3C2IA

The crystal structure of methyl-cpg binding domain of human mecp2 in complex with a methylated dna sequence from bdnf
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
72
structure length
72
Chain Sequence
RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIMYFEKVGDTSLDPNDFDFTVTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords Methyl-CpG-binding protein 2
publication title MeCP2 binding to DNA depends upon hydration at methyl-CpG
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01429 MBD Methyl-CpG binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.890.10 Alpha Beta 2-Layer Sandwich Methyl-cpg-binding Protein 2; Chain A Methyl-cpg-binding Protein 2; Chain A 3c2iA01
4LG7A 3VYBA 2MB7A 1D9NA 2KY8A 2MOEA 3C2IA 5BT2A 3VXVA 3VXXA 1QK9A 1IG4A 1UB1A 3VYQA
chains in the Genus database with same CATH superfamily
4LG7A 3VYBA 2MB7A 1D9NA 2KY8A 2MOEA 3C2IA 5BT2A 3VXVA 3VXXA 1QK9A 1IG4A 1UB1A 3VYQA
chains in the Genus database with same CATH topology
4LG7A 3VYBA 2MB7A 1D9NA 2KY8A 2MOEA 3C2IA 5BT2A 3VXVA 3VXXA 1QK9A 1IG4A 1UB1A 3VYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG7 A;  3VYB A;  2MB7 A;  1D9N A;  2KY8 A;  2MOE A;  3C2I A;  5BT2 A;  3VXV A;  3VXX A;  1QK9 A;  1IG4 A;  1UB1 A;  3VYQ A; 
#chains in the Genus database with same CATH topology
 4LG7 A;  3VYB A;  2MB7 A;  1D9N A;  2KY8 A;  2MOE A;  3C2I A;  5BT2 A;  3VXV A;  3VXX A;  1QK9 A;  1IG4 A;  1UB1 A;  3VYQ A; 
#chains in the Genus database with same CATH homology
 4LG7 A;  3VYB A;  2MB7 A;  1D9N A;  2KY8 A;  2MOE A;  3C2I A;  5BT2 A;  3VXV A;  3VXX A;  1QK9 A;  1IG4 A;  1UB1 A;  3VYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...