4RNYA

Structure of helicobacter pylori csd3 from the orthorhombic crystal
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
363
structure length
359
Chain Sequence
MERLVWDKLTLLGFLEKNHIPQKLYYNLSSQDKELSAEIQSNVTYYTLRDANNTLIQALIPISQDLQIHIYKKGEDYFLDFIPIIFTRKEKTLLLSLQTSPYQDIIKATNDPLLANQLMNAYKKSVPFKRLVKNDKIAIVYTRDYRVGQAFGQPTIKMAMVSSRSNQYYLFSHSNGHYYDSKAQEVAGFLLETPVKYTRISSPFSYGRFHPVLKVRRPHYGVDYAAKHGSLIHSASDGRVGFMGVKAGYGKVVEIHLNELRLVYAHMSAFANGLKKGSFVKKGQIIGRVGSTGPHLHFGVYKNSRPINPLGYIRTAKSKLHGKQREVFLEKAQRSKQKLEELLKTHSFEKNSFYLLEGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical secreted protein
publication title Structure of Csd3 from Helicobacter pylori, a cell shape-determining metallopeptidase.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
total genus 94
structure length 359
sequence length 363
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01551 Peptidase_M23 Peptidase family M23
A PF18059 Csd3_N Csd3 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.70.10 Mainly Beta Distorted Sandwich Glucose Permease (Domain IIA) Glucose Permease (Domain IIA) 4rnyA03
3.10.450.350 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4rnyA02
1QWYA 4RNZA 4BH5A 2GU1A 2F3GA 1O2FA 1GLBF 2B13A 2HSIA 4QP5A 3NYYA 4ZYBA 2B44A 4RNYA 3UZ0B 3CSQA 2MP0B 1GLCF 3OURB 1GGRA 3IT5A 1F3GA 1GLEF 1GLDF 2GPRA 3SLUA 4LXCA 5B0HA 4QPBA 3TUFB 1AX3A 2B0PA 1GPRA 1GLAF 1F3ZA 4JBWM 3IT7A 5KVPA
chains in the Genus database with same CATH superfamily
1NWWA 1W01A 1K734 2CG1A 1JZDA 1HU9A 4HAAA 3EHCA 3EQQB 1IQ8A 2KF6A 1YVBI 4HM3B 3NYYA 4BIRA 4OK0A 2BO9B 1RJOA 1E3RA 1B2ZA 1X1WA 4KVHA 5D81A 3CXC2 1VQ83 3CSQA 1ROVA 1I3IA 3DXOA 1VQK3 1VQ43 1V58A 5AYSC 3X41A 1VQQA 2LQVA 3IT5A 1RGHA 3BB9A 1BRIA 3AMOB 3LT9A 1BSEA 4O3VA 4EC6A 2K0MA 2CH9A 3RGRA 1N9EA 1X1YA 3ECFA 4K1VA 1GLDF 2D1WA 2SARA 4GSPA 2V1LA 2M7OA 1V74A 1FUWA 1AX3A 1W6YA 4HBRA 1YNVX 1BNJA 2XGLA 2Y73A 2ZDJA 3BU4A 2BHMA 3OWYA 4R1KA 8CHOA 1BSCA 1OCVA 4HKVB 5CK6A 2KF3A 3F40A 4FCJA 9RNTA 1Q864 2F5MA 1Q824 1F8NA 2CWTA 1I3FA 3DGLA 2IY2A 1YVSA 4LEHA 2IYJA 3LOYA 3RGAA 4BTYA 2IA7A 1OHPA 4IT7A 3CCV3 2QA43 1BSAA 2LYXA 3KKGA 3ZFZA 2E2VA 5AI1A 1IVXA 1WMNA 2WGQA 2F98A 2JDIH 1B2XA 1STFI 1UW1A 1RGEA 2AADA 3UB1A 1MGRA 1JN5B 1T2HA 3DGMA 1VQP3 1AY7A 3ZG0A 5IG4A 1A2VA 1ASKA 3MG3A 4DKIA 1OACA 8RNTA 1QAFA 1I70A 4JBWM 1RLSA 3EB8A 3F14A 3OWSA 4KFEA 5BU4A 1JBRA 1RGKA 2W04A 3HIIA 4I5QA 4ORLA 4L8OA 5G1KA 3WR2A 1RHLA 2ML5A 3FZWA 1BIRA 1DMNA 3JVCA 2J8XB 4AKZA 1MGWA 3CCE3 1BU4A 2SBLA 1FGTA 3SVAA 3AMOA 3NV0B 5BVBA 1D6UA 1MNLA 3KN4A 1V57A 3FF2A 3WOFB 3PCRA 4XBYA 1YJN3 1F3GA 4N6V0 4FR9A 1RRLA 3CCU3 1YIJ3 1TJDA 4FCMA 2YFIB 5IERA 3Q90A 1IQXA 2OWPA 7STDA 1YIT3 2H0IA 3CCM3 3MSOA 1I2GA 2W56A 3EBYA 4HYZA 2WOFA 5A0OB 3WDGB 1G96A 3KSED 1RGCA 4GHOA 2FGTA 1UCIA 4X2OA 4ILFA 3F7SA 4BL3A 4EBGA 1E3VA 2FNQA 1IV9A 1SPUA 3G16A 1IV7A 1EA2A 3OWUA 5AEUB 2ML6A 1NNVA 5I97A 4RZMA 1MWRA 1B2MA 2CFDA 3SOAA 4LMIA 3MYTA 2P38A 5EEOA 3TDGA 3HIGA 2WGOA 1UUVB 2XEPA 1CYVA 4KT3B 4RNYA 1BAOA 3LXUX 4H61A 5DRVA 5LC6A 1FYSA 1SARA 1YGEA 4JF8A 1ZS7A 3EE1A 1HYFA 3SYUA 1Q9EA 1QALA 4N6OB 3QRDA 1YJW3 1RNTA 2HMMB 3VGNA 1OGZA 1W00A 3LZAA 1W2B2 1RCKA 3K7CA 5B0HA 4EV5A 4WHAA 1PY3A 5HGRA 1CQSA 3BIRA 1F3ZA 1VZZA 3M8CA 4AKYA 3CCR3 1JJ22 5IG3A 3NV0A 2GU1A 2P09A 1O2FA 1JZOA 1GD4A 2CC3A 2JQ5A 4IIAA 1BNFA 4HVNA 1HKXA 4FMAA 1KC84 5IW9A 5CF1A 1US1A 2P0MA 2R41A 3RNTA 4ZYBA 2CX1A 1WTHA 4OVMA 2QEX3 3UZ0B 4R4KA 1NJI4 3I563 5IG0A 2P05A 1BNIA 2ZL8A 2KXGA 3AGOA 1M904 3K0ZA 1FUSA 3CCL3 1S723 2IUJA 1IDPA 1GGRA 2B1XB 1FA3A 1OPYA 3Q1CA 5AIHA 3WODG 1TRQA 2YFJB 1LNIA 3JUQA 3J7Yd 3DUKA 4STDA 2BMRB 3CMA3 3H3HA 3DGOA 4HM4B 4WWUC 1L5GB 5CXOA 3CNMA 1RGGA 2ZA4A 1M9GA 1G0TA 3KE7A 1ROAA 2CK3H 4J5GA 3DM8A 2GXFA 3D5GA 4J5KA 1YJ93 1FGRA 1M1XB 3CPW2 1KQS2 2CKFB 2CFGA 4HM1B 2BMQB 1NB3I 1SIIA 3NXJA 4K1UA 4HM6B 4QP5A 3G6E3 2OTL3 2Z6BA 5AIIA 3S27A 2CFLA 1W7CA 4LYLB 