE7A 4AKYA 4L8OA 4MJDA 3BNDA 3D79A 1RDSA 1Z1SA 3F14A 3CD63 4WWUC 1RGFA 1US1A 2OTL3 1FUWA 1YJN3 3TUFB 3D3LA 3GZXB 4HM0B 1I2FA 3IPTA 2BHMA 3NV0B 3I553 1BRJA 1QVF2 1C54A 1LQMB 2K3DA 2HMKB 2ZHXB 2H0HA 3PXMA 5RNTA 1Q7Y4 4GHOA 1TJDA 1MWUA 1IV9A 4N6TA 2KAAA 5BXQA 2QGUA 1IQXA 2CFGA 5CLKA 3NHXA 3VF1A 2BT3A 4LGQA 4XM4A 2Y73A 1M1K4 1TFOA 4CJNA 1YJW3 1SJWA 1O2FA 1X1WA 1B20A 3KKGA 2INXA 5M1AA 2HSIA 3OWSA 3F40A 4XBYA 3K63A 1X1UA 1GYBA 3JUNA 1FGTA 1VQ83 1NB3I 2P05A 4N6NB 3U1WA 5EEOA 3L0RA 7GSPA 4OVMA 5JPPA 2P0XA 1QWYA 3LZAA 4FMAA 5M19A 5IF6A 5G2GA 2GSPA 1FUTA 2WGQA 4EV2A 1CYUA 3OWYA 1EG9B 1HZ1A 3VGNA 1BSAA 2STDA 4CPKA 1WTHA 4NHFA 1SIIA 2MC8A 2LQVA 1I0XA 2BMRB 3CCE3 2ZA4A 3DZLA 4HM6B 3SOYA 5DREA 3KFQC 1YIT3 2M7OA 2C4BA 3V98A 1LOYA 2HOHA 2K0MA 1BGSA 3S67A 1UGIA 1LQGC 3EN8A 3DGLA 3MKIA 3UB1A 4NPBA 3NUVA 1FGMA 1Q40B 3FLJA 1GMPA 4ILFA 1K734 3X41A 1MNLA 4XDWA 1B2UA 1STDA 1BSDA 3DH2A 1RNBA 2OTJ3 2I9WA 3T8NA 4R4KA 5ELJA 1K8A4 3MSOA 1ULJB 2W9PA 3CCM3 3CNMA 1BRNL 1BIRA 1N9JA 3CCV3 1B2MA 1BUQA 1T5YA 3GWRA 4FMBA 1EA2A 3X40A 2HMJB 2XF3A 1PY3A 3D4AA 4XB5A 3OW22 2CHCA 3MPHA 3URPA 3SOAA 3BNCA 3HX8A 1AY7A 1GOUA 1BSCA 1I3FA 3UZ0B 4N6MA 4H3UA 1R4CA 1TIJA 1OF5B 1W01A 5KP3A 3KSED 4GSPA 3X3ZA 1M904 2R41A 3RDEA 2CG1A 3PYJA 3MYTA 4EBGA 1BRIA 3HI7A 6GSPA 4HKVB 4K1VA 1ZS7A 2P0MA 3LMLA 2KF3A 1RTUA 2GPRA 5CK6A 2BMOB 4KZ1A 3H3HA 4FMCA 2XRXB 3ZG5A 3T0UA 2MF7A 2W2CA 2CIUA 2F98A 2CX1A 2QA43 5IG4A 2E2TA 2W03A 4R1KA 2CX0A 4RBNA 3SX1A 2W9QA 2YFLB 1JKGA 2Z7AA 1OUNA 2GEXA 1PFPA 2XGNA 1OHPA 4TX4A 3IMAB 2E2UA 2W56A 4HM3B 1RGLA 5BU4A 1NDOB 1YGEA 2BO9B 1GLEF 1I8VA 3B8LA 2SARA 1F8NA 4JF8A 7RNTA 5KP4A 2CFWA 1I2GA 1ZX2A 4H61A 3WOEB 1MGRA 1WMOA 1T2HA 2OOVC 3F9SA 1JJ22 4O2HA 1EQKA 1BNFA 3Q1CA 4EYCA 3CCQ3 2CFLA 2YX9A 4XBTA 3E99A 2CKFB 2V1LA 1UDII 2CK3H 3HZPA 4HM4B 1DYUA 3QRDA 5IG0A 1BSEA 1OGZA 3D9RA 4FCMA 3OURB 1ASKA 1G0TA 1WMNA 3SLUA 2D42A 3Q2PA 8RNTA 1K9M4 2KF5A 1UUGB 1GOVA 1GY6A 1UUVB 3D5IA 1LRAA 1O7GB 1CYVA 2SBLA 3LTDA 5KVPA 1AVKA 1D6YA 1BNGA 4ZYBA 2XR8B 3JVCA 4HAAA 4I4KA 1I0VA 3CC73 3FG1A 8CHOA 3X42A 1LXEA 2OQEA 5BIRA 1CEWI 4BIRA 1RLSA 1T2IA 1B2ZA 2UUGC 2XH9A 1GLDF 1CQSA 1RN4A 3LXUX 4BU4A 1A2VA 2E2VA 1M9GA 2RNTA 4HM2B 1VQ73 3BNBA 3FF0A 2AAEA 5IERA 2RFRA 4I5QA 1B27A 3DXOA 4STDA 3UL5A 1VQ53 3ALAA 3FKAA 3NM2A 4GB5A 2HMNB 2MP0B 4EW5A 5FW5A 1DE3A 2GBXB 1T3BA 4IIAA 6RNTA 1GLAF 5G1LA 4IPBA 1HU9A 3LTCA 1TRPA 1IVUA 1BRHA 2FNQA 3WA3A 3LH4A 1A90A 4O8SA 5AEWB 1GGRA 5AIGA 2IUKA 1BUJA 4MMXB 5FGOA 1UCJA 1YGWA 1TU5A 4L8PA 5I97A 1TFKA 3O8YA 4FMDA 3EBTA 3EN1B 3NBBA 4KT3B 5AIHA 5LC6A 3RGAA 3LTBA 1AX3A 1K28A 1OACA 1RCKA 1ZO2A 1G02A 1W02A 3ER7A 1QALA 2JQ5A 5ELUA 1UGHI 3GRDA 3M8CA 1KSIA 1AR0A 4FCZA 4BL2A 1FW7A 1WQLB 1PU4A 2IUJA 3TDGA 1DETA 5STDA 1IVVA 1A67A 3B7CA 2F4YA 3PCSA 4AEQA 5A0OB 3X3YA 2RCDA 4JBWM 1LOXA 5AI1A 2A15A 2FXTA 2PZVA 1W2ZA 2CFKA 1QJGA 3FF2A 1SIHA 2BU4A 2WGOA 3OWUA 4K61A 2QIYA 3GAXA 1B3SA 2IYJA 3T8UA 5D82A 1RN7A 1ISKA 2CW9A 2IA7A 2Z6BA 2GBWB 4QP5A 1Q824 3CCR3 3H51A 1FA3A 2WOFA 3K9MC 3NQZA 5IW9A 5IEOA 1OH0A 3J7Yd 3G16A 1JKGB 2XSHB 1GPRA 1OHOA 3BLZA 1IT8A 1B2XA 4XDVA 5LC7A 3WODG 3LOYA 3CC43 2W56B 2IMJA 3MG1A 1W6CA 3NBRA 4HBRA 1RGGA 3I0YA 1UI7A 3OX9A 1W4NA 3G0KA 4WP5A 1STFI 3WA2X 1RJOA 4GL6A 3MHEA 1LVNA 1RRHA 1BRGA 3CU3A 1RRLA 3LYGA 3CCS3 1QVG2 3DGNA 3KSPA 1N8QA 4NREA 1VQ43 1BNJA 1SQWA 2O9UX 5AEUB 2UX0A 1I3IA 5IG3A 4N6V0 1IYYA 4IT7A 2C11A 3NXJA 1IT7A 1MWRA 3CME3 1QAFA 1HYFA 2Q07A 4X2HA 4BTWA 1RGHA 2AADA 4KFDA 2B1XB 4HZBB 4MEIA 1JB2A 2PNCA 1S5AA 5BVBA 2RGQA 1EKMA 1A2KA 1JNQA 1GD3A 2P38A 3EX9A 1BU4A 3D5GA 3KIIA 1MGWA 1MOLA 1MWTA 4CDLA 1R4YA 2Z77A 1E97A 3LT9A 1UCLA 1RHLA 2GU3A 3EF8A 2F5WA 3GZBA 4J5KA 3UL6A 2CWUA 3N9HA 