The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
89
|
sequence length |
214
|
structure length |
214
|
Chain Sequence |
MTVDFLSMVKYTPLFISGLIMTLKLTFLAVTIGVLMGLFIALMKMSSIKPIKLVASSYIEVIRGTPLLVQLLLIYNGLMQFGMNIPAFTAGVSALAINSSAYVAEIIRAGIQAVDPGQNEAARSLGMTHAMAMRYVIIPQAIKNILPALGNEFIVMLKESAIVSVIGFADLTRQADIIQSVTYRYFEPYIIIAAIYFVMTLTFSKLLSLFERRL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural basis for substrate specificity of an amino acid ABC transporter
pubmed doi rcsb |
| molecule tags |
Protein binding/transport protein
|
| source organism |
Caldanaerobacter subterraneus subsp. tengcongensis mb4
|
| molecule keywords |
ABC-type polar amino acid transport system, ATPase component
|
| total genus |
89
|
| structure length |
214
|
| sequence length |
214
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2015-03-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | MetI-like fold | MetI-like |
#chains in the Genus database with same CATH superfamily 3RLF F; 3PV0 G; 2R6G F; 3PUX F; 3PUZ G; 4KI0 G; 4XIG M; 3TUZ A; 3PUY F; 3TUJ A; 4XTC N; 4KHZ G; 2ONK C; 3RLF G; 3PUV F; 4JBW F; 4YMS C; 3DHW A; 3PUX G; 4XTC M; 2R6G G; 4YMU C; 3D31 C; 4YMW C; 3PUW F; 3TUI A; 3PUY G; 3PV0 F; 4TQU N; 3PUV G; 4YMT B; 4YMV C; 3PUZ F; 4JBW G; 4KI0 F; 4KHZ F; 3PUW G; 4TQU M; 4XIG N; #chains in the Genus database with same CATH topology 3RLF F; 3PV0 G; 2R6G F; 3PUX F; 3PUZ G; 4KI0 G; 4XIG M; 3TUZ A; 3PUY F; 3TUJ A; 4XTC N; 4KHZ G; 2ONK C; 3RLF G; 3PUV F; 4JBW F; 4YMS C; 3DHW A; 3PUX G; 4XTC M; 2R6G G; 4YMU C; 3D31 C; 4YMW C; 3PUW F; 3TUI A; 3PUY G; 3PV0 F; 4TQU N; 3PUV G; 4YMT B; 4YMV C; 3PUZ F; 4JBW G; 4KI0 F; 4KHZ F; 3PUW G; 4TQU M; 4XIG N; #chains in the Genus database with same CATH homology 3RLF F; 3PV0 G; 2R6G F; 3PUX F; 3PUZ G; 4KI0 G; 4XIG M; 3TUZ A; 3PUY F; 3TUJ A; 4XTC N; 4KHZ G; 2ONK C; 3RLF G; 3PUV F; 4JBW F; 4YMS C; 3DHW A; 3PUX G; 4XTC M; 2R6G G; 4YMU C; 3D31 C; 4YMW C; 3PUW F; 3TUI A; 3PUY G; 3PV0 F; 4TQU N; 3PUV G; 4YMT B; 4YMV C; 3PUZ F; 4JBW G; 4KI0 F; 4KHZ F; 3PUW G; 4TQU M; 4XIG N;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