1I8VA 1B2SA 2E2UA 4FMCA 3GZYB 3B7CA 3LTBA 3NM7A 3PS8A 3B4OA 1VQ73 3CD63 1RNBA 1BNEA 3OV4A 2CFKA 3K5TA 4H3UA 1Q40A 2CWVA 4CDLA 1LRAA 1DVDA 2Z76A 3D5IA 4RNZA 1GOUA 1WQLB 2L4VA 3MKIA 3HZPA 1NDOB 2W56B 2KAAA 4AEQA 3SOYA 2HSIA 3WHOA 2UX0A 1IQYA 2GSPA 3NX0A 3URPA 4HM8B 1U5OA 3UJMA 1E97A 1RDSA 1RN4A 1A2PA 2KF5A 2KRTA 5JPUA 3V92A 5JBSA 1J2BA 3V99A 1TP6A 1RCLA 1GSPA 4HJLB 1VQO3 4HZ9B 1GY5A 1O7GB 1UCLA 4RBNA 2I9WA 3CPOA 3FKAA 1IVUA 3L0RA 4K90B 5M1AA 2IMJA 3EJVA 7RNTA 1BRNL 5FW5A 4LXCA 2Q07A 1BUJA 3EBTA 3HOHA 3CNXA 3PYJA 3T8NA 3MPHA 1EQKA 1K28A 1LOXA 3LYGA 4BH5A 2STDA 2W6JH 2B24B 2O9UX 4LZIA 6STDA 1K8A4 4OUQA 2B13A 1OF5A 2BT3A 3D3LA 1HZ1A 2Y74A 4FMBA 5G1LA 3SXXA 3NQZA 1VQ53 2F86B 1UUGB 4HOHA 1IK3A 1LOYA 2W9QA 5BIRA 2W0QA 2Z7AA 3H51A 2CHCA 5ELJA 2MP0B 1BNGA 1LQMB 3E99A 1JB2A 4XBXA 4Q53A 3QK9A 4J8TA 1O7PB 2GU3A 4I4KA 5M19A 3BNEA 4R9LA 4R9KA 3PXMA 2F56A 2WO0A 4IPBA 3MWZA 2C10A 4CPKA 1IVVA 2R4IA 2C4BA 1UI7A 4HZBB 1CYUA 1FGQA 1N8QA 2XR8B 1UUWB 4XBTA 1SQWA 1IYYA 2YX9A 1QWYA 4G1MB 4MMYB 5IEOA 1AQZA 2F3GA 6RNTA 1DE3A 3I553 3MG1A 2QIYA 1N5HA 2RBIA 1BVIA 3BNCA 2HMKB 3I0YA 4MMZB 1VQL3 3DMCA 3MHEA 1EUIC 1BRKA 1O7HB 3OXAA 4EV2A 1QVG2 2MC8A 2BU4A 1BGSA 3SEDA 3LT8A 2UGIA 3LMLA 4XDWA 4WYKB 1GLEF 3FG3A 2HMOB 2ZHXB 3B8LA 2INXA 4HM7B 1LNHA 3SLUA 2GEYA 3K9MC 3N9HA 1NB5I 2OCTA 1KSIA 2B0PA 3FCSB 2CG0A 3AHWA 3X3YA 1JBTA 1STDA 1BRJA 3AGNA 1VQM3 5RNTA 1JB5A 3BLZA 3G0KA 1FGOA 4GL6A 3JUOA 3GZRA 4MMXB 4O8SA 1T2IA 1T3BA 1YGWA 5KP1A 1N8R4 1S5AA 1BNRA 2O3OA 1B27A 1Q40B 5FGOA 3F9SA 1BRHA 3NHXA 1DMMA 1UCJA 4ZM8A 2F5WA 5G2GA 2W9PA 1BRGA 3BNBA 1TRPA 4CCVA 4R80A 3NM2A 3UNLA 1GD3A 3D9RA 4L7KA 5LC7A 4LGQA 1VQN3 2K3DA 3KZTA 3X42A 3LH4A 4QPBA 5EVHA 1TIJA 3CCJ3 5AEWB 3IT7A 5KVPA 5AIFA 4EYCA 1Q7HA 2E2TA 2XGNA 4WP5A 5AIGA 3KCHA 1UCKA 3GWRA 1UDII 2Z77A 2KF4A 3IPTA 5JPPA 4WYKA 3KSPA 3S28A 3JUPA 1ZGXA 1ZO2A 2B44A 1CEWI 2QGUA 3G4S3 1JBSA 1WMPA 1SIHA 1AVLA 3O8YA 2HMNB 1KWIA 1X1UA 4BL2A 1I0VA 1OF5B 4JRFA 2OTJ3 1RRHA 1GMPA 1JKGB 1ZX2A 1MWTA 3WOEB 1Y4KA 1O7WB 3S67A 2GPRA 1AR0A 3S29A 3DH2A 1UI8A 3GZBA 1WMOA 1X1XA 1RGLA 3F7XA 2RGQA 1T5YA 4LSOA 3OX9A 1FW7A 1UGHI 1ULJB 1DETA 1I2FA 4N6LA 7GSPA 2XH9A 1MWUA 1A2KA 1W4NA 3FG1A 4EXRA 1TU5A 4HM0B 4U13A 2L1SA 1BOXA 3U97A 3HX8A 3LTAA 4N6MA 4TX4A 1Q814 1A90A 1DYUA 3G713 1OUNA 2H0HA 2CFWA 3CU3A 2CW9A 1D6YA 1OHSA 1VQ63 1RGFA 4NPBA 1JNQA 3KFQC 3NBJA 4PEJA 4XB5A 4EW5A 1RKYA 1TUHA 2XFSA 2GBXB 2RCDA 2HOHA 1IVWA 1AV4A 1YI23 4K61A 1GY6A 5STDA 1Q7Y4 1BANA 2GBWB 1MOLA 4BTXA 5HOHA 2YFLB 3T0UA 1G02A 2IUKA 3ZG5A 2C11A 2F4YA 2HMLB 2PZVA 3WA2X 2XFTA 3CC43 2RSXA 2PNCA 4KFFA 2XSOB 3NUVA 1D6ZA 1Z1SA 4GB5A 3N54B 5AYRB 1JKGA 4NHFA 1OHOA 2D42A 1IT7A 5M18A 3EF8A 3PZWA 1CH0A 2XSHB 1GOVA 3CCQ3 5D83A 3DGNA 1MWSA 5CF2A 1M1K4 4XDVA 5IG5A 2W03A 3PGBA 1UGIA 3NBRA 4MEIA 2AAEA 1WNHA 2CIUA 5IEPA 4N6TA 4BTWA 3TUFB 1LVNA 2RFRA 4FMDA 2OQEA 1GPRA 2A15A 1B2UA 2XF3A 3FGYA 1U8CB 2XRXB 3GSPA 1JV2B 4NREA 3DGYA 3DZLA 3VSYA 2CWUA 3AHSA 1K41A 3A5EA 1NU3A 1YHQ3 1N5PA 3A76A 3LTCA 3X3ZA 2UUGC 2WOHA 3CCS3 1BNSA 2OOVA 3U1WA 3F8XA 1C54A 1JB4A 2BMOB 1EKMA 1ULIB 4O2HA 3PCSA 1RN1A 4RNTA 1W2ZA 1QJGA 1OGXA 3UL6A 4N6UA 2BNGA 4MJDA 4X2HA 5GSPA 3SX1A 3V98A 4CJNA 3ROBA 1GYBA 3FH1A 1K9M4 2BIRA 1GLCF 1LOVA 4L8PA 2RNTA 1PU4A 1W6CA 2HMJB 2OQEC 3BNDA 1FGMA 1FUTA 3LTDA 1W5ZA 1IT8A 3FF0A 1FZUA 1EG9B 3WA3A 1Q42A 3Q3FA 3X40A 1DVCA 3VF1A 1GLAF 1B21A 3T8UA 3CME3 1TFKA 3CC73 2OOVC 1PFPA 5CLKA 5IF6A 1GMQA 3GAXA 3GZXB 4J9AA 5EQLA 3IMAB 3S5CA 3FSDA 1LQGC 1ISKA 5KP3A 3WMDA 5IENA 1RN7A 1JN5A 2KCDA 1I2EA 3EC9A 3EN8A 3Q2PA 3EN1B 3F8HA 4XM4A 3B4PA 3OW22 4HM5B 4KZ1A 4BU4A 1KD14 3ER7A 1W6GA 3OURB 1SJWA 1NO3A 4N3VA 1LOWA 3GRDA 4KFDA 1BUQA 3EX9A 3UL5A 1IU7A 3MG2A 1QMAA 4HM2B 1GS3A 3G8ZA 3NQYA 2CX0A 1QAKA 1BRSA 1VQ93 1N9JA 1RMSA 1TFOA 1GOYA 1LXEA 3X3XA 3HI7A 3N8BA 1O7MB 1C7HA 2F99A 5DREA 3FG4A 4FCZA 1GLBF 2H0GA 5BXQA 1QVF2 1RGAA 1BSDA 2P0XA 3IJEB 1AVKA 2K54A 3JUMA 1RSNA 3ALAA 4N6NB 1RTUA 5TGNA 1I0XA 5ELUA 6GSPA 1EEJA 1B20A 1TTOA 1A67A 1GMRA 2W2CA 1OH0A 1PYLA 3HK4A 4O02B 1JRQA 3FLJA 3K63A 4QWTA 3D4AA 1O7NB 3STDA 2FXTA 3JUNA 1B3SA 3NBBA 1R4CA 1GY7A 3D79A 5D82A 3DY5A 3KIIA 3CC23 1BSBA 2MF7A 4WFOA 1W02A 1DMQA 2GEXA 1R4YA 3RDEA 5KP4A