2KCDA 3AMOB 1OCVA 1J2BA 1BAOA 1N5HA 1BRSA 2RBIA 4J8TA 3HOHA 2ZDJA 5EVHA 3HK4A 4ZM8A 5B0HA 1KWIA 3SYUA 2B0PA 1YHQ3 1GS3A 3CNXA 3IT7A 3A76A 3MG2A 1D6UA 1GMQA 1UCKA 1JBSA 2F56A 3A5EA 3GZRA 1S723 2WOHA 1BNSA 1QMAA 1W5ZA 3B4PA 1TTOA 1RGKA 4BTYA 3F7XA 1CH0A 1LOVA 2C10A 1W7CA 5AYSC 4CCVA 4BH5A 1EUIC 1UI8A 4FCJA 2Y74A 5CXOA 1JZOA 1BNIA 1G96A 4G1MB 3S27A 3OV4A 1NO3A 2ML5A 1NB5I 3PS8A 5CF1A 1JN5B 2FGTA 2RSXA 3U97A 2B24B 3WHOA 3G6E3 2XFSA 4RZMA 2F3GA 2L4VA 2XSOB 1C7HA 4HM1B 4HM7B 3X3XA 1L5GB 3CCJ3 3JUOA 1AV4A 1YNVX 1RSNA 3STDA 1K41A 1DVCA 5D81A 1FGOA 4O3VA 1A2PA 1IU7A 1SPUA 3AMOA 3JUQA 2IY2A 4MMYB 1BNRA 1RN1A 3AHWA 1BRKA 1GD4A 2YFJB 3ECFA 1IVXA 2R4IA 3HIGA 1N8R4 4WFOA 2ML6A 1W6GA 1Q42A 4RNYA 1E3VA 1I2EA 2OOVA 3S29A 5IG5A 1VZZA 4R9LA 4R9KA 4O02B 4LZIA 2F5MA 3FG4A 4RNTA 3BIRA 4WYKA 1OPYA 2LYXA 3EJVA 3CPW2 1U8CB 4OK0A 3CPOA 4HM8B 1HKXA 1GY5A 2W6JH 1V58A 2B44A 1W2B2 3OXAA 3NX0A 1Q7HA 3FH1A 3FZWA 1OHSA 3V99A 1DMMA 1FUSA 1UUWB 1E3RA 2BNGA 4LMIA 1MWSA 1U5OA 1JN5A 5JPUA 1NU3A 4HM5B 2CH9A 1YIJ3 1ZGXA 1JZDA 4AKZA 1FGQA 5TGNA 3ROBA 3KCHA 4J9AA 5JBSA 1N9EA 1JBTA 1YVSA 3DY5A 4KVHA 1FYSA 5M18A 4J5GA 4PEJA 3DM8A 2P09A 3CCL3 1W6YA 3LT8A 4K1UA 1D6ZA 3DGYA 3CMA3 3MG3A 5HOHA 2KF4A 1Q814 1NNVA 3F8XA 5AYRB 1ROVA 1TRQA 3UNLA 3NBJA 1PYLA 1DMQA 3EQQB 4EV5A 1M1XB 2BMQB 2D1WA 3WMDA 5EQLA 1VQ93 1O7NB 3LTAA 2Z76A 2KXGA 3SXXA 4QWTA 2XFTA 3EC9A 4HOHA 3S28A 3WR2A 2OWPA 1NJI4 3PCRA 3K5TA 2J8XB 1W00A 3DGOA 3QK9A 3Q90A 5HGRA 4HYZA 2KF6A 5AIIA 1RGEA 3NQYA 4R80A 2WO0A 3DGMA 1VQN3 4N3VA 1TUHA 3AGNA 3DUKA 4LYLB 3EBYA 3NV0A 3GSPA 4OUQA 4XBXA 5CF2A 2XEPA 1NWWA 1I70A 1OGXA 3F8HA 7STDA 6STDA 5KP1A 1DVDA 2H0IA 3NM7A 4EXRA 3VSYA 2QEX3 4X2OA 3V92A 1N5PA 2O3OA 1VQK3 1YJ93 2GU1A 2YFIB 3CSQA 1VQ63 4MMZB 2GXFA 3JUMA 1FGRA 1IV7A 2W0QA 1DMNA 3GZYB 1JRQA 1BNEA 1RNTA 3JUPA 5D83A 2HMMB 1GSPA 1V57A 1KC84 1JBRA 2OCTA 2F86B 4JRFA 1V74A 1VQO3 3SVAA 3EE1A 1BANA 4HJLB 3DMCA 3WDGB 1YVBI 3CCU3 1YI23 2H0GA 3CC23 5DRVA 3MWZA 3AGOA 1ULIB 2CWTA 2HMLB 3FSDA 3RGRA 1IQ8A 4EC6A 4LXCA 2F99A 1AQZA 1VQL3 2B13A 3KZTA 4KFFA 4BL3A 1BVIA 4FR9A 3EHCA 2K54A 1IVWA 1Y4KA 3CXC2 2ZL8A 4DKIA 2CC3A 1GMRA 1FZUA 1O7WB 1B2SA 1JB5A 1GLBF 1GOYA 1RCLA 2HMOB 2JDIH 1Q864 4N6OB 1LNHA 4ORLA 1F3ZA 4RNZA 1Q40A 1KD14 2XGLA 3B4OA 3KN4A 2CG0A 1VQP3 2W04A 4WYKB 3G713 3K7CA 1VQQA 3FCSB 1SARA 3ZFZA 1WMPA 3N54B 1GLCF 3BNEA 3G4S3 1JV2B 1JB4A 4WHAA 1X1YA 3AHSA 1UW1A 4LEHA 5GSPA 4K90B 1IQYA 4LSOA 1BOXA 1X1XA 3G8ZA 1Q9EA 3K0ZA 2L1SA 4HVNA 1RKYA 1KQS2 1QAKA 3FGYA 2OQEC 4Q53A 1O7PB 4U13A 1RGCA 1LNIA 3N8BA 2GEYA 1RMSA 1BSBA 1UCIA
chains in the Genus database with same CATH topology
3F7SA 4QPBA 2CFDA 5IENA 3PGBA 3NYYA 1ROAA 1O7HB 1OF5A 4HZ9B 3IJEB 5IEPA 5AIFA 3I563 1IDPA 1TP6A 3UJMA 3EB8A 3FG3A 1AVLA 4N6UA 3IT5A 1GY7A 3S5CA 4BTXA 1IK3A 3WOFB 1F3GA 2CWVA 2KRTA 1O7MB 1WNHA 3PZWA 4L7KA 3HIIA 4N6LA 4KFEA 1VQM3 3BB9A 3SEDA 3KE7A 4AKYA 4L8OA 4MJDA 3BNDA 1Z1SA 3F14A 3CD63 4WWUC 1US1A 2OTL3 1FUWA 1YJN3 3TUFB 3D3LA 3GZXB 4HM0B 3IPTA 2BHMA 3NV0B 3I553 1QVF2 2HMKB 1Q7Y4 3PXMA 1IV9A 4N6TA 5BXQA 2QGUA 1IQXA 2CFGA 5CLKA 3NHXA 3VF1A 2BT3A 4LGQA 4XM4A 2Y73A 1M1K4 1TFOA 1YJW3 1SJWA 1O2FA 3KKGA 2INXA 2HSIA 3OWSA 3F40A 4XBYA 3K63A 3JUNA 1GYBA 1VQ83 1FGTA 1NB3I 2P05A 4N6NB 3U1WA 5EEOA 3L0RA 4OVMA 5JPPA 2P0XA 1QWYA 3LZAA 4FMAA 5IF6A 5G2GA 2WGQA 4EV2A 1CYUA 3OWYA 1EG9B 3VGNA 2STDA 1WTHA 4NHFA 1SIIA 2MC8A 2LQVA 3CCE3 2BMRB 3DZLA 4HM6B 3SOYA 5DREA 3KFQC 1YIT3 2M7OA 3V98A 2K0MA 3S67A 3EN8A 3UB1A 3DGLA 3MKIA 3NUVA 1FGMA 1Q40B 3FLJA 1K734 3X41A 1MNLA 4XDWA 1STDA 2OTJ3 2I9WA 3T8NA 4R4KA 5ELJA 3MSOA 1ULJB 2W9PA 3CCM3 3CNMA 1N9JA 3CCV3 1BUQA 1T5YA 3GWRA 4FMBA 1EA2A 3X40A 2HMJB 2XF3A 4XB5A 3OW22 2CHCA 3MPHA 