The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
sequence length |
162
|
structure length |
160
|
Chain Sequence |
HHTDPIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEHYLDVLLDNPLSDVRLVLKQAGLEVDQVKQAIASTYSREQVTYPAFSPLLVELLQEAWLLSSTELEQAELRSGAIFLAALTRADRYLSFKLISLFEGINRENLKKHFAMILSDSAET
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Molecular Basis for the Unique Role of the Aaa+ Chaperone Clpv in Type Vi Protein Secretion.
pubmed doi rcsb |
molecule tags |
Chaperone/peptide
|
source organism |
Vibrio cholerae
|
molecule keywords |
CLPB PROTEIN
|
total genus |
64
|
structure length |
160
|
sequence length |
162
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2011-06-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Double Clp-N motif | Clp, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1KHY A; 1QVR A; 3ZRI A; 3WDB A; 3FH2 A; 4Y0C A; 1MBV A; 4P15 A; 1KSF X; 1MBX A; 4Y0B A; 1R6C X; 3WDD A; 1R6B X; 5HBN A; 1MBU A; 4HH6 A; 2K77 A; 3WDE A; 4UQW A; 4IRF A; 1LZW B; 4IOD A; 3PXG A; 3FES A; 2Y1R A; 4HH5 A; 3WDC A; 1R6Q A; 5GUI A; 2Y1Q A; 1R6O A; 3ZRJ A; 1K6K A; 1MG9 B; #chains in the Genus database with same CATH topology 1KHY A; 1QVR A; 3ZRI A; 3WDB A; 3FH2 A; 4Y0C A; 1MBV A; 4P15 A; 1KSF X; 1MBX A; 4Y0B A; 1R6C X; 3WDD A; 1R6B X; 5HBN A; 1MBU A; 4HH6 A; 2K77 A; 3WDE A; 4UQW A; 4IRF A; 1LZW B; 4IOD A; 3PXG A; 3FES A; 2Y1R A; 4HH5 A; 3WDC A; 1R6Q A; 5GUI A; 2Y1Q A; 1R6O A; 3ZRJ A; 1K6K A; 1MG9 B; #chains in the Genus database with same CATH homology 1KHY A; 1QVR A; 3ZRI A; 3WDB A; 3FH2 A; 4Y0C A; 1MBV A; 4P15 A; 1KSF X; 1MBX A; 4Y0B A; 1R6C X; 3WDD A; 1R6B X; 5HBN A; 1MBU A; 4HH6 A; 2K77 A; 3WDE A; 4UQW A; 4IRF A; 1LZW B; 4IOD A; 3PXG A; 3FES A; 2Y1R A; 4HH5 A; 3WDC A; 1R6Q A; 5GUI A; 2Y1Q A; 1R6O A; 3ZRJ A; 1K6K A; 1MG9 B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...