chains in the Genus database with same CATH topology
1NWWA 1W01A 1K734 2CG1A 1HU9A 3EHCA 3EQQB 1IQ8A 1YVBI 4HM3B 3NYYA 4OK0A 2BO9B 1RJOA 1E3RA 5D81A 4KVHA 1VQ83 3CXC2 3CSQA 1ROVA 1VQ43 3DXOA 1VQK3 5AYSC 3X41A 2LQVA 3IT5A 3BB9A 3LT9A 4O3VA 3AMOB 4EC6A 5JBSA 2K0MA 2CH9A 3RGRA 1N9EA 3ECFA 4K1VA 1GLDF 2D1WA 2V1LA 2M7OA 1V74A 1FUWA 1AX3A 1W6YA 4HBRA 4R1KA 2Y73A 2XGLA 2ZDJA 3OWYA 2BHMA 8CHOA 1OCVA 4HKVB 5CK6A 1Q824 3F40A 4FCJA 1Q864 1F8NA 2CWTA 3DGLA 3RGAA 4LEHA 3LOYA 4BTYA 2IA7A 1OHPA 4IT7A 3CCV3 2QA43 2LYXA 3KKGA 2E2VA 5AI1A 1IVXA 1WMNA 2WGQA 2F98A 2JDIH 1STFI 1UW1A 3UB1A 1JN5B 3DGMA 1VQP3 5IG4A 1A2VA 1ASKA 3MG3A 1OACA 1QAFA 4JBWM 3EB8A 3F14A 3OWSA 4KFEA 2W04A 3HIIA 4ORLA 4L8OA 3JVCA 2ML5A 3FZWA 1DMNA 4AKZA 3CCE3 2SBLA 1FGTA 3SVAA 3AMOA 3NV0B 5BVBA 1D6UA 1MNLA 3KN4A 3FF2A 3WOFB 3PCRA 4XBYA 1YJN3 1F3GA 4N6V0 4FR9A 1RRLA 3CCU3 1YIJ3 4FCMA 2YFIB 5IERA 3Q90A 1IQXA 2OWPA 7STDA 1YIT3 3CCM3 3MSOA 2W56A 3EBYA 4HYZA 5A0OB 2WOFA 3WDGB 1G96A 3KSED 4X2OA 4EBGA 2FGTA 3F7SA 1E3VA 2FNQA 1IV9A 1SPUA 3G16A 1EA2A 1IV7A 3OWUA 5AEUB 2ML6A 5I97A 4RZMA 2CFDA 3SOAA 4LMIA 3MYTA 2P38A 5EEOA 3TDGA 3HIGA 2WGOA 1UUVB 2XEPA 1CYVA 4RNYA 5DRVA 3LXUX 4H61A 5LC6A 1YGEA 4JF8A 3EE1A 1QALA 4N6OB 3QRDA 1YJW3 2HMMB 3VGNA 1OGZA 1W00A 3LZAA 1W2B2 3K7CA 5B0HA 4EV5A 4WHAA 5HGRA 1CQSA 1F3ZA 1VZZA 3M8CA 4AKYA 3CCR3 1JJ22 5IG3A 3NV0A 2GU1A 2P09A 1O2FA 1GD4A 2CC3A 2JQ5A 4IIAA 4HVNA 1HKXA 4FMAA 1KC84 5IW9A 5CF1A 1US1A 2P0MA 4ZYBA 1WTHA 4OVMA 2QEX3 3UZ0B 4R4KA 1NJI4 3I563 5IG0A 2P05A 2ZL8A 2KXGA 1M904 3K0ZA 3CCL3 1S723 2IUJA 1IDPA 1GGRA 2B1XB 1FA3A 1OPYA 3Q1CA 5AIHA 3WODG 2YFJB 3JUQA 3J7Yd 3DUKA 4STDA 2BMRB 3CMA3 3H3HA 3DGOA 4HM4B 4WWUC 1L5GB 5CXOA 3CNMA 1M9GA 3KE7A 1ROAA 2CK3H 3DM8A 2GXFA 1YJ93 1FGRA 1M1XB 3CPW2 1KQS2 2CKFB 2CFGA 4HM1B 2BMQB 1NB3I 1SIIA 3NXJA 4K1UA 4HM6B 4QP5A 3G6E3 2OTL3 2Z6BA 5AIIA 3S27A 2CFLA 1W7CA 2E2UA 4FMCA 3GZYB 3B7CA 3LTBA 3NM7A 3PS8A 3B4OA 1VQ73 3CD63 3OV4A 2CFKA 3K5TA 4H3UA 1Q40A 2CWVA 4CDLA 1DVDA 2Z76A 4RNZA 1WQLB 2L4VA 3MKIA 3HZPA 1NDOB 2W56B 4AEQA 3SOYA 2HSIA 2UX0A 1IQYA 3NX0A 4HM8B 1U5OA 3UJMA 1E97A 2KRTA 5JPUA 1J2BA 3V92A 3V99A 1TP6A 4HJLB 1VQO3 4HZ9B 1GY5A 1O7GB 4RBNA 2I9WA 3CPOA 3FKAA 1IVUA 3L0RA 4K90B 2IMJA 3EJVA 5FW5A 4LXCA 2Q07A 3EBTA 3CNXA 3PYJA 3T8NA 3MPHA 1EQKA 1K28A 1LOXA 3LYGA 4BH5A 2STDA 2W6JH 2B24B 2O9UX 4LZIA 6STDA 1K8A4 4OUQA 2B13A 1OF5A 2BT3A 3D3LA 2Y74A 4FMBA 3SXXA 3NQZA 1VQ53 2F86B 1IK3A 2W9QA 2W0QA 2Z7AA 3H51A 2CHCA 5ELJA 2MP0B 3E99A 1JB2A 4XBXA 4Q53A 3QK9A 4J8TA 1O7PB 2GU3A 4I4KA 3BNEA 4R9LA 4R9KA 3PXMA 2WO0A 4IPBA 3MWZA 2C10A 1IVVA 2R4IA 4HZBB 1UI7A 1CYUA 1FGQA 1N8QA 2XR8B 1UUWB 4XBTA 1SQWA 2YX9A 1QWYA 4G1MB 4MMYB 5IEOA 2F3GA 3I553 3MG1A 2QIYA 1N5HA 3I0YA 3BNCA 2HMKB 4MMZB 3DMCA 3MHEA 1O7HB 3OXAA 4EV2A 1QVG2 2MC8A 3SEDA 3LT8A 3LMLA 4XDWA 4WYKB 1GLEF 3FG3A 2HMOB 3B8LA 4HM7B 2INXA 1NB5I 1LNHA 3SLUA 2GEYA 3K9MC 3N9HA 2OCTA 1KSIA 2B0PA 3FCSB 2CG0A 3X3YA 1STDA 1VQM3 1JB5A 3BLZA 3G0KA 1FGOA 4GL6A 3JUOA 3GZRA 4MMXB 4O8SA 5KP1A 1N8R4 1S5AA 2O3OA 1Q40B 5FGOA 3F9SA 3NHXA 1DMMA 4ZM8A 5G2GA 2W9PA 3BNBA 4CCVA 4R80A 3NM2A 3UNLA 1GD3A 3D9RA 4L7KA 5LC7A 4LGQA 1VQN3 3KZTA 3X42A 3LH4A 4QPBA 5EVHA 1TIJA 3CCJ3 5AEWB 3IT7A 5KVPA 5AIFA 4EYCA 2E2TA 2XGNA 4WP5A 5AIGA 3GWRA 2Z77A 3IPTA 5JPPA 4WYKA 3KSPA 3S28A 3JUPA 1ZO2A 2B44A 1CEWI 2QGUA 3G4S3 1WMPA 1SIHA 1AVLA 3O8YA 2HMNB 1KWIA 1OF5B 4JRFA 2OTJ3 1RRHA 1JKGB 1ZX2A 3WOEB 1Y4KA 1O7WB 3S67A 2GPRA 1AR0A 3S29A 1UI8A 3GZBA 1WMOA 3F7XA 2RGQA 1T5YA 4LSOA 3OX9A 1ULJB 4N6LA 2XH9A 1A2KA 1W4NA 3FG1A 4EXRA 1TU5A 4HM0B 4U13A 3U97A 1Q814 3HX8A 3LTAA 4N6MA 4TX4A 1A90A 1DYUA 3G713 1OUNA 2CFWA 3CU3A 2CW9A 