3SOAA 3BNCA 3HX8A 3UZ0B 4N6MA 4H3UA 1R4CA 1TIJA 1OF5B 1W01A 5KP3A 3KSED 3X3ZA 1M904 3RDEA 2CG1A 3PYJA 3MYTA 4EBGA 3HI7A 4HKVB 4K1VA 2P0MA 3LMLA 2GPRA 5CK6A 2BMOB 4KZ1A 3H3HA 4FMCA 2XRXB 3T0UA 2MF7A 2W2CA 2CIUA 2F98A 2QA43 5IG4A 2E2TA 2W03A 4R1KA 4RBNA 3SX1A 2W9QA 2YFLB 1JKGA 2Z7AA 1OUNA 2GEXA 1PFPA 2XGNA 1OHPA 4TX4A 3IMAB 2E2UA 2W56A 4HM3B 1NDOB 1YGEA 2BO9B 1GLEF 3B8LA 1F8NA 4JF8A 5KP4A 2CFWA 1ZX2A 4H61A 3WOEB 1WMOA 1JJ22 2OOVC 3F9SA 1EQKA 4O2HA 4EYCA 3Q1CA 3CCQ3 2CFLA 2YX9A 4XBTA 3E99A 2CKFB 2V1LA 3HZPA 2CK3H 4HM4B 1DYUA 3QRDA 5IG0A 1OGZA 3D9RA 4FCMA 3OURB 1ASKA 1WMNA 2D42A 3SLUA 3Q2PA 1K9M4 1GY6A 1UUVB 1O7GB 1CYVA 2SBLA 3LTDA 5KVPA 1AVKA 1D6YA 4ZYBA 2XR8B 3JVCA 4I4KA 3CC73 3FG1A 8CHOA 3X42A 1LXEA 2OQEA 1CEWI 2XH9A 1GLDF 1CQSA 3LXUX 1A2VA 2E2VA 1M9GA 4HM2B 1VQ73 3BNBA 3FF0A 5IERA 2RFRA 3DXOA 4STDA 3UL5A 1VQ53 3ALAA 3FKAA 3NM2A 4GB5A 2HMNB 2MP0B 5FW5A 2GBXB 4IIAA 1GLAF 4IPBA 1HU9A 3LTCA 2FNQA 1IVUA 3WA3A 1A90A 3LH4A 4O8SA 5AEWB 1GGRA 5AIGA 2IUKA 4MMXB 5FGOA 1TU5A 4L8PA 5I97A 1TFKA 3O8YA 4FMDA 3EBTA 3EN1B 3NBBA 5AIHA 5LC6A 3RGAA 3LTBA 1AX3A 1K28A 1OACA 1ZO2A 1W02A 3ER7A 1QALA 2JQ5A 5ELUA 3GRDA 3M8CA 1KSIA 1AR0A 4FCZA 1WQLB 1PU4A 2IUJA 3TDGA 5STDA 1IVVA 1A67A 3B7CA 3PCSA 4AEQA 5A0OB 3X3YA 2RCDA 4JBWM 1LOXA 5AI1A 2A15A 2FXTA 2PZVA 1W2ZA 2CFKA 1QJGA 3FF2A 1SIHA 2WGOA 3OWUA 4K61A 2QIYA 3GAXA 3T8UA 5D82A 1RN7A 1ISKA 2IA7A 2CW9A 2Z6BA 2GBWB 4QP5A 1Q824 3CCR3 3H51A 1FA3A 2WOFA 3K9MC 3NQZA 5IW9A 5IEOA 1OH0A 3J7Yd 3G16A 1JKGB 2XSHB 1GPRA 1OHOA 3BLZA 1IT8A 4XDVA 5LC7A 3WODG 3LOYA 3CC43 2W56B 2IMJA 3MG1A 1W6CA 3NBRA 4HBRA 3I0YA 1UI7A 3OX9A 1W4NA 3G0KA 4WP5A 1STFI 3WA2X 1RJOA 4GL6A 3MHEA 1LVNA 1RRHA 3CU3A 1RRLA 3LYGA 3CCS3 1QVG2 3DGNA 3KSPA 1N8QA 4NREA 1VQ43 1SQWA 2O9UX 5AEUB 2UX0A 4N6V0 4IT7A 2C11A 3NXJA 1IT7A 3CME3 1QAFA 2Q07A 4X2HA 4BTWA 4KFDA 2B1XB 4HZBB 4MEIA 1JB2A 2PNCA 1S5AA 5BVBA 2RGQA 1EKMA 1A2KA 1JNQA 1GD3A 2P38A 3EX9A 3KIIA 4CDLA 1MOLA 1K8A4 2Z77A 1E97A 3LT9A 2GU3A 3GZBA 3UL6A 3EF8A 2CWUA 3N9HA 2KCDA 3AMOB 1OCVA 1J2BA 1N5HA 4J8TA 2ZDJA 5EVHA 3HK4A 4ZM8A 5B0HA 1KWIA 2B0PA 1YHQ3 1GS3A 3CNXA 3IT7A 3A76A 3MG2A 1D6UA 3GZRA 1S723 2WOHA 1QMAA 1W5ZA 3B4PA 4BTYA 3F7XA 2C10A 1W7CA 5AYSC 4CCVA 4BH5A 1UI8A 4FCJA 2Y74A 5CXOA 1G96A 4G1MB 3S27A 3OV4A 1NO3A 2ML5A 1NB5I 3PS8A 5CF1A 1JN5B 2FGTA 2RSXA 3U97A 2B24B 3G6E3 2XFSA 4RZMA 2F3GA 2L4VA 2XSOB 1C7HA 4HM1B 4HM7B 3X3XA 1L5GB 3CCJ3 3JUOA 1AV4A 3STDA 1K41A 1DVCA 5D81A 1FGOA 4O3VA 1IU7A 1SPUA 3AMOA 3JUQA 4MMYB 1GD4A 2YFJB 3ECFA 1IVXA 2R4IA 3HIGA 1N8R4 4WFOA 2ML6A 1W6GA 1Q42A 4RNYA 1E3VA 2OOVA 3S29A 5IG5A 1VZZA 4R9LA 4R9KA 4O02B 4LZIA 3FG4A 4WYKA 1OPYA 2LYXA 3EJVA 3CPW2 1U8CB 4OK0A 3CPOA 4HM8B 1HKXA 1GY5A 2W6JH 2B44A 1W2B2 3OXAA 3NX0A 3FH1A 3FZWA 1OHSA 3V99A 1DMMA 1UUWB 1E3RA 2BNGA 4LMIA 1U5OA 1JN5A 5JPUA 1NU3A 4HM5B 2CH9A 1YIJ3 4AKZA 1FGQA 5TGNA 3ROBA 4J9AA 5JBSA 1N9EA 3DY5A 4KVHA 4PEJA 3DM8A 2P09A 3CCL3 1W6YA 3LT8A 4K1UA 1D6ZA 3CMA3 3MG3A 1Q814 3F8XA 5AYRB 1ROVA 3UNLA 3NBJA 1DMQA 3EQQB 4EV5A 1M1XB 2BMQB 2D1WA 3WMDA 5EQLA 1VQ93 1O7NB 3LTAA 2Z76A 2KXGA 3SXXA 4QWTA 2XFTA 3EC9A 3S28A 2OWPA 1NJI4 3PCRA 3K5TA 1W00A 3DGOA 3QK9A 3Q90A 5HGRA 4HYZA 5AIIA 3NQYA 4R80A 2WO0A 3DGMA 1VQN3 4N3VA 1TUHA 3DUKA 4OUQA 3EBYA 3NV0A 4XBXA 5CF2A 5IG3A 2XEPA 1NWWA 1OGXA 3F8HA 6STDA 5KP1A 1DVDA 3NM7A 4EXRA 3VSYA 2QEX3 4X2OA 3V92A 1N5PA 2O3OA 1VQK3 1YJ93 2GU1A 2YFIB 3CSQA 1VQ63 4MMZB 2GXFA 3JUMA 1FGRA 1IV7A 2W0QA 1DMNA 3GZYB 1JRQA 3JUPA 5D83A 2HMMB 1KC84 2OCTA 2F86B 4JRFA 1V74A 1VQO3 3SVAA 3EE1A 4HJLB 3WDGB 3DMCA 3CCU3 1YVBI 1YI23 3CC23 5DRVA 3MWZA 1ULIB 2CWTA 2HMLB 3FSDA 3RGRA 1IQ8A 4EC6A 4LXCA 2F99A 1VQL3 2B13A 3KZTA 4KFFA 4FR9A 3EHCA 2K54A 1IVWA 