The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
61
|
sequence length |
145
|
structure length |
145
|
Chain Sequence |
QGKYLNRTINILNAGKNIAKSYGHNKLKPIHILSALAKSDYGSTLFKENNVNAANLKEYIDIALEQTRAGAPLDNKSKIVNSAEVKETLALAEAAANKYKSPKVDVEHLLSGLSNDELVNEIFNEVYLTDEAIKAILKRKFEKTL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural mapping of the ClpB ATPases of Plasmodium falciparum: Targeting protein folding and secretion for antimalarial drug design.
pubmed doi rcsb |
molecule tags |
Chaperone
|
source organism |
Plasmodium falciparum
|
molecule keywords |
MALARIAL CLPB2 ATPASE/HSP101 PROTEIN
|
total genus |
61
|
structure length |
145
|
sequence length |
145
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2013-01-14 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02861 | Clp_N | Clp amino terminal domain, pathogenicity island component |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Double Clp-N motif | Clp, N-terminal domain |
#chains in the Genus database with same CATH superfamily 1MBX A; 1QVR A; 3WDC A; 3PXG A; 1MG9 B; 3FH2 A; 4IOD A; 5GUI A; 2Y1R A; 1MBV A; 4IRF A; 2Y1Q A; 1R6Q A; 3WDB A; 1MBU A; 1R6C X; 4Y0C A; 1LZW B; 3FES A; 4P15 A; 1R6B X; 3ZRI A; 1KSF X; 2K77 A; 1K6K A; 1R6O A; 3WDE A; 5HBN A; 3WDD A; 4UQW A; 4Y0B A; 4HH5 A; 3ZRJ A; 4HH6 A; 1KHY A; #chains in the Genus database with same CATH topology 1MBX A; 1QVR A; 3WDC A; 3PXG A; 1MG9 B; 3FH2 A; 4IOD A; 5GUI A; 2Y1R A; 1MBV A; 4IRF A; 2Y1Q A; 1R6Q A; 3WDB A; 1MBU A; 1R6C X; 4Y0C A; 1LZW B; 3FES A; 4P15 A; 1R6B X; 3ZRI A; 1KSF X; 2K77 A; 1K6K A; 1R6O A; 3WDE A; 5HBN A; 3WDD A; 4UQW A; 4Y0B A; 4HH5 A; 3ZRJ A; 4HH6 A; 1KHY A; #chains in the Genus database with same CATH homology 1MBX A; 1QVR A; 3WDC A; 3PXG A; 1MG9 B; 3FH2 A; 4IOD A; 5GUI A; 2Y1R A; 1MBV A; 4IRF A; 2Y1Q A; 1R6Q A; 3WDB A; 1MBU A; 1R6C X; 4Y0C A; 1LZW B; 3FES A; 4P15 A; 1R6B X; 3ZRI A; 1KSF X; 2K77 A; 1K6K A; 1R6O A; 3WDE A; 5HBN A; 3WDD A; 4UQW A; 4Y0B A; 4HH5 A; 3ZRJ A; 4HH6 A; 1KHY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...