1D6YA 1OHSA 1VQ63 4PEJA 1JNQA 3KFQC 3NBJA 4XB5A 1RKYA 1TUHA 2XFSA 2GBXB 2RCDA 1IVWA 1AV4A 1YI23 4K61A 1GY6A 5STDA 1Q7Y4 2GBWB 4BTXA 1MOLA 2YFLB 3T0UA 2IUKA 2C11A 2HMLB 2PZVA 3WA2X 2XFTA 3CC43 2RSXA 2PNCA 4KFFA 2XSOB 3NUVA 1D6ZA 1Z1SA 4GB5A 3N54B 5AYRB 1JKGA 4NHFA 1OHOA 2D42A 1IT7A 3EF8A 3PZWA 2XSHB 3CCQ3 5D83A 3DGNA 5CF2A 1M1K4 4XDVA 5IG5A 2W03A 3PGBA 3NBRA 4MEIA 1WNHA 2CIUA 5IEPA 4N6TA 4BTWA 3TUFB 1LVNA 2RFRA 4FMDA 2OQEA 1GPRA 2A15A 2XF3A 3FGYA 1U8CB 2XRXB 3VSYA 1JV2B 4NREA 3DZLA 2CWUA 1K41A 1NU3A 1YHQ3 1N5PA 3A76A 3LTCA 3X3ZA 2WOHA 3CCS3 2OOVA 3U1WA 3F8XA 1JB4A 2BMOB 1EKMA 1ULIB 4O2HA 3PCSA 1W2ZA 1QJGA 1OGXA 3UL6A 4N6UA 2BNGA 4MJDA 4X2HA 3SX1A 3V98A 1VQL3 1K9M4 3ROBA 1GYBA 3FH1A 1GLCF 4L8PA 1PU4A 1W6CA 2HMJB 2OQEC 3BNDA 1FGMA 3LTDA 1W5ZA 1IT8A 3FF0A 1EG9B 3WA3A 1Q42A 3X40A 1DVCA 3VF1A 1GLAF 3CME3 3T8UA 1TFKA 3CC73 2OOVC 1PFPA 5CLKA 5IF6A 3GZXB 3GAXA 4J9AA 5EQLA 3IMAB 3S5CA 3FSDA 1ISKA 5KP3A 3WMDA 5IENA 1RN7A 1JN5A 2KCDA 3EC9A 3EN8A 3Q2PA 3EN1B 3F8HA 4XM4A 3B4PA 3OW22 4HM5B 4KZ1A 1KD14 3ER7A 1W6GA 3OURB 1SJWA 1NO3A 4N3VA 3GRDA 4KFDA 1BUQA 3EX9A 3UL5A 1IU7A 3MG2A 1QMAA 4HM2B 1GS3A 3G8ZA 3NQYA 1QAKA 1VQ93 1N9JA 1TFOA 1LXEA 3X3XA 3HI7A 3N8BA 1O7MB 1C7HA 2F99A 5DREA 3FG4A 4FCZA 1GLBF 5BXQA 1QVF2 2P0XA 3IJEB 1AVKA 2K54A 3JUMA 3ALAA 4N6NB 5TGNA 5ELUA 1A67A 2W2CA 1OH0A 4O02B 3HK4A 1JRQA 3FLJA 3K63A 4QWTA 1O7NB 3STDA 2FXTA 3JUNA 3NBBA 1R4CA 1GY7A 5D82A 3DY5A 3KIIA 3CC23 2MF7A 4WFOA 1W02A 1DMQA 2GEXA 3RDEA 5KP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWY A;  4RNZ A;  4BH5 A;  2GU1 A;  2F3G A;  1O2F A;  1GLB F;  2B13 A;  2HSI A;  4QP5 A;  3NYY A;  4ZYB A;  2B44 A;  4RNY A;  3UZ0 B;  3CSQ A;  2MP0 B;  1GLC F;  3OUR B;  1GGR A;  3IT5 A;  1F3G A;  1GLE F;  1GLD F;  2GPR A;  3SLU A;  4LXC A;  5B0H A;  4QPB A;  3TUF B;  1AX3 A;  2B0P A;  1GPR A;  1GLA F;  1F3Z A;  4JBW M;  3IT7 A;  5KVP A; 
#chains in the Genus database with same CATH topology
 1NWW A;  1W01 A;  1K73 4;  2CG1 A;  1JZD A;  1HU9 A;  4HAA A;  3EHC A;  3EQQ B;  1IQ8 A;  2KF6 A;  1YVB I;  4HM3 B;  3NYY A;  4BIR A;  4OK0 A;  2BO9 B;  1RJO A;  1E3R A;  1B2Z A;  1X1W A;  4KVH A;  5D81 A;  3CXC 2;  1VQ8 3;  3CSQ A;  1ROV A;  1I3I A;  3DXO A;  1VQK 3;  1VQ4 3;  1V58 A;  5AYS C;  3X41 A;  1VQQ A;  2LQV A;  3IT5 A;  1RGH A;  3BB9 A;  1BRI A;  3AMO B;  3LT9 A;  1BSE A;  4O3V A;  4EC6 A;  2K0M A;  2CH9 A;  3RGR A;  1N9E A;  1X1Y A;  3ECF A;  4K1V A;  1GLD F;  2D1W A;  2SAR A;  4GSP A;  2V1L A;  2M7O A;  1V74 A;  1FUW A;  1AX3 A;  1W6Y A;  4HBR A;  1YNV X;  1BNJ A;  2XGL A;  2Y73 A;  2ZDJ A;  3BU4 A;  2BHM A;  3OWY A;  4R1K A;  8CHO A;  1BSC A;  1OCV A;  4HKV B;  5CK6 A;  2KF3 A;  3F40 A;  4FCJ A;  9RNT A;  1Q86 4;  2F5M A;  1Q82 4;  1F8N A;  2CWT A;  1I3F A;  3DGL A;  2IY2 A;  1YVS A;  4LEH A;  2IYJ A;  3LOY A;  3RGA A;  4BTY A;  2IA7 A;  1OHP A;  4IT7 A;  3CCV 3;  2QA4 3;  1BSA A;  2LYX A;  3KKG A;  3ZFZ A;  2E2V A;  5AI1 A;  1IVX A;  1WMN A;  2WGQ A;  2F98 A;  2JDI H;  1B2X A;  1STF I;  1UW1 A;  1RGE A;  2AAD A;  3UB1 A;  1MGR A;  1JN5 B;  1T2H A;  3DGM A;  1VQP 3;  1AY7 A;  3ZG0 A;  5IG4 A;  1A2V A;  1ASK A;  3MG3 A;  4DKI A;  1OAC A;  8RNT A;  1QAF A;  1I70 A;  4JBW M;  1RLS A;  3EB8 A;  3F14 A;  3OWS A;  4KFE A;  5BU4 A;  1JBR A;  1RGK A;  2W04 A;  3HII A;  4I5Q A;  4ORL A;  4L8O A;  5G1K A;  3WR2 A;  1RHL A;  2ML5 A;  3FZW A;  1BIR A;  1DMN A;  3JVC A;  2J8X B;  4AKZ A;  1MGW A;  3CCE 3;  1BU4 A;  2SBL A;  1FGT A;  3SVA A;  3AMO A;  3NV0 B;  5BVB A;  1D6U A;  1MNL A;  3KN4 A;  1V57 A;  3FF2 A;  3WOF B;  3PCR A;  4XBY A;  1YJN 3;  1F3G A;  4N6V 0;  4FR9 A;  1RRL A;  3CCU 3;  1YIJ 3;  1TJD A;  4FCM A;  2YFI B;  5IER A;  3Q90 A;  1IQX A;  2OWP A;  7STD A;  1YIT 3;  2H0I A;  3CCM 3;  3MSO A;  1I2G A;  2W56 A;  3EBY A;  4HYZ A;  2WOF A;  5A0O B;  3WDG B;  1G96 A;  3KSE D;  1RGC A;  4GHO A;  2FGT A;  1UCI A;  4X2O A;  