1Y4KA 3CXC2 2ZL8A 2CC3A 1O7WB 1JB5A 1GLBF 1Q864 2HMOB 2JDIH 4N6OB 1LNHA 4ORLA 1F3ZA 4RNZA 1Q40A 1KD14 2XGLA 3B4OA 3KN4A 2CG0A 1VQP3 2W04A 4WYKB 3G713 3K7CA 3FCSB 1WMPA 3N54B 1GLCF 3BNEA 3G4S3 1JV2B 1JB4A 4WHAA 1UW1A 4LEHA 4K90B 1IQYA 4LSOA 3G8ZA 3K0ZA 4HVNA 1RKYA 1KQS2 1QAKA 3FGYA 2OQEC 4Q53A 1O7PB 4U13A 3N8BA 2GEYA 7STDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QP5 A;  4QPB A;  1AX3 A;  3NYY A;  2GPR A;  1GPR A;  1GLD F;  1GLC F;  4RNY A;  4LXC A;  3OUR B;  3IT5 A;  4BH5 A;  3SLU A;  1F3G A;  2MP0 B;  1O2F A;  3UZ0 B;  2B13 A;  2HSI A;  1GLA F;  4JBW M;  2GU1 A;  3CSQ A;  5B0H A;  5KVP A;  1QWY A;  2F3G A;  1GGR A;  1GLB F;  2B0P A;  1GLE F;  2B44 A;  3TUF B;  4ZYB A;  3IT7 A;  1F3Z A;  4RNZ A; 
#chains in the Genus database with same CATH topology
 2UGI A;  3F7S A;  4QPB A;  2CFD A;  5IEN A;  3PGB A;  3NYY A;  1ROA A;  1O7H B;  1OF5 A;  4HZ9 B;  9RNT A;  3IJE B;  5IEP A;  5AIF A;  3ZG0 A;  3I56 3;  1IDP A;  1TP6 A;  3UJM A;  3EB8 A;  1LOW A;  3FG3 A;  1AVL A;  4N6U A;  3IT5 A;  1GY7 A;  3S5C A;  4BTX A;  1IK3 A;  2BIR A;  1F3G A;  2CWV A;  2KRT A;  3BU4 A;  1O7M B;  1WNH A;  3WOF B;  3PZW A;  3Q3F A;  3HII A;  4L7K A;  4N6L A;  3RNT A;  1RGA A;  1B21 A;  4KFE A;  3BB9 A;  5G1K A;  1EEJ A;  1VQM 3;  3SED A;  3KE7 A;  4AKY A;  4L8O A;  4MJD A;  3BND A;  3D79 A;  1RDS A;  1Z1S A;  3F14 A;  3CD6 3;  4WWU C;  1RGF A;  1US1 A;  2OTL 3;  1FUW A;  1YJN 3;  3TUF B;  3D3L A;  3GZX B;  4HM0 B;  1I2F A;  3IPT A;  2BHM A;  3NV0 B;  3I55 3;  1BRJ A;  1QVF 2;  1C54 A;  1LQM B;  2K3D A;  2HMK B;  2ZHX B;  2H0H A;  3PXM A;  5RNT A;  1Q7Y 4;  4GHO A;  1TJD A;  1MWU A;  1IV9 A;  4N6T A;  2KAA A;  5BXQ A;  2QGU A;  1IQX A;  2CFG A;  5CLK A;  3NHX A;  3VF1 A;  2BT3 A;  4LGQ A;  4XM4 A;  2Y73 A;  1M1K 4;  1TFO A;  4CJN A;  1YJW 3;  1SJW A;  1O2F A;  1X1W A;  1B20 A;  3KKG A;  2INX A;  5M1A A;  2HSI A;  3OWS A;  3F40 A;  4XBY A;  3K63 A;  1X1U A;  1GYB A;  3JUN A;  1FGT A;  1VQ8 3;  1NB3 I;  2P05 A;  4N6N B;  3U1W A;  5EEO A;  3L0R A;  7GSP A;  4OVM A;  5JPP A;  2P0X A;  1QWY A;  3LZA A;  4FMA A;  5M19 A;  5IF6 A;  5G2G A;  2GSP A;  1FUT A;  2WGQ A;  4EV2 A;  1CYU A;  3OWY A;  1EG9 B;  1HZ1 A;  3VGN A;  1BSA A;  2STD A;  4CPK A;  1WTH A;  4NHF A;  1SII A;  2MC8 A;  2LQV A;  1I0X A;  2BMR B;  3CCE 3;  2ZA4 A;  3DZL A;  4HM6 B;  3SOY A;  5DRE A;  3KFQ C;  1YIT 3;  2M7O A;  2C4B A;  3V98 A;  1LOY A;  2HOH A;  2K0M A;  1BGS A;  3S67 A;  1UGI A;  1LQG C;  3EN8 A;  3DGL A;  3MKI A;  3UB1 A;  4NPB A;  3NUV A;  1FGM A;  1Q40 B;  3FLJ A;  1GMP A;  4ILF A;  1K73 4;  3X41 A;  1MNL A;  4XDW A;  1B2U A;  1STD A;  1BSD A;  3DH2 A;  1RNB A;  2OTJ 3;  2I9W A;  3T8N A;  4R4K A;  5ELJ A;  1K8A 4;  3MSO A;  1ULJ B;  2W9P A;  3CCM 3;  3CNM A;  1BRN L;  1BIR A;  1N9J A;  3CCV 3;  1B2M A;  1BUQ A;  1T5Y A;  3GWR A;  4FMB A;  1EA2 A;  3X40 A;  2HMJ B;  2XF3 A;  1PY3 A;  3D4A A;  4XB5 A;  3OW2 2;  2CHC A;  3MPH A;  3URP A;  3SOA A;  3BNC A;  3HX8 A;  1AY7 A;  1GOU A;  1BSC A;  1I3F A;  3UZ0 B;  4N6M A;  4H3U A;  1R4C A;  1TIJ A;  1OF5 B;  1W01 A;  5KP3 A;  3KSE D;  4GSP A;  3X3Z A;  1M90 4;  2R41 A;  3RDE A;  2CG1 A;  3PYJ A;  3MYT A;  4EBG A;  1BRI A;  3HI7 A;  6GSP A;  4HKV B;  4K1V A;  1ZS7 A;  2P0M A;  3LML A;  2KF3 A;  1RTU A;  2GPR A;  5CK6 A;  2BMO B;  4KZ1 A;  3H3H A;  4FMC A;  2XRX B;  3ZG5 A;  3T0U A;  2MF7 A;  2W2C A;  2CIU A;  2F98 A;  2CX1 A;  2QA4 3;  5IG4 A;  2E2T A;  2W03 A;  4R1K A;  2CX0 A;  4RBN A;  3SX1 A;  2W9Q A;  2YFL B;  1JKG A;  2Z7A A;  1OUN A;  2GEX A;  1PFP A;  2XGN A;  1OHP A;  4TX4 A;  3IMA B;  2E2U A;  2W56 A;  4HM3 B;  1RGL A;  5BU4 A;  1NDO B;  1YGE A;  2BO9 B;  1GLE F;  1I8V A;  3B8L A;  2SAR A;  1F8N A;  4JF8 A;  7RNT A;  5KP4 A;  2CFW A;  1I2G A;  1ZX2 A;  4H61 A;  3WOE B;  1MGR A;  1WMO A;  1T2H A;  2OOV C;  3F9S A;  1JJ2 2;  4O2H A;  1EQK A;  1BNF A;  3Q1C A;  4EYC A;  3CCQ 3;  2CFL A;  2YX9 A;  4XBT A;  3E99 A;  2CKF B;  2V1L A;  1UDI I;  2CK3 H;  3HZP A;  4HM4 B;  1DYU A;  3QRD A;  5IG0 A;  1BSE A;  1OGZ A;  3D9R A;  4FCM A;  3OUR B;  1ASK A;  1G0T A;  1WMN A;  3SLU A;  2D42 A;  3Q2P A;  8RNT A;  1K9M 4;  2KF5 A;  1UUG B;  1GOV A;  1GY6 A;  1UUV B;  3D5I A;  1LRA A;  1O7G B;  1CYV A;  2SBL A;  3LTD A;  5KVP A;  1AVK A;  1D6Y A;  1BNG A;  4ZYB A;  2XR8 B;  3JVC A;  4HAA A;  4I4K A;  1I0V A;  3CC7 3;  3FG1 A;  8CHO A;  3X42 A;  1LXE A;  2OQE A;  5BIR A;  1CEW I;  4BIR A;  1RLS A;  1T2I A;  1B2Z A;  2UUG C;  2XH9 A;  1GLD F;  1CQS A;  1RN4 A;  3LXU X;  4BU4 A;  1A2V A;  2E2V A;  1M9G A;  2RNT A;  4HM2 B;  1VQ7 3;  3BNB A;  3FF0 A;  2AAE A;  5IER A;  2RFR A;  4I5Q A;  1B27 A;  3DXO A;  4STD A;  3UL5 A;  1VQ5 3;  3ALA A;  3FKA A;  3NM2 A;  4GB5 A;  2HMN B;  2MP0 B;  4EW5 A;  5FW5 A;  1DE3 A;  2GBX B;  1T3B A;  4IIA A;  6RNT A;  1GLA F;  5G1L A;  4IPB A;  1HU9 A;  3LTC A;  1TRP A;  1IVU A;  1BRH A;  2FNQ A;  3WA3 A;  3LH4 A;  1A90 A;  4O8S A;  5AEW B;  1GGR A;  5AIG A;  2IUK A;  1BUJ A;  4MMX B;  5FGO A;  1UCJ A;  1YGW A;  1TU5 A;  4L8P A;  5I97 A;  1TFK A;  3O8Y A;  4FMD A;  3EBT A;  3EN1 B;  3NBB A;  4KT3 B;  5AIH A;  5LC6 A;  3RGA A;  3LTB A;  1AX3 A;  1K28 A;  1OAC A;  1RCK A;  1ZO2 A;  1G02 A;  1W02 A;  3ER7 A;  1QAL A;  2JQ5 A;  5ELU A;  1UGH I;  3GRD A;  3M8C A;  1KSI A;  1AR0 A;  4FCZ A;  4BL2 A;  1FW7 A;  1WQL B;  1PU4 A;  2IUJ A;  3TDG A;  1DET A;  5STD A;  1IVV A;  1A67 A;  3B7C A;  2F4Y A;  3PCS A;  4AEQ A;  5A0O B;  3X3Y A;  2RCD A;  4JBW M;  1LOX A;  5AI1 A;  2A15 A;  2FXT A;  2PZV A;  1W2Z A;  2CFK A;  1QJG A;  3FF2 A;  1SIH A;  2BU4 A;  2WGO A;  3OWU A;  4K61 A;  2QIY A;  3GAX A;  1B3S A;  2IYJ A;  3T8U A;  5D82 A;  1RN7 A;  1ISK A;  2CW9 A;  2IA7 A;  2Z6B A;  2GBW B;  4QP5 A;  1Q82 4;  3CCR 3;  3H51 A;  1FA3 A;  2WOF A;  3K9M C;  3NQZ A;  5IW9 A;  5IEO A;  1OH0 A;  3J7Y d;  3G16 A;  1JKG B;  2XSH B;  1GPR A;  1OHO A;  3BLZ A;  1IT8 A;  1B2X A;  4XDV A;  5LC7 A;  3WOD G;  3LOY A;  3CC4 3;  2W56 B;  2IMJ A;  3MG1 A;  1W6C A;  3NBR A;  4HBR A;  1RGG A;  3I0Y A;  1UI7 A;  3OX9 A;  1W4N A;  3G0K A;  4WP5 A;  1STF I;  3WA2 X;  1RJO A;  4GL6 A;  3MHE A;  1LVN A;  1RRH A;  1BRG A;  3CU3 A;  1RRL A;  3LYG A;  3CCS 3;  1QVG 2;  3DGN A;  3KSP A;  1N8Q A;  4NRE A;  1VQ4 3;  1BNJ A;  1SQW A;  2O9U X;  5AEU B;  2UX0 A;  1I3I A;  5IG3 A;  4N6V 0;  1IYY A;  4IT7 A;  2C11 A;  3NXJ A;  1IT7 A;  1MWR A;  3CME 3;  1QAF A;  1HYF A;  2Q07 A;  4X2H A;  4BTW A;  1RGH A;  2AAD A;  4KFD A;  2B1X B;  4HZB B;  4MEI A;  1JB2 A;  2PNC A;  1S5A A;  5BVB A;  2RGQ A;  1EKM A;  1A2K A;  1JNQ A;  1GD3 A;  2P38 A;  3EX9 A;  1BU4 A;  3D5G A;  3KII A;  1MGW A;  1MOL A;  1MWT A;  4CDL A;  1R4Y A;  2Z77 A;  1E97 A;  3LT9 A;  1UCL A;  1RHL A;  2GU3 A;  3EF8 A;  2F5W A;  3GZB A;  4J5K A;  3UL6 A;  2CWU A;  3N9H A;  2KCD A;  3AMO B;  1OCV A;  1J2B A;  1BAO A;  1N5H A;  1BRS A;  2RBI A;  4J8T A;  3HOH A;  2ZDJ A;  5EVH A;  3HK4 A;  4ZM8 A;  5B0H A;  1KWI A;  3SYU A;  2B0P A;  1YHQ 3;  1GS3 A;  3CNX A;  3IT7 A;  3A76 A;  3MG2 A;  1D6U A;  1GMQ A;  1UCK A;  1JBS A;  2F56 A;  3A5E A;  3GZR A;  1S72 3;  2WOH A;  1BNS A;  1QMA A;  1W5Z A;  3B4P A;  1TTO A;  1RGK A;  4BTY A;  3F7X A;  1CH0 A;  1LOV A;  2C10 A;  1W7C A;  5AYS C;  4CCV A;  4BH5 A;  1EUI C;  1UI8 A;  4FCJ A;  2Y74 A;  5CXO A;  1JZO A;  1BNI A;  1G96 A;  4G1M B;  3S27 