4ILF A;  3F7S A;  4BL3 A;  4EBG A;  1E3V A;  2FNQ A;  1IV9 A;  1SPU A;  3G16 A;  1IV7 A;  1EA2 A;  3OWU A;  5AEU B;  2ML6 A;  1NNV A;  5I97 A;  4RZM A;  1MWR A;  1B2M A;  2CFD A;  3SOA A;  4LMI A;  3MYT A;  2P38 A;  5EEO A;  3TDG A;  3HIG A;  2WGO A;  1UUV B;  2XEP A;  1CYV A;  4KT3 B;  4RNY A;  1BAO A;  3LXU X;  4H61 A;  5DRV A;  5LC6 A;  1FYS A;  1SAR A;  1YGE A;  4JF8 A;  1ZS7 A;  3EE1 A;  1HYF A;  3SYU A;  1Q9E A;  1QAL A;  4N6O B;  3QRD A;  1YJW 3;  1RNT A;  2HMM B;  3VGN A;  1OGZ A;  1W00 A;  3LZA A;  1W2B 2;  1RCK A;  3K7C A;  5B0H A;  4EV5 A;  4WHA A;  1PY3 A;  5HGR A;  1CQS A;  3BIR A;  1F3Z A;  1VZZ A;  3M8C A;  4AKY A;  3CCR 3;  1JJ2 2;  5IG3 A;  3NV0 A;  2GU1 A;  2P09 A;  1O2F A;  1JZO A;  1GD4 A;  2CC3 A;  2JQ5 A;  4IIA A;  1BNF A;  4HVN A;  1HKX A;  4FMA A;  1KC8 4;  5IW9 A;  5CF1 A;  1US1 A;  2P0M A;  2R41 A;  3RNT A;  4ZYB A;  2CX1 A;  1WTH A;  4OVM A;  2QEX 3;  3UZ0 B;  4R4K A;  1NJI 4;  3I56 3;  5IG0 A;  2P05 A;  1BNI A;  2ZL8 A;  2KXG A;  3AGO A;  1M90 4;  3K0Z A;  1FUS A;  3CCL 3;  1S72 3;  2IUJ A;  1IDP A;  1GGR A;  2B1X B;  1FA3 A;  1OPY A;  3Q1C A;  5AIH A;  3WOD G;  1TRQ A;  2YFJ B;  1LNI A;  3JUQ A;  3J7Y d;  3DUK A;  4STD A;  2BMR B;  3CMA 3;  3H3H A;  3DGO A;  4HM4 B;  4WWU C;  1L5G B;  5CXO A;  3CNM A;  1RGG A;  2ZA4 A;  1M9G A;  1G0T A;  3KE7 A;  1ROA A;  2CK3 H;  4J5G A;  3DM8 A;  2GXF A;  3D5G A;  4J5K A;  1YJ9 3;  1FGR A;  1M1X B;  3CPW 2;  1KQS 2;  2CKF B;  2CFG A;  4HM1 B;  2BMQ B;  1NB3 I;  1SII A;  3NXJ A;  4K1U A;  4HM6 B;  4QP5 A;  3G6E 3;  2OTL 3;  2Z6B A;  5AII A;  3S27 A;  2CFL A;  1W7C A;  4LYL B;  1I8V A;  1B2S A;  2E2U A;  4FMC A;  3GZY B;  3B7C A;  3LTB A;  3NM7 A;  3PS8 A;  3B4O A;  1VQ7 3;  3CD6 3;  1RNB A;  1BNE A;  3OV4 A;  2CFK A;  3K5T A;  4H3U A;  1Q40 A;  2CWV A;  4CDL A;  1LRA A;  1DVD A;  2Z76 A;  3D5I A;  4RNZ A;  1GOU A;  1WQL B;  2L4V A;  3MKI A;  3HZP A;  1NDO B;  2W56 B;  2KAA A;  4AEQ A;  3SOY A;  2HSI A;  3WHO A;  2UX0 A;  1IQY A;  2GSP A;  3NX0 A;  3URP A;  4HM8 B;  1U5O A;  3UJM A;  1E97 A;  1RDS A;  1RN4 A;  1A2P A;  2KF5 A;  2KRT A;  5JPU A;  3V92 A;  5JBS A;  1J2B A;  3V99 A;  1TP6 A;  1RCL A;  1GSP A;  4HJL B;  1VQO 3;  4HZ9 B;  1GY5 A;  1O7G B;  1UCL A;  4RBN A;  2I9W A;  3CPO A;  3FKA A;  1IVU A;  3L0R A;  4K90 B;  5M1A A;  2IMJ A;  3EJV A;  7RNT A;  1BRN L;  5FW5 A;  4LXC A;  2Q07 A;  1BUJ A;  3EBT A;  3HOH A;  3CNX A;  3PYJ A;  3T8N A;  3MPH A;  1EQK A;  1K28 A;  1LOX A;  3LYG A;  4BH5 A;  2STD A;  2W6J H;  2B24 B;  2O9U X;  4LZI A;  6STD A;  1K8A 4;  4OUQ A;  2B13 A;  1OF5 A;  2BT3 A;  3D3L A;  1HZ1 A;  2Y74 A;  4FMB A;  5G1L A;  3SXX A;  3NQZ A;  1VQ5 3;  2F86 B;  1UUG B;  4HOH A;  1IK3 A;  1LOY A;  2W9Q A;  5BIR A;  2W0Q A;  2Z7A A;  3H51 A;  2CHC A;  5ELJ A;  2MP0 B;  1BNG A;  1LQM B;  3E99 A;  1JB2 A;  4XBX A;  4Q53 A;  3QK9 A;  4J8T A;  1O7P B;  2GU3 A;  4I4K A;  5M19 A;  3BNE A;  4R9L A;  4R9K A;  3PXM A;  2F56 A;  2WO0 A;  4IPB A;  3MWZ A;  2C10 A;  4CPK A;  1IVV A;  2R4I A;  2C4B A;  1UI7 A;  4HZB B;  1CYU A;  1FGQ A;  1N8Q A;  2XR8 B;  1UUW B;  4XBT A;  1SQW A;  1IYY A;  2YX9 A;  1QWY A;  4G1M B;  4MMY B;  5IEO A;  1AQZ A;  2F3G A;  6RNT A;  1DE3 A;  3I55 3;  3MG1 A;  2QIY A;  1N5H A;  2RBI A;  1BVI A;  3BNC A;  2HMK B;  3I0Y A;  4MMZ B;  1VQL 3;  3DMC A;  3MHE A;  1EUI C;  1BRK A;  1O7H B;  3OXA A;  4EV2 A;  1QVG 2;  2MC8 A;  2BU4 A;  1BGS A;  3SED A;  3LT8 A;  2UGI A;  3LML A;  4XDW A;  4WYK B;  1GLE F;  3FG3 A;  2HMO B;  2ZHX B;  3B8L A;  2INX A;  4HM7 B;  1LNH A;  3SLU A;  2GEY A;  3K9M C;  3N9H A;  1NB5 I;  2OCT A;  1KSI A;  2B0P A;  3FCS B;  2CG0 A;  3AHW A;  3X3Y A;  1JBT A;  1STD A;  1BRJ A;  3AGN A;  1VQM 3;  5RNT A;  1JB5 A;  3BLZ A;  3G0K A;  1FGO A;  4GL6 A;  3JUO A;  3GZR A;  4MMX B;  4O8S A;  1T2I A;  1T3B A;  1YGW A;  5KP1 A;  1N8R 4;  1S5A A;  1BNR A;  2O3O A;  1B27 A;  1Q40 B;  5FGO A;  3F9S A;  1BRH A;  3NHX A;  1DMM A;  1UCJ A;  4ZM8 A;  2F5W A;  5G2G A;  2W9P A;  1BRG A;  3BNB A;  1TRP A;  4CCV A;  4R80 A;  3NM2 A;  3UNL A;  1GD3 A;  3D9R A;  4L7K A;  5LC7 A;  4LGQ A;  1VQN 3;  2K3D A;  3KZT A;  3X42 A;  3LH4 A;  4QPB A;  5EVH A;  1TIJ A;  3CCJ 3;  5AEW B;  3IT7 A;  5KVP A;  5AIF A;  4EYC A;  1Q7H A;  2E2T A;  2XGN A;  4WP5 A;  5AIG A;  3KCH A;  1UCK A;  3GWR A;  1UDI I;  2Z77 A;  2KF4 A;  3IPT A;  5JPP A;  4WYK A;  3KSP A;  3S28 A;  3JUP A;  1ZGX A;  1ZO2 A;  2B44 A;  1CEW I;  2QGU A;  3G4S 3;  1JBS A;  1WMP A;  1SIH A;  1AVL A;  3O8Y A;  2HMN B;  1KWI A;  1X1U A;  4BL2 A;  1I0V A;  1OF5 B;  4JRF A;  2OTJ 3;  1RRH A;  1GMP A;  1JKG B;  1ZX2 A;  1MWT A;  3WOE B;  1Y4K A;  1O7W B;  3S67 A;  2GPR A;  1AR0 A;  3S29 A;  3DH2 A;  1UI8 A;  3GZB A;  1WMO A;  1X1X A;  1RGL A;  3F7X A;  2RGQ A;  1T5Y A;  4LSO A;  3OX9 A;  1FW7 A;  1UGH I;  1ULJ B;  1DET A;  1I2F A;  4N6L A;  7GSP A;  2XH9 A;  1MWU A;  1A2K A;  1W4N A;  3FG1 A;  4EXR A;  1TU5 A;  4HM0 B;  4U13 A;  2L1S A;  1BOX A;  3U97 A;  3HX8 A;  3LTA A;  4N6M A;  4TX4 A;  1Q81 4;  1A90 A;  1DYU A;  3G71 3;  1OUN A;  2H0H A;  2CFW A;  3CU3 A;  2CW9 A;  1D6Y A;  1OHS A;  1VQ6 3;  1RGF A;  4NPB A;  1JNQ A;  3KFQ C;  3NBJ A;  4PEJ A;  4XB5 A;  4EW5 A;  1RKY A;  1TUH A;  2XFS A;  2GBX B;  2RCD A;  2HOH A;  1IVW A;  1AV4 A;  1YI2 3;  4K61 A;  1GY6 A;  5STD A;  1Q7Y 4;  1BAN A;  2GBW B;  1MOL A;  4BTX A;  5HOH A;  2YFL B;  3T0U A;  1G02 A;  2IUK A;  3ZG5 A;  2C11 A;  2F4Y A;  2HML B;  2PZV A;  3WA2 X;  2XFT A;  3CC4 3;  2RSX A;  2PNC A;  4KFF A;  2XSO B;  3NUV A;  1D6Z A;  1Z1S A;  4GB5 A;  3N54 B;  5AYR B;  1JKG A;  4NHF A;  1OHO A;  2D42 A;  1IT7 A;  5M18 A;  3EF8 A;  3PZW A;  1CH0 A;  2XSH B;  1GOV A;  3CCQ 3;  5D83 A;  3DGN A;  1MWS A;  5CF2 A;  1M1K 4;  4XDV A;  5IG5 A;  2W03 A;  3PGB A;  1UGI A;  3NBR A;  4MEI A;  2AAE A;  1WNH A;  2CIU A;  5IEP A;  4N6T A;  4BTW A;  3TUF B;  1LVN A;  2RFR A;  4FMD A;  2OQE A;  1GPR A;  2A15 A;  1B2U A;  2XF3 A;  3FGY A;  1U8C B;  2XRX B;  3GSP A;  1JV2 B;  4NRE A;  3DGY A;  3DZL A;  3VSY A;  2CWU A;  3AHS A;  1K41 A;  3A5E A;  1NU3 A;  1YHQ 3;  1N5P A;  3A76 A;  3LTC A;  3X3Z A;  2UUG C;  2WOH A;  3CCS 3;  1BNS A;  2OOV A;  3U1W A;  3F8X A;  1C54 A;  1JB4 A;  2BMO B;  1EKM A;  1ULI B;  4O2H A;  3PCS A;  1RN1 A;  4RNT A;  1W2Z A;  1QJG A;  1OGX A;  3UL6 A;  4N6U A;  2BNG A;  4MJD A;  4X2H A;  5GSP A;  3SX1 A;  3V98 A;  4CJN A;  3ROB A;  1GYB A;  3FH1 A;  1K9M 4;  2BIR A;  1GLC F;  1LOV A;  4L8P A;  2RNT A;  1PU4 A;  1W6C A;  2HMJ B;  2OQE C;  3BND A;  1FGM A;  1FUT A;  3LTD A;  1W5Z A;  1IT8 A;  3FF0 A;  1FZU A;  1EG9 B;  3WA3 A;  1Q42 A;  3Q3F A;  3X40 A;  1DVC A;  3VF1 A;  1GLA F;  1B21 A;  3T8U A;  3CME 3;  1TFK A;  3CC7 3;  2OOV C;  1PFP A;  5CLK A;  5IF6 A;  1GMQ A;  3GAX A;  3GZX B;  4J9A A;  5EQL A;  3IMA B;  3S5C A;  3FSD A;  1LQG C;  1ISK A;  5KP3 A;  3WMD A;  5IEN A;  1RN7 A;  1JN5 A;  2KCD A;  1I2E A;  3EC9 A;  3EN8 A;  3Q2P A;  3EN1 B;  3F8H A;  4XM4 A;  3B4P A;  3OW2 2;  4HM5 B;  4KZ1 A;  4BU4 A;  1KD1 4;  3ER7 A;  1W6G A;  3OUR B;  1SJW A;  1NO3 A;  4N3V A;  1LOW A;  3GRD A;  4KFD A;  1BUQ A;  3EX9 A;  3UL5 A;  1IU7 A;  3MG2 A;  1QMA A;  4HM2 B;  1GS3 A;  3G8Z A;  3NQY A;  2CX0 A;  1QAK A;  1BRS A;  1VQ9 3;  1N9J A;  1RMS A;  1TFO A;  1GOY A;  1LXE A;  3X3X A;  3HI7 A;  3N8B A;  1O7M B;  1C7H A;  2F99 A;  5DRE A;  3FG4 A;  4FCZ A;  1GLB F;  2H0G A;  5BXQ A;  1QVF 2;  1RGA A;  1BSD A;  2P0X A;  3IJE B;  1AVK A;  2K54 A;  3JUM A;  1RSN A;  3ALA A;  4N6N B;  1RTU A;  5TGN A;  1I0X A;  5ELU A;  6GSP A;  1EEJ A;  1B20 A;  1TTO A;  1A67 A;  1GMR A;  2W2C A;  1OH0 A;  1PYL A;  3HK4 A;  4O02 B;  1JRQ A;  3FLJ A;  3K63 A;  4QWT A;  3D4A A;  1O7N B;  3STD A;  2FXT A;  3JUN A;  1B3S A;  3NBB A;  1R4C A;  1GY7 A;  3D79 A;  5D82 A;  3DY5 A;  3KII A;  3CC2 3;  1BSB A;  2MF7 A;  4WFO A;  1W02 A;  1DMQ A;  2GEX A;  1R4Y A;  3RDE A;  5KP4 A; 