A;  3OV4 A;  1NO3 A;  2ML5 A;  1NB5 I;  3PS8 A;  5CF1 A;  1JN5 B;  2FGT A;  2RSX A;  3U97 A;  2B24 B;  3WHO A;  3G6E 3;  2XFS A;  4RZM A;  2F3G A;  2L4V A;  2XSO B;  1C7H A;  4HM1 B;  4HM7 B;  3X3X A;  1L5G B;  3CCJ 3;  3JUO A;  1AV4 A;  1YNV X;  1RSN A;  3STD A;  1K41 A;  1DVC A;  5D81 A;  1FGO A;  4O3V A;  1A2P A;  1IU7 A;  1SPU A;  3AMO A;  3JUQ A;  2IY2 A;  4MMY B;  1BNR A;  1RN1 A;  3AHW A;  1BRK A;  1GD4 A;  2YFJ B;  3ECF A;  1IVX A;  2R4I A;  3HIG A;  1N8R 4;  4WFO A;  2ML6 A;  1W6G A;  1Q42 A;  4RNY A;  1E3V A;  1I2E A;  2OOV A;  3S29 A;  5IG5 A;  1VZZ A;  4R9L A;  4R9K A;  4O02 B;  4LZI A;  2F5M A;  3FG4 A;  4RNT A;  3BIR A;  4WYK A;  1OPY A;  2LYX A;  3EJV A;  3CPW 2;  1U8C B;  4OK0 A;  3CPO A;  4HM8 B;  1HKX A;  1GY5 A;  2W6J H;  1V58 A;  2B44 A;  1W2B 2;  3OXA A;  3NX0 A;  1Q7H A;  3FH1 A;  3FZW A;  1OHS A;  3V99 A;  1DMM A;  1FUS A;  1UUW B;  1E3R A;  2BNG A;  4LMI A;  1MWS A;  1U5O A;  1JN5 A;  5JPU A;  1NU3 A;  4HM5 B;  2CH9 A;  1YIJ 3;  1ZGX A;  1JZD A;  4AKZ A;  1FGQ A;  5TGN A;  3ROB A;  3KCH A;  4J9A A;  5JBS A;  1N9E A;  1JBT A;  1YVS A;  3DY5 A;  4KVH A;  1FYS A;  5M18 A;  4J5G A;  4PEJ A;  3DM8 A;  2P09 A;  3CCL 3;  1W6Y A;  3LT8 A;  4K1U A;  1D6Z A;  3DGY A;  3CMA 3;  3MG3 A;  5HOH A;  2KF4 A;  1Q81 4;  1NNV A;  3F8X A;  5AYR B;  1ROV A;  1TRQ A;  3UNL A;  3NBJ A;  1PYL A;  1DMQ A;  3EQQ B;  4EV5 A;  1M1X B;  2BMQ B;  2D1W A;  3WMD A;  5EQL A;  1VQ9 3;  1O7N B;  3LTA A;  2Z76 A;  2KXG A;  3SXX A;  4QWT A;  2XFT A;  3EC9 A;  4HOH A;  3S28 A;  3WR2 A;  2OWP A;  1NJI 4;  3PCR A;  3K5T A;  2J8X B;  1W00 A;  3DGO A;  3QK9 A;  3Q90 A;  5HGR A;  4HYZ A;  2KF6 A;  5AII A;  1RGE A;  3NQY A;  4R80 A;  2WO0 A;  3DGM A;  1VQN 3;  4N3V A;  1TUH A;  3AGN A;  3DUK A;  4LYL B;  3EBY A;  3NV0 A;  3GSP A;  4OUQ A;  4XBX A;  5CF2 A;  2XEP A;  1NWW A;  1I70 A;  1OGX A;  3F8H A;  7STD A;  6STD A;  5KP1 A;  1DVD A;  2H0I A;  3NM7 A;  4EXR A;  3VSY A;  2QEX 3;  4X2O A;  3V92 A;  1N5P A;  2O3O A;  1VQK 3;  1YJ9 3;  2GU1 A;  2YFI B;  3CSQ A;  1VQ6 3;  4MMZ B;  2GXF A;  3JUM A;  1FGR A;  1IV7 A;  2W0Q A;  1DMN A;  3GZY B;  1JRQ A;  1BNE A;  1RNT A;  3JUP A;  5D83 A;  2HMM B;  1GSP A;  1V57 A;  1KC8 4;  1JBR A;  2OCT A;  2F86 B;  4JRF A;  1V74 A;  1VQO 3;  3SVA A;  3EE1 A;  1BAN A;  4HJL B;  3DMC A;  3WDG B;  1YVB I;  3CCU 3;  1YI2 3;  2H0G A;  3CC2 3;  5DRV A;  3MWZ A;  3AGO A;  1ULI B;  2CWT A;  2HML B;  3FSD A;  3RGR A;  1IQ8 A;  4EC6 A;  4LXC A;  2F99 A;  1AQZ A;  1VQL 3;  2B13 A;  3KZT A;  4KFF A;  4BL3 A;  1BVI A;  4FR9 A;  3EHC A;  2K54 A;  1IVW A;  1Y4K A;  3CXC 2;  2ZL8 A;  4DKI A;  2CC3 A;  1GMR A;  1FZU A;  1O7W B;  1B2S A;  1JB5 A;  1GLB F;  1GOY A;  1RCL A;  2HMO B;  2JDI H;  1Q86 4;  4N6O B;  1LNH A;  4ORL A;  1F3Z A;  4RNZ A;  1Q40 A;  1KD1 4;  2XGL A;  3B4O A;  3KN4 A;  2CG0 A;  1VQP 3;  2W04 A;  4WYK B;  3G71 3;  3K7C A;  1VQQ A;  3FCS B;  1SAR A;  3ZFZ A;  1WMP A;  3N54 B;  1GLC F;  3BNE A;  3G4S 3;  1JV2 B;  1JB4 A;  4WHA A;  1X1Y A;  3AHS A;  1UW1 A;  4LEH A;  5GSP A;  4K90 B;  1IQY A;  4LSO A;  1BOX A;  1X1X A;  3G8Z A;  1Q9E A;  3K0Z A;  2L1S A;  4HVN A;  1RKY A;  1KQS 2;  1QAK A;  3FGY A;  2OQE C;  4Q53 A;  1O7P B;  4U13 A;  1RGC A;  1LNI A;  3N8B A;  2GEY A;  1RMS A;  1BSB A;  1UCI A; 
#chains in the Genus database with same CATH homology
 3F7S A;  4QPB A;  2CFD A;  5IEN A;  3PGB A;  3NYY A;  1ROA A;  1O7H B;  1OF5 A;  4HZ9 B;  3IJE B;  5IEP A;  5AIF A;  3I56 3;  1IDP A;  1TP6 A;  3UJM A;  3EB8 A;  3FG3 A;  1AVL A;  4N6U A;  3IT5 A;  1GY7 A;  3S5C A;  4BTX A;  1IK3 A;  3WOF B;  1F3G A;  2CWV A;  2KRT A;  1O7M B;  1WNH A;  3PZW A;  4L7K A;  3HII A;  4N6L A;  4KFE A;  1VQM 3;  3BB9 A;  3SED A;  3KE7 A;  4AKY A;  4L8O A;  4MJD A;  3BND A;  1Z1S A;  3F14 A;  3CD6 3;  4WWU C;  1US1 A;  2OTL 3;  1FUW A;  1YJN 3;  3TUF B;  3D3L A;  3GZX B;  4HM0 B;  3IPT A;  2BHM A;  3NV0 B;  3I55 3;  1QVF 2;  2HMK B;  1Q7Y 4;  3PXM A;  1IV9 A;  4N6T A;  5BXQ A;  2QGU A;  1IQX A;  2CFG A;  5CLK A;  3NHX A;  3VF1 A;  2BT3 A;  4LGQ A;  4XM4 A;  2Y73 A;  1M1K 4;  1TFO A;  1YJW 3;  1SJW A;  1O2F A;  3KKG A;  2INX A;  2HSI A;  3OWS A;  3F40 A;  4XBY A;  3K63 A;  3JUN A;  1GYB A;  1VQ8 3;  1FGT A;  1NB3 I;  2P05 A;  4N6N B;  3U1W A;  5EEO A;  3L0R A;  4OVM A;  5JPP A;  2P0X A;  1QWY A;  3LZA A;  4FMA A;  5IF6 A;  5G2G A;  2WGQ A;  4EV2 A;  1CYU A;  3OWY A;  1EG9 B;  3VGN A;  2STD A;  1WTH A;  4NHF A;  1SII A;  2MC8 A;  2LQV A;  3CCE 3;  2BMR B;  3DZL A;  4HM6 B;  3SOY A;  5DRE A;  3KFQ C;  1YIT 3;  2M7O A;  3V98 A;  2K0M A;  3S67 A;  3EN8 A;  3UB1 A;  3DGL A;  3MKI A;  3NUV A;  1FGM A;  1Q40 B;  3FLJ A;  1K73 4;  3X41 A;  1MNL A;  4XDW A;  1STD A;  2OTJ 3;  2I9W A;  3T8N A;  4R4K A;  5ELJ A;  3MSO A;  1ULJ B;  2W9P A;  3CCM 3;  3CNM A;  1N9J A;  3CCV 3;  1BUQ A;  1T5Y A;  3GWR A;  4FMB A;  1EA2 A;  3X40 A;  2HMJ B;  2XF3 A;  4XB5 A;  3OW2 2;  2CHC A;  3MPH A;  3SOA A;  3BNC A;  3HX8 A;  3UZ0 B;  4N6M A;  4H3U A;  1R4C A;  1TIJ A;  1OF5 B;  1W01 A;  5KP3 A;  3KSE D;  3X3Z A;  1M90 4;  3RDE A;  2CG1 A;  3PYJ A;  3MYT A;  4EBG A;  3HI7 A;  4HKV B;  4K1V A;  2P0M A;  3LML A;  2GPR A;  5CK6 A;  2BMO B;  4KZ1 A;  3H3H A;  4FMC A;  2XRX B;  3T0U A;  2MF7 A;  2W2C A;  2CIU A;  2F98 A;  2QA4 3;  5IG4 A;  2E2T A;  2W03 A;  4R1K A;  4RBN A;  3SX1 A;  2W9Q A;  2YFL B;  1JKG A;  2Z7A A;  1OUN A;  2GEX A;  1PFP A;  2XGN A;  1OHP A;  4TX4 A;  3IMA B;  2E2U A;  2W56 A;  4HM3 B;  1NDO B;  1YGE A;  2BO9 B;  1GLE F;  3B8L A;  1F8N A;  4JF8 A;  5KP4 A;  2CFW A;  1ZX2 A;  4H61 A;  3WOE B;  1WMO A;  1JJ2 2;  2OOV C;  3F9S A;  1EQK A;  4O2H A;  4EYC A;  3Q1C A;  3CCQ 3;  2CFL A;  2YX9 A;  4XBT A;  3E99 A;  2CKF B;  2V1L A;  3HZP A;  2CK3 H;  4HM4 B;  1DYU A;  3QRD A;  5IG0 A;  1OGZ A;  3D9R A;  4FCM A;  3OUR B;  1ASK A;  1WMN A;  2D42 A;  3SLU A;  3Q2P A;  1K9M 4;  1GY6 A;  1UUV B;  1O7G B;  1CYV A;  2SBL A;  3LTD A;  5KVP A;  1AVK A;  1D6Y A;  4ZYB A;  2XR8 B;  3JVC A;  4I4K A;  3CC7 3;  3FG1 A;  8CHO A;  3X42 A;  1LXE A;  2OQE A;  1CEW I;  2XH9 A;  1GLD F;  1CQS A;  3LXU X;  1A2V A;  2E2V A;  1M9G A;  4HM2 B;  1VQ7 3;  3BNB A;  3FF0 A;  5IER A;  2RFR A;  3DXO A;  4STD A;  3UL5 A;  1VQ5 3;  3ALA A;  3FKA A;  3NM2 A;  4GB5 A;  2HMN B;  2MP0 B;  5FW5 A;  2GBX B;  4IIA A;  1GLA F;  4IPB A;  1HU9 A;  3LTC A;  2FNQ A;  1IVU A;  3WA3 A;  1A90 A;  3LH4 A;  4O8S A;  5AEW B;  1GGR A;  5AIG A;  2IUK A;  4MMX B;  5FGO A;  1TU5 A;  4L8P A;  5I97 A;  1TFK A;  3O8Y A;  4FMD A;  3EBT A;  3EN1 B;  3NBB A;  5AIH A;  5LC6 A;  3RGA A;  3LTB A;  1AX3 A;  1K28 A;  1OAC A;  1ZO2 A;  1W02 A;  3ER7 A;  1QAL A;  2JQ5 A;  5ELU A;  3GRD A;  3M8C A;  1KSI A;  1AR0 A;  4FCZ A;  1WQL B;  1PU4 A;  2IUJ A;  3TDG A;  5STD A;  1IVV A;  1A67 A;  3B7C A;  3PCS A;  4AEQ A;  5A0O B;  3X3Y A;  2RCD A;  4JBW M;  1LOX A;  5AI1 A;  2A15 A;  2FXT A;  2PZV A;  1W2Z A;  2CFK A;  1QJG A;  3FF2 A;  1SIH A;  2WGO A;  3OWU A;  4K61 A;  2QIY A;  3GAX A;  3T8U A;  5D82 A;  1RN7 A;  1ISK A;  2IA7 A;  2CW9 A;  2Z6B A;  2GBW B;  4QP5 A;  1Q82 4;  3CCR 3;  3H51 A;  1FA3 A;  2WOF A;  3K9M C;  3NQZ A;  5IW9 A;  5IEO A;  1OH0 A;  3J7Y d;  3G16 A;  1JKG B;  2XSH B;  1GPR A;  1OHO A;  3BLZ A;  1IT8 A;  4XDV A;  5LC7 A;  3WOD G;  3LOY A;  3CC4 3;  2W56 B;  2IMJ A;  3MG1 A;  1W6C A;  3NBR A;  