#chains in the Genus database with same CATH homology
 1NWW A;  1W01 A;  1K73 4;  2CG1 A;  1HU9 A;  3EHC A;  3EQQ B;  1IQ8 A;  1YVB I;  4HM3 B;  3NYY A;  4OK0 A;  2BO9 B;  1RJO A;  1E3R A;  5D81 A;  4KVH A;  1VQ8 3;  3CXC 2;  3CSQ A;  1ROV A;  1VQ4 3;  3DXO A;  1VQK 3;  5AYS C;  3X41 A;  2LQV A;  3IT5 A;  3BB9 A;  3LT9 A;  4O3V A;  3AMO B;  4EC6 A;  5JBS A;  2K0M A;  2CH9 A;  3RGR A;  1N9E A;  3ECF A;  4K1V A;  1GLD F;  2D1W A;  2V1L A;  2M7O A;  1V74 A;  1FUW A;  1AX3 A;  1W6Y A;  4HBR A;  4R1K A;  2Y73 A;  2XGL A;  2ZDJ A;  3OWY A;  2BHM A;  8CHO A;  1OCV A;  4HKV B;  5CK6 A;  1Q82 4;  3F40 A;  4FCJ A;  1Q86 4;  1F8N A;  2CWT A;  3DGL A;  3RGA A;  4LEH A;  3LOY A;  4BTY A;  2IA7 A;  1OHP A;  4IT7 A;  3CCV 3;  2QA4 3;  2LYX A;  3KKG A;  2E2V A;  5AI1 A;  1IVX A;  1WMN A;  2WGQ A;  2F98 A;  2JDI H;  1STF I;  1UW1 A;  3UB1 A;  1JN5 B;  3DGM A;  1VQP 3;  5IG4 A;  1A2V A;  1ASK A;  3MG3 A;  1OAC A;  1QAF A;  4JBW M;  3EB8 A;  3F14 A;  3OWS A;  4KFE A;  2W04 A;  3HII A;  4ORL A;  4L8O A;  3JVC A;  2ML5 A;  3FZW A;  1DMN A;  4AKZ A;  3CCE 3;  2SBL A;  1FGT A;  3SVA A;  3AMO A;  3NV0 B;  5BVB A;  1D6U A;  1MNL A;  3KN4 A;  3FF2 A;  3WOF B;  3PCR A;  4XBY A;  1YJN 3;  1F3G A;  4N6V 0;  4FR9 A;  1RRL A;  3CCU 3;  1YIJ 3;  4FCM A;  2YFI B;  5IER A;  3Q90 A;  1IQX A;  2OWP A;  7STD A;  1YIT 3;  3CCM 3;  3MSO A;  2W56 A;  3EBY A;  4HYZ A;  5A0O B;  2WOF A;  3WDG B;  1G96 A;  3KSE D;  4X2O A;  4EBG A;  2FGT A;  3F7S A;  1E3V A;  2FNQ A;  1IV9 A;  1SPU A;  3G16 A;  1EA2 A;  1IV7 A;  3OWU A;  5AEU B;  2ML6 A;  5I97 A;  4RZM A;  2CFD A;  3SOA A;  4LMI A;  3MYT A;  2P38 A;  5EEO A;  3TDG A;  3HIG A;  2WGO A;  1UUV B;  2XEP A;  1CYV A;  4RNY A;  5DRV A;  3LXU X;  4H61 A;  5LC6 A;  1YGE A;  4JF8 A;  3EE1 A;  1QAL A;  4N6O B;  3QRD A;  1YJW 3;  2HMM B;  3VGN A;  1OGZ A;  1W00 A;  3LZA A;  1W2B 2;  3K7C A;  5B0H A;  4EV5 A;  4WHA A;  5HGR A;  1CQS A;  1F3Z A;  1VZZ A;  3M8C A;  4AKY A;  3CCR 3;  1JJ2 2;  5IG3 A;  3NV0 A;  2GU1 A;  2P09 A;  1O2F A;  1GD4 A;  2CC3 A;  2JQ5 A;  4IIA A;  4HVN A;  1HKX A;  4FMA A;  1KC8 4;  5IW9 A;  5CF1 A;  1US1 A;  2P0M A;  4ZYB A;  1WTH A;  4OVM A;  2QEX 3;  3UZ0 B;  4R4K A;  1NJI 4;  3I56 3;  5IG0 A;  2P05 A;  2ZL8 A;  2KXG A;  1M90 4;  3K0Z A;  3CCL 3;  1S72 3;  2IUJ A;  1IDP A;  1GGR A;  2B1X B;  1FA3 A;  1OPY A;  3Q1C A;  5AIH A;  3WOD G;  2YFJ B;  3JUQ A;  3J7Y d;  3DUK A;  4STD A;  2BMR B;  3CMA 3;  3H3H A;  3DGO A;  4HM4 B;  4WWU C;  1L5G B;  5CXO A;  3CNM A;  1M9G A;  3KE7 A;  1ROA A;  2CK3 H;  3DM8 A;  2GXF A;  1YJ9 3;  1FGR A;  1M1X B;  3CPW 2;  1KQS 2;  2CKF B;  2CFG A;  4HM1 B;  2BMQ B;  1NB3 I;  1SII A;  3NXJ A;  4K1U A;  4HM6 B;  4QP5 A;  3G6E 3;  2OTL 3;  2Z6B A;  5AII A;  3S27 A;  2CFL A;  1W7C A;  2E2U A;  4FMC A;  3GZY B;  3B7C A;  3LTB A;  3NM7 A;  3PS8 A;  3B4O A;  1VQ7 3;  3CD6 3;  3OV4 A;  2CFK A;  3K5T A;  4H3U A;  1Q40 A;  2CWV A;  4CDL A;  1DVD A;  2Z76 A;  4RNZ A;  1WQL B;  2L4V A;  3MKI A;  3HZP A;  1NDO B;  2W56 B;  4AEQ A;  3SOY A;  2HSI A;  2UX0 A;  1IQY A;  3NX0 A;  4HM8 B;  1U5O A;  3UJM A;  1E97 A;  2KRT A;  5JPU A;  1J2B A;  3V92 A;  3V99 A;  1TP6 A;  4HJL B;  1VQO 3;  4HZ9 B;  1GY5 A;  1O7G B;  4RBN A;  2I9W A;  3CPO A;  3FKA A;  1IVU A;  3L0R A;  4K90 B;  2IMJ A;  3EJV A;  5FW5 A;  4LXC A;  2Q07 A;  3EBT A;  3CNX A;  3PYJ A;  3T8N A;  3MPH A;  1EQK A;  1K28 A;  1LOX A;  3LYG A;  4BH5 A;  2STD A;  2W6J H;  2B24 B;  2O9U X;  4LZI A;  6STD A;  1K8A 4;  4OUQ A;  2B13 A;  1OF5 A;  2BT3 A;  3D3L A;  2Y74 A;  4FMB A;  3SXX A;  3NQZ A;  1VQ5 3;  2F86 B;  1IK3 A;  2W9Q A;  2W0Q A;  2Z7A A;  3H51 A;  2CHC A;  5ELJ A;  2MP0 B;  3E99 A;  1JB2 A;  4XBX A;  4Q53 A;  3QK9 A;  4J8T A;  1O7P B;  2GU3 A;  4I4K A;  3BNE A;  4R9L A;  4R9K A;  3PXM A;  2WO0 A;  4IPB A;  3MWZ A;  2C10 A;  1IVV A;  2R4I A;  4HZB B;  1UI7 A;  1CYU A;  1FGQ A;  1N8Q A;  2XR8 B;  1UUW B;  4XBT A;  1SQW A;  2YX9 A;  1QWY A;  4G1M B;  4MMY B;  5IEO A;  2F3G A;  3I55 3;  3MG1 A;  2QIY A;  1N5H A;  3I0Y A;  3BNC A;  2HMK B;  4MMZ B;  3DMC A;  3MHE A;  1O7H B;  3OXA A;  4EV2 A;  1QVG 2;  2MC8 A;  3SED A;  3LT8 A;  3LML A;  4XDW A;  4WYK B;  1GLE F;  3FG3 A;  2HMO B;  3B8L A;  4HM7 B;  2INX A;  1NB5 I;  1LNH A;  3SLU A;  2GEY A;  3K9M C;  3N9H A;  2OCT A;  1KSI A;  2B0P A;  3FCS B;  2CG0 A;  3X3Y A;  1STD A;  1VQM 3;  1JB5 A;  3BLZ A;  3G0K A;  1FGO A;  4GL6 A;  3JUO A;  3GZR A;  4MMX B;  4O8S A;  5KP1 A;  1N8R 4;  1S5A A;  2O3O A;  1Q40 B;  5FGO A;  3F9S A;  3NHX A;  1DMM A;  4ZM8 A;  5G2G A;  2W9P A;  3BNB A;  4CCV A;  4R80 A;  3NM2 A;  3UNL A;  1GD3 A;  3D9R A;  4L7K A;  5LC7 A;  4LGQ A;  1VQN 3;  3KZT A;  3X42 A;  3LH4 A;  4QPB A;  5EVH A;  1TIJ A;  3CCJ 3;  5AEW B;  3IT7 A;  5KVP A;  5AIF A;  4EYC A;  2E2T A;  2XGN A;  4WP5 A;  5AIG A;  3GWR A;  2Z77 A;  3IPT A;  5JPP A;  4WYK A;  3KSP A;  3S28 A;  3JUP A;  1ZO2 A;  2B44 A;  1CEW I;  2QGU A;  3G4S 3;  1WMP A;  1SIH A;  1AVL A;  3O8Y A;  2HMN B;  1KWI A;  1OF5 B;  4JRF A;  2OTJ 3;  1RRH A;  1JKG B;  1ZX2 A;  3WOE B;  1Y4K A;  1O7W B;  3S67 A;  2GPR A;  1AR0 A;  3S29 A;  1UI8 A;  3GZB A;  1WMO A;  3F7X A;  2RGQ A;  1T5Y A;  4LSO A;  3OX9 A;  1ULJ B;  4N6L A;  2XH9 A;  1A2K A;  1W4N A;  3FG1 A;  4EXR A;  1TU5 A;  4HM0 B;  4U13 A;  3U97 A;  1Q81 4;  3HX8 A;  3LTA A;  4N6M A;  4TX4 A;  1A90 A;  1DYU A;  3G71 3;  1OUN A;  2CFW A;  3CU3 A;  2CW9 A;  1D6Y A;  1OHS A;  1VQ6 3;  4PEJ A;  1JNQ A;  3KFQ C;  3NBJ A;  4XB5 A;  1RKY A;  1TUH A;  2XFS A;  2GBX B;  2RCD A;  1IVW A;  1AV4 A;  1YI2 3;  4K61 A;  1GY6 A;  5STD A;  1Q7Y 4;  2GBW B;  4BTX A;  1MOL A;  2YFL B;  3T0U A;  2IUK A;  2C11 A;  2HML B;  2PZV A;  3WA2 X;  2XFT A;  3CC4 3;  2RSX A;  2PNC A;  4KFF A;  2XSO B;  3NUV A;  1D6Z A;  1Z1S A;  4GB5 A;  3N54 B;  5AYR B;  1JKG A;  4NHF A;  1OHO A;  2D42 A;  1IT7 A;  3EF8 A;  3PZW A;  2XSH B;  3CCQ 3;  5D83 A;  3DGN A;  5CF2 A;  1M1K 4;  4XDV A;  5IG5 A;  2W03 A;  3PGB A;  3NBR A;  4MEI A;  1WNH A;  2CIU A;  5IEP A;  4N6T A;  4BTW A;  3TUF B;  1LVN A;  2RFR A;  4FMD A;  2OQE A;  1GPR A;  2A15 A;  2XF3 A;  3FGY A;  1U8C B;  2XRX B;  3VSY A;  1JV2 B;  4NRE A;  3DZL A;  2CWU A;  1K41 A;  1NU3 A;  1YHQ 3;  1N5P A;  3A76 A;  3LTC A;  3X3Z A;  2WOH A;  3CCS 3;  2OOV A;  3U1W A;  3F8X A;  1JB4 A;  2BMO B;  1EKM A;  1ULI B;  4O2H A;  3PCS A;  1W2Z A;  1QJG A;  1OGX A;  3UL6 A;  4N6U A;  2BNG A;  4MJD A;  4X2H A;  3SX1 A;  3V98 A;  1VQL 3;  1K9M 4;  3ROB A;  1GYB A;  3FH1 A;  1GLC F;  4L8P A;  1PU4 A;  1W6C A;  2HMJ B;  2OQE C;  3BND A;  1FGM A;  3LTD A;  1W5Z A;  1IT8 A;  3FF0 A;  1EG9 B;  3WA3 A;  1Q42 A;  3X40 A;  1DVC A;  3VF1 A;  1GLA F;  3CME 3;  3T8U A;  1TFK A;  3CC7 3;  2OOV C;  1PFP A;  5CLK A;  5IF6 A;  3GZX B;  3GAX A;  4J9A A;  5EQL A;  3IMA B;  3S5C A;  3FSD A;  1ISK A;  5KP3 A;  3WMD A;  5IEN A;  1RN7 A;  1JN5 A;  2KCD A;  3EC9 A;  3EN8 A;  3Q2P A;  3EN1 B;  3F8H A;  4XM4 A;  3B4P A;  3OW2 2;  4HM5 B;  4KZ1 A;  1KD1 4;  3ER7 A;  1W6G A;  3OUR B;  1SJW A;  1NO3 A;  4N3V A;  3GRD A;  4KFD A;  1BUQ A;  3EX9 A;  3UL5 A;  1IU7 A;  3MG2 A;  1QMA A;  4HM2 B;  1GS3 A;  3G8Z A;  3NQY A;  1QAK A;  1VQ9 3;  1N9J A;  1TFO A;  1LXE A;  3X3X A;  3HI7 A;  3N8B A;  1O7M B;  1C7H A;  2F99 A;  5DRE A;  3FG4 A;  4FCZ A;  1GLB F;  5BXQ A;  1QVF 2;  2P0X A;  3IJE B;  1AVK A;  2K54 A;  3JUM A;  3ALA A;  4N6N B;  5TGN A;  5ELU A;  1A67 A;  2W2C A;  1OH0 A;  4O02 B;  3HK4 A;  1JRQ A;  3FLJ A;  3K63 A;  4QWT A;  1O7N B;  3STD A;  2FXT A;  3JUN A;  3NBB A;  1R4C A;  1GY7 A;  5D82 A;  3DY5 A;  3KII A;  3CC2 3;  2MF7 A;  4WFO A;  1W02 A;  1DMQ A;  2GEX A;  3RDE A;  5KP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...