4HBR A;  3I0Y A;  1UI7 A;  3OX9 A;  1W4N A;  3G0K A;  4WP5 A;  1STF I;  3WA2 X;  1RJO A;  4GL6 A;  3MHE A;  1LVN A;  1RRH A;  3CU3 A;  1RRL A;  3LYG A;  3CCS 3;  1QVG 2;  3DGN A;  3KSP A;  1N8Q A;  4NRE A;  1VQ4 3;  1SQW A;  2O9U X;  5AEU B;  2UX0 A;  4N6V 0;  4IT7 A;  2C11 A;  3NXJ A;  1IT7 A;  3CME 3;  1QAF A;  2Q07 A;  4X2H A;  4BTW A;  4KFD A;  2B1X B;  4HZB B;  4MEI A;  1JB2 A;  2PNC A;  1S5A A;  5BVB A;  2RGQ A;  1EKM A;  1A2K A;  1JNQ A;  1GD3 A;  2P38 A;  3EX9 A;  3KII A;  4CDL A;  1MOL A;  1K8A 4;  2Z77 A;  1E97 A;  3LT9 A;  2GU3 A;  3GZB A;  3UL6 A;  3EF8 A;  2CWU A;  3N9H A;  2KCD A;  3AMO B;  1OCV A;  1J2B A;  1N5H A;  4J8T A;  2ZDJ A;  5EVH A;  3HK4 A;  4ZM8 A;  5B0H A;  1KWI A;  2B0P A;  1YHQ 3;  1GS3 A;  3CNX A;  3IT7 A;  3A76 A;  3MG2 A;  1D6U A;  3GZR A;  1S72 3;  2WOH A;  1QMA A;  1W5Z A;  3B4P A;  4BTY A;  3F7X A;  2C10 A;  1W7C A;  5AYS C;  4CCV A;  4BH5 A;  1UI8 A;  4FCJ A;  2Y74 A;  5CXO A;  1G96 A;  4G1M B;  3S27 A;  3OV4 A;  1NO3 A;  2ML5 A;  1NB5 I;  3PS8 A;  5CF1 A;  1JN5 B;  2FGT A;  2RSX A;  3U97 A;  2B24 B;  3G6E 3;  2XFS A;  4RZM A;  2F3G A;  2L4V A;  2XSO B;  1C7H A;  4HM1 B;  4HM7 B;  3X3X A;  1L5G B;  3CCJ 3;  3JUO A;  1AV4 A;  3STD A;  1K41 A;  1DVC A;  5D81 A;  1FGO A;  4O3V A;  1IU7 A;  1SPU A;  3AMO A;  3JUQ A;  4MMY B;  1GD4 A;  2YFJ B;  3ECF A;  1IVX A;  2R4I A;  3HIG A;  1N8R 4;  4WFO A;  2ML6 A;  1W6G A;  1Q42 A;  4RNY A;  1E3V A;  2OOV A;  3S29 A;  5IG5 A;  1VZZ A;  4R9L A;  4R9K A;  4O02 B;  4LZI A;  3FG4 A;  4WYK A;  1OPY A;  2LYX A;  3EJV A;  3CPW 2;  1U8C B;  4OK0 A;  3CPO A;  4HM8 B;  1HKX A;  1GY5 A;  2W6J H;  2B44 A;  1W2B 2;  3OXA A;  3NX0 A;  3FH1 A;  3FZW A;  1OHS A;  3V99 A;  1DMM A;  1UUW B;  1E3R A;  2BNG A;  4LMI A;  1U5O A;  1JN5 A;  5JPU A;  1NU3 A;  4HM5 B;  2CH9 A;  1YIJ 3;  4AKZ A;  1FGQ A;  5TGN A;  3ROB A;  4J9A A;  5JBS A;  1N9E A;  3DY5 A;  4KVH A;  4PEJ A;  3DM8 A;  2P09 A;  3CCL 3;  1W6Y A;  3LT8 A;  4K1U A;  1D6Z A;  3CMA 3;  3MG3 A;  1Q81 4;  3F8X A;  5AYR B;  1ROV A;  3UNL A;  3NBJ A;  1DMQ A;  3EQQ B;  4EV5 A;  1M1X B;  2BMQ B;  2D1W A;  3WMD A;  5EQL A;  1VQ9 3;  1O7N B;  3LTA A;  2Z76 A;  2KXG A;  3SXX A;  4QWT A;  2XFT A;  3EC9 A;  3S28 A;  2OWP A;  1NJI 4;  3PCR A;  3K5T A;  1W00 A;  3DGO A;  3QK9 A;  3Q90 A;  5HGR A;  4HYZ A;  5AII A;  3NQY A;  4R80 A;  2WO0 A;  3DGM A;  1VQN 3;  4N3V A;  1TUH A;  3DUK A;  4OUQ A;  3EBY A;  3NV0 A;  4XBX A;  5CF2 A;  5IG3 A;  2XEP A;  1NWW A;  1OGX A;  3F8H A;  6STD A;  5KP1 A;  1DVD A;  3NM7 A;  4EXR A;  3VSY A;  2QEX 3;  4X2O A;  3V92 A;  1N5P A;  2O3O A;  1VQK 3;  1YJ9 3;  2GU1 A;  2YFI B;  3CSQ A;  1VQ6 3;  4MMZ B;  2GXF A;  3JUM A;  1FGR A;  1IV7 A;  2W0Q A;  1DMN A;  3GZY B;  1JRQ A;  3JUP A;  5D83 A;  2HMM B;  1KC8 4;  2OCT A;  2F86 B;  4JRF A;  1V74 A;  1VQO 3;  3SVA A;  3EE1 A;  4HJL B;  3WDG B;  3DMC A;  3CCU 3;  1YVB I;  1YI2 3;  3CC2 3;  5DRV A;  3MWZ A;  1ULI B;  2CWT A;  2HML B;  3FSD A;  3RGR A;  1IQ8 A;  4EC6 A;  4LXC A;  2F99 A;  1VQL 3;  2B13 A;  3KZT A;  4KFF A;  4FR9 A;  3EHC A;  2K54 A;  1IVW A;  1Y4K A;  3CXC 2;  2ZL8 A;  2CC3 A;  1O7W B;  1JB5 A;  1GLB F;  1Q86 4;  2HMO B;  2JDI H;  4N6O B;  1LNH A;  4ORL A;  1F3Z A;  4RNZ A;  1Q40 A;  1KD1 4;  2XGL A;  3B4O A;  3KN4 A;  2CG0 A;  1VQP 3;  2W04 A;  4WYK B;  3G71 3;  3K7C A;  3FCS B;  1WMP A;  3N54 B;  1GLC F;  3BNE A;  3G4S 3;  1JV2 B;  1JB4 A;  4WHA A;  1UW1 A;  4LEH A;  4K90 B;  1IQY A;  4LSO A;  3G8Z A;  3K0Z A;  4HVN A;  1RKY A;  1KQS 2;  1QAK A;  3FGY A;  2OQE C;  4Q53 A;  1O7P B;  4U13 A;  3N8B A;  2GEY A